Citrus Sinensis ID: 017286

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQRTSSESFLMEEQPSWLDDLLNEPETPVRRGGHRRSSSDSFAYIDLVNASNLDYAAQDESRYKHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSARENVVLQNLGSPAQDADGVPSTTSEKLETAEAGPHDSKSSSEKKDNSHAKASASDTETKRAKQQFAQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLESLAQEQLIKCLEHEVLEREIGRLRVVYQQQQQQQPPQKPSSSHRRTSSRDLDSQFANLSLKHKDANSGHDPVTGPLHI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccc
ccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcHHHccccHHcccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHccccccccccccccccccccc
manskgssnirnslftgkhallppkspfpsispaysdylptgvigpkavqkpregsvhhqrtssesflmeeqpswlddllnepetpvrrgghrrsssdsfaYIDLvnasnldyaaqdeSRYKHlvsvpswgpqdidyhkdtrhspfyaelNSLKLknrawdnpinalphpgnlpsareNVVLqnlgspaqdadgvpsttsekletaeagphdsksssekkdnshakasasdTETKRAKQQFAQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLESLAQEQLIKCLEHEVLEREIGRLRVVYQQqqqqqppqkpssshrrtssrdlDSQFANLslkhkdansghdpvtgplhi
manskgssnirnslftgkhallppksPFPSISPAYSDYLPTGVIGPKavqkpregsvhhqrtssesflMEEQPSWLDDLLNEPETpvrrgghrrsssdsfAYIDLVNASNLDYAAQDESRYKHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSARENVVLQNLGSPAQDADGVPSTTSEKLetaeagphdsksssekkdnshakasasdtetkrakqqfaqrsRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLESLAQEQLIKCLEHEVLEREIGRLRVVYQqqqqqqppqkpssshrrtsSRDLDSQFANlslkhkdansghdpvtgplhi
MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQRTSSESFLMEEQPSWLDDLLNEPETPVrrgghrrsssdsFAYIDLVNASNLDYAAQDESRYKHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSARENVVLQNLGSPAQDADGVPSTTSEKLETAEAGPHDsksssekkDNSHAKASASDTETKRAKQQFAQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLESLAQEQLIKCLEHEVLEREIGRLRVVYqqqqqqqppqkpsssHRRTSSRDLDSQFANLSLKHKDANSGHDPVTGPLHI
*************************************YL************************************************************FAYIDLVNASNLDYAAQDESRYKHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPI*************************************************************************************LQYIAEL***************AELEFLNQQNLILSMENKALKQRLESLAQEQLIKCLEHEVLEREIGRLRVV****************************************************
***********************************************************************************************************************************************************************************************************************************************************YIAELERNVQSLQAEGTEVSAELEF**********************************V*EREIG*********************************************************
********NIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKA***********************QPSWLDDLLNEPE************SDSFAYIDLVNASNLDYAAQDESRYKHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSARENVVLQNLGSPA*********************************************************VRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLESLAQEQLIKCLEHEVLEREIGRLRVV*************************DSQFANLSLKHKDANSGHDPVTGPLHI
***************TGKHALLPPKSPFPSISPAYSDYLPT*****************************EQPSWLDDLLNEPE**************SFAYIDLVNASNLDYAAQDESRYKHLVSVPSWGPQDIDYHKDTRHSPFY************************************************************************************************RSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLESLAQEQLIKCLEHEVLEREIGRLRVVYQQQQQ**********************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQRTSSESFLMEEQPSWLDDLLNEPETPVRRGGHRRSSSDSFAYIDLVNASNLDYAAQDESRYKHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSARENVVLQNLGSPAQDADGVPSTTSEKLETAEAGPHDSKSSSEKKDNSHAKASASDTETKRAKQQFAQRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQLIKCLExxxxxxxxxxxxxxxxxxxxxQPPQKPSSSHRRTSSRDLDSQFANLSLKHKDANSGHDPVTGPLHI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query374 2.2.26 [Sep-21-2011]
Q8W3M7265 Uncharacterized protein A no no 0.689 0.973 0.511 1e-59
Q69IL4380 Transcription factor RF2a no no 0.344 0.339 0.392 1e-12
Q9MA75341 Transcription factor VIP1 no no 0.299 0.328 0.383 4e-11
Q04088398 Probable transcription fa no no 0.326 0.306 0.382 2e-10
Q6S4P4329 Transcription factor RF2b no no 0.229 0.261 0.406 7e-10
>sp|Q8W3M7|Y4598_ARATH Uncharacterized protein At4g06598 OS=Arabidopsis thaliana GN=At4g06598 PE=2 SV=2 Back     alignment and function desciption
 Score =  231 bits (588), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 177/272 (65%), Gaps = 14/272 (5%)

Query: 1   MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQ 60
           MA+SKGS N RN    GK ALLPPKSPF       +D++P+ VIG KAVQK  EG+ +H 
Sbjct: 1   MASSKGSQNHRNLGCNGKQALLPPKSPFTGGPTFSADFVPSSVIGSKAVQKLGEGNANHH 60

Query: 61  RTSSESFLMEEQPSWLDDLLNEPETPVRRGGHRRSSSDSFAYIDLVNASNLDYAAQDESR 120
           RTSSESFL+EEQPSWLDDLLNEPETPVR+GGHRRSSSDSFAY+D+    ++DY   D  R
Sbjct: 61  RTSSESFLIEEQPSWLDDLLNEPETPVRKGGHRRSSSDSFAYVDVPVGFDVDYTLWDGGR 120

Query: 121 Y--KHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSARE 178
           Y   +  S    GP++ DY + ++  PFY   +  K K R WD    +LP  G  P++  
Sbjct: 121 YNNNNGFSNHVRGPKESDYLR-SQPVPFYPSAHLSKQKIRPWD----SLPDSGARPNSSS 175

Query: 179 NVVLQNLGSPAQDADGVPSTTSEKLETAEAGPHD-----SKSSSEKKDNSHAKASASDTE 233
             +  +  + +  +  +  T  EK  +A     D     +KSS EK+DN  AK++ S+ +
Sbjct: 176 GCLESSSITRSGSSGSLRDT--EKAYSAADSKKDFINNFAKSSFEKRDNPLAKSATSEAD 233

Query: 234 TKRAKQQFAQRSRVRKLQYIAELERNVQSLQA 265
           TKRA+QQFAQRSRVRK+QYIAELERNVQ LQ 
Sbjct: 234 TKRARQQFAQRSRVRKIQYIAELERNVQMLQV 265

Arabidopsis thaliana (taxid: 3702)
>sp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1 Back     alignment and function description
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function description
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
255584594380 Transcription factor RF2a, putative [Ric 0.994 0.978 0.719 1e-150
356512598375 PREDICTED: uncharacterized membrane prot 0.983 0.981 0.701 1e-142
224118388368 predicted protein [Populus trichocarpa] 0.978 0.994 0.715 1e-141
356525369376 PREDICTED: uncharacterized membrane prot 0.983 0.978 0.694 1e-141
357519325377 Transcription factor bZIP63 [Medicago tr 0.986 0.978 0.685 1e-137
449457035377 PREDICTED: uncharacterized protein At4g0 0.991 0.984 0.680 1e-135
118488133368 unknown [Populus trichocarpa] 0.978 0.994 0.694 1e-133
357519327364 Transcription factor bZIP63 [Medicago tr 0.951 0.978 0.685 1e-132
224073258381 predicted protein [Populus trichocarpa] 0.981 0.963 0.670 1e-131
225448176374 PREDICTED: uncharacterized membrane prot 0.981 0.981 0.679 1e-130
>gi|255584594|ref|XP_002533021.1| Transcription factor RF2a, putative [Ricinus communis] gi|223527183|gb|EEF29352.1| Transcription factor RF2a, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 272/378 (71%), Positives = 320/378 (84%), Gaps = 6/378 (1%)

Query: 1   MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQ 60
           MANSKGS N+RN +++GKHALLPPK PFPS+SP+Y DY+P+ VIG KAVQ+PREG+ HHQ
Sbjct: 1   MANSKGSPNVRNLMYSGKHALLPPKIPFPSVSPSYVDYVPSNVIGSKAVQRPREGNAHHQ 60

Query: 61  RTSSESFLMEEQPSWLDDLLNEPETPVRRGGHRRSSSDSFAYIDLVNASNLDYAAQDESR 120
           RTSSE+ L+EEQPSWLDDLLNEPETPVRRGGHRRSSSDSFAYID+ N SN+DY+ QD+ R
Sbjct: 61  RTSSETLLIEEQPSWLDDLLNEPETPVRRGGHRRSSSDSFAYIDVANVSNIDYSTQDDYR 120

Query: 121 YKHLVSV-PSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSAREN 179
           YK+++SV PSWGPQD DYHKD R     A++N  K KNR W++ +N       LPS+REN
Sbjct: 121 YKNMMSVLPSWGPQDYDYHKDARQVSLCADVNMSKQKNRTWESSLNPAARQSGLPSSREN 180

Query: 180 VVLQNLGSPA--QDADGVPSTTSEKLETAEAGPHDSKSSSEKKDNSHAKASASDTETKRA 237
            V Q+  S    Q+ADG+ S+ SEK ++AE+GPHDSK+SS++KD  HAK+S S+T+TKRA
Sbjct: 181 AVSQSSVSSCALQEADGIQSSLSEKQDSAESGPHDSKASSDRKDGCHAKSSVSETDTKRA 240

Query: 238 KQQFAQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLES 297
           KQQFAQRSRVRKLQYIAELERNVQ+LQAEG+EVSAE+EFLNQQNLIL+MENKALKQRLES
Sbjct: 241 KQQFAQRSRVRKLQYIAELERNVQALQAEGSEVSAEVEFLNQQNLILNMENKALKQRLES 300

Query: 298 LAQEQLIKCLEHEVLEREIGRLRVVYQ---QQQQQQPPQKPSSSHRRTSSRDLDSQFANL 354
           LAQEQLIK LEHEVLEREIGRLR +Y+   Q QQ Q  Q+PSSSHRRT+SRDL+SQF NL
Sbjct: 301 LAQEQLIKYLEHEVLEREIGRLRALYKQQQQPQQPQQQQQPSSSHRRTNSRDLESQFGNL 360

Query: 355 SLKHKDANSGHDPVTGPL 372
           SLKHKDA+ G DPVTGPL
Sbjct: 361 SLKHKDASPGRDPVTGPL 378

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356512598|ref|XP_003525005.1| PREDICTED: uncharacterized membrane protein At4g06598-like [Glycine max] Back     alignment and taxonomy information
>gi|224118388|ref|XP_002331470.1| predicted protein [Populus trichocarpa] gi|222873548|gb|EEF10679.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356525369|ref|XP_003531297.1| PREDICTED: uncharacterized membrane protein At4g06598 [Glycine max] Back     alignment and taxonomy information
>gi|357519325|ref|XP_003629951.1| Transcription factor bZIP63 [Medicago truncatula] gi|355523973|gb|AET04427.1| Transcription factor bZIP63 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449457035|ref|XP_004146254.1| PREDICTED: uncharacterized protein At4g06598-like [Cucumis sativus] gi|449495535|ref|XP_004159870.1| PREDICTED: uncharacterized protein At4g06598-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|118488133|gb|ABK95886.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357519327|ref|XP_003629952.1| Transcription factor bZIP63 [Medicago truncatula] gi|355523974|gb|AET04428.1| Transcription factor bZIP63 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224073258|ref|XP_002304048.1| predicted protein [Populus trichocarpa] gi|222841480|gb|EEE79027.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225448176|ref|XP_002266061.1| PREDICTED: uncharacterized membrane protein At4g06598 [Vitis vinifera] gi|147788552|emb|CAN61016.1| hypothetical protein VITISV_021778 [Vitis vinifera] gi|297739555|emb|CBI29737.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
TAIR|locus:2196225374 AT1G58110 "AT1G58110" [Arabido 0.981 0.981 0.503 2.6e-86
TAIR|locus:2008673300 AT1G35490 "AT1G35490" [Arabido 0.243 0.303 0.549 4.2e-30
TAIR|locus:2085425329 BZIP61 [Arabidopsis thaliana ( 0.663 0.753 0.281 1e-20
TAIR|locus:2053761321 BZIP34 "AT2G42380" [Arabidopsi 0.304 0.355 0.474 2.7e-20
TAIR|locus:2175473307 AT5G04840 "AT5G04840" [Arabido 0.224 0.273 0.476 1.5e-15
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.363 0.398 0.352 1.8e-12
TAIR|locus:2198856423 AT1G06070 "AT1G06070" [Arabido 0.422 0.373 0.341 5.7e-11
TAIR|locus:2061908367 AT2G40620 "AT2G40620" [Arabido 0.318 0.324 0.367 1.2e-09
TAIR|locus:2141826553 AT4G38900 "AT4G38900" [Arabido 0.227 0.153 0.4 2.4e-09
TAIR|locus:2033123337 bZIP52 "AT1G06850" [Arabidopsi 0.395 0.439 0.306 4.7e-09
TAIR|locus:2196225 AT1G58110 "AT1G58110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 863 (308.9 bits), Expect = 2.6e-86, P = 2.6e-86
 Identities = 191/379 (50%), Positives = 251/379 (66%)

Query:     1 MANSKGSSNIRNSLFTGKHALLPPKSPFPSISPAYSDYLPTGVIGPKAVQKPREGSVHHQ 60
             MA+SKGS ++RN ++ GKHALLPPK PFPS+S +YS+Y+PTG+IG +  QK      HHQ
Sbjct:     1 MASSKGSQSVRNLMYPGKHALLPPKIPFPSVSASYSEYIPTGLIGSRHGQKLSNEKTHHQ 60

Query:    61 RTSSESFLMEEQPSWLDDLLNE-PETPVXXXXXXXXXXXXFAYIDLVNASNLDYAAQDES 119
             RTSSES L+EE P WLDDLLNE PE+P             +AY+D+ NA+N+    Q++ 
Sbjct:    61 RTSSESHLVEELPFWLDDLLNEQPESPARKCGHRRSSSDSYAYLDVANATNISLTLQNDF 120

Query:   120 RYKHLVSVPSWGPQDIDYHKDTRHSPFYAELNSLKLKNRAWDNPINALPHPGNLPSAREN 179
              Y++ V     G Q++D +K+ + + FY+  + LK K+R  D+ +     P  LP AREN
Sbjct:   121 SYRNTVLSTQRGVQELDRNKNAQDAAFYSGASFLKQKSRQRDSLVATGACPSWLPFAREN 180

Query:   180 VVLQNLGS--PAQDADGVPSTTSEKLETAEAGPHDXXXXXXXXDNSHAKASASDTE-TKR 236
                +NLG+   +QDA  +   +SE+   AE   HD        +NS+      + + TKR
Sbjct:   181 GGGKNLGALYMSQDATVI---SSERKNYAEPFSHDPKMLSSEENNSNPSPVTYEADNTKR 237

Query:   237 AKQQFAQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKALKQRLE 296
             AKQQFAQRSRVRKLQYI+ELERNVQ+LQAEG++VSAEL+FLNQ+NLILSMENKALK+RLE
Sbjct:   238 AKQQFAQRSRVRKLQYISELERNVQTLQAEGSKVSAELDFLNQRNLILSMENKALKKRLE 297

Query:   297 SLAQEQLIKCLEHEVLEREIGRLRVVYXXXXXXXXXXXXXXXHRRTSSRDLDSQFANLSL 356
             S+AQE+LIK LE EVLE+EIGRLR +Y                 R +S+DLDSQF++LSL
Sbjct:   298 SIAQEKLIKQLEQEVLEKEIGRLRALYQQQQQTQKPSASRG---RATSKDLDSQFSSLSL 354

Query:   357 KHKDANSGHDPVT--GPLH 373
               KD+N   D V+  G  H
Sbjct:   355 NTKDSNCRRDSVSVMGQFH 373
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0009612 "response to mechanical stimulus" evidence=RCA
GO:0019722 "calcium-mediated signaling" evidence=RCA
TAIR|locus:2008673 AT1G35490 "AT1G35490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085425 BZIP61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053761 BZIP34 "AT2G42380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175473 AT5G04840 "AT5G04840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01630045
hypothetical protein (369 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-06
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 2e-04
pfam06156106 pfam06156, DUF972, Protein of unknown function (DU 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 45.2 bits (108), Expect = 1e-06
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 242 AQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMENKA 290
           A+RSR RK   I ELER V+ L+AE   +  E+E L ++   L  E + 
Sbjct: 17  ARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSELEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|218915 pfam06156, DUF972, Protein of unknown function (DUF972) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 374
smart0033865 BRLZ basic region leucin zipper. 98.9
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 98.75
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 98.36
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 97.85
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 97.51
KOG0709472 consensus CREB/ATF family transcription factor [Tr 97.42
KOG0837279 consensus Transcriptional activator of the JUN fam 97.06
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 96.85
PRK13169110 DNA replication intiation control protein YabA; Re 96.71
KOG4571294 consensus Activating transcription factor 4 [Trans 96.64
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 96.27
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.22
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.19
COG4467114 Regulator of replication initiation timing [Replic 95.82
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.76
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 95.65
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.54
PRK10884206 SH3 domain-containing protein; Provisional 95.52
KOG3584348 consensus cAMP response element binding protein an 95.3
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.79
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 94.53
COG2433 652 Uncharacterized conserved protein [Function unknow 94.41
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.15
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.67
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 93.64
PF14662193 CCDC155: Coiled-coil region of CCDC155 93.57
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 93.29
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 93.18
PRK1542279 septal ring assembly protein ZapB; Provisional 92.79
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 92.63
KOG3119269 consensus Basic region leucine zipper transcriptio 92.59
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 92.58
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.51
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 92.5
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 92.48
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 92.4
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 92.22
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.21
COG2433652 Uncharacterized conserved protein [Function unknow 92.18
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 92.14
PRK0211973 hypothetical protein; Provisional 91.91
PRK11637 428 AmiB activator; Provisional 91.82
PRK0029568 hypothetical protein; Provisional 91.77
PRK11637 428 AmiB activator; Provisional 91.73
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.71
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 91.69
PRK0432574 hypothetical protein; Provisional 91.64
PRK0073668 hypothetical protein; Provisional 91.15
PF10186 302 Atg14: UV radiation resistance protein and autopha 91.06
PF00038 312 Filament: Intermediate filament protein; InterPro: 90.75
PRK0279372 phi X174 lysis protein; Provisional 90.57
PRK10884206 SH3 domain-containing protein; Provisional 90.06
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 90.02
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 89.95
TIGR0244965 conserved hypothetical protein TIGR02449. Members 89.94
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 89.8
PRK0084677 hypothetical protein; Provisional 89.63
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 89.61
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 89.47
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 89.44
PRK0440675 hypothetical protein; Provisional 89.36
PRK13922 276 rod shape-determining protein MreC; Provisional 89.19
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 89.12
PF00038312 Filament: Intermediate filament protein; InterPro: 89.08
PRK09039343 hypothetical protein; Validated 88.79
TIGR0244965 conserved hypothetical protein TIGR02449. Members 88.68
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 88.63
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 88.53
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 88.45
KOG4807593 consensus F-actin binding protein, regulates actin 88.25
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 87.97
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 87.89
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 87.87
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 87.19
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 87.04
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 86.95
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 86.91
KOG1103 561 consensus Predicted coiled-coil protein [Function 86.81
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 86.8
PRK09039 343 hypothetical protein; Validated 86.59
PF10186 302 Atg14: UV radiation resistance protein and autopha 86.51
PF06216 389 RTBV_P46: Rice tungro bacilliform virus P46 protei 86.29
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 86.09
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 85.72
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 85.56
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 85.43
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 85.4
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 85.32
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 84.92
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 84.7
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 84.35
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 84.23
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 84.22
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 84.16
PF15058200 Speriolin_N: Speriolin N terminus 83.93
PF14817 632 HAUS5: HAUS augmin-like complex subunit 5 83.76
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 83.64
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 83.6
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 83.59
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 83.54
PRK1542279 septal ring assembly protein ZapB; Provisional 83.48
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 83.46
COG307479 Uncharacterized protein conserved in bacteria [Fun 83.46
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 83.43
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 83.29
KOG4196135 consensus bZIP transcription factor MafK [Transcri 83.17
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 83.16
PHA02562 562 46 endonuclease subunit; Provisional 83.01
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 82.86
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 82.7
PF15290 305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 82.6
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 82.46
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 82.4
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 82.13
KOG3650120 consensus Predicted coiled-coil protein [General f 82.12
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 82.08
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 82.05
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 82.04
COG4372 499 Uncharacterized protein conserved in bacteria with 82.01
PF1374789 DUF4164: Domain of unknown function (DUF4164) 82.01
PF15294278 Leu_zip: Leucine zipper 81.96
PRK10803263 tol-pal system protein YbgF; Provisional 81.83
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 81.67
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 81.51
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 81.27
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 81.14
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 81.06
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 80.85
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 80.81
TIGR02231 525 conserved hypothetical protein. This family consis 80.71
PF06428100 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP 80.68
KOG4673961 consensus Transcription factor TMF, TATA element m 80.65
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 80.64
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 80.42
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 80.41
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=98.90  E-value=6.3e-09  Score=79.98  Aligned_cols=56  Identities=39%  Similarity=0.475  Sum_probs=49.6

Q ss_pred             hhhHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHhHHHHHhh
Q 017286          233 ETKRAK-----QQFAQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLILSMEN  288 (374)
Q Consensus       233 DpKRaK-----RqSAqRSR~RKlqYI~ELErkVq~LQ~E~a~Ls~~i~~L~~~~~~L~~EN  288 (374)
                      |+|+.+     |.+|+++|+||.+||.+||.+|+.|+.++..|..+|..|..+...|..+|
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            667776     49999999999999999999999999999999999999877777776655

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF06216 RTBV_P46: Rice tungro bacilliform virus P46 protein; InterPro: IPR009347 This family consists of several Rice tungro bacilliform virus P46 proteins Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PF14817 HAUS5: HAUS augmin-like complex subunit 5 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 3e-07
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-06
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 3e-05
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 4e-05
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 7e-05
2wt7_B90 Transcription factor MAFB; transcription, transcri 1e-04
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 4e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-04
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
 Score = 46.6 bits (110), Expect = 3e-07
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 226 KASASDTETKRAKQ-QFAQRS-RVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQNLI 283
           K S  +  +KR  Q + AQR+ R RK  ++  LE  V +L+   +  + E + L Q+   
Sbjct: 2   KNSDQEPSSKRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQ 61

Query: 284 LSMENKALK 292
           L  E + LK
Sbjct: 62  LEEELRILK 70
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 98.96
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 98.68
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 98.66
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 98.6
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.57
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 98.56
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.06
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 97.44
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.39
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 97.35
2wt7_B90 Transcription factor MAFB; transcription, transcri 96.16
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 96.04
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.55
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.04
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.43
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.4
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 94.11
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.74
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 93.54
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 93.05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.07
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 91.72
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 91.39
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 90.67
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 90.59
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 90.33
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 90.13
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 90.06
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 89.62
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 89.5
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 89.03
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 88.91
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 88.61
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 88.6
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 87.52
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 87.37
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 87.36
1deb_A54 APC protein, adenomatous polyposis coli protein; c 86.71
3m48_A33 General control protein GCN4; leucine zipper, synt 86.57
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.52
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 86.44
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 86.06
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 85.35
3cve_A72 Homer protein homolog 1; coiled coil, alternative 85.17
3m48_A33 General control protein GCN4; leucine zipper, synt 84.39
3m0d_C65 TNF receptor-associated factor 1; trimeric helix c 84.37
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 84.16
2j5u_A 255 MREC protein; bacterial cell shape determining pro 84.11
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 83.9
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 83.4
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 83.02
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 82.75
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 82.34
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 82.27
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 82.01
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 81.99
2wt7_B90 Transcription factor MAFB; transcription, transcri 81.97
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 81.86
4ati_A118 MITF, microphthalmia-associated transcription fact 81.77
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 81.71
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 81.68
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 81.68
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 81.57
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 81.26
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 80.7
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 80.5
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 80.36
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=98.96  E-value=1e-09  Score=82.21  Aligned_cols=43  Identities=28%  Similarity=0.415  Sum_probs=40.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHh
Q 017286          239 QQFAQRSRVRKLQYIAELERNVQSLQAEGTEVSAELEFLNQQN  281 (374)
Q Consensus       239 RqSAqRSR~RKlqYI~ELErkVq~LQ~E~a~Ls~~i~~L~~~~  281 (374)
                      |+||+|||.||++||.+||.+|..|+.|+..|..+|..|++..
T Consensus        10 ResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A           10 REAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6999999999999999999999999999999999999987653
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3m0d_C TNF receptor-associated factor 1; trimeric helix coiled coiled, acetylation, alternative splic apoptosis, coiled coil, cytoplasm; 2.80A {Homo sapiens} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 81.51
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: tRNA-binding arm
family: Seryl-tRNA synthetase (SerRS)
domain: Seryl-tRNA synthetase (SerRS)
species: Thermus thermophilus, strain hb27 [TaxId: 274]

Probab=81.51  E-value=9.1  Score=28.96  Aligned_cols=31  Identities=29%  Similarity=0.397  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHhhHHHHHHHHHHHHH
Q 017286          250 LQYIAELERNVQSLQAEGTEVSAELEFLNQQ  280 (374)
Q Consensus       250 lqYI~ELErkVq~LQ~E~a~Ls~~i~~L~~~  280 (374)
                      +..|.+|..+...|+.+...|.++...+..+
T Consensus        27 ld~i~~ld~~rr~l~~~~e~l~~~rN~~sk~   57 (110)
T d1seta1          27 LEALLALDREVQELKKRLQEVQTERNQVAKR   57 (110)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4456666666666666666666665555444