Citrus Sinensis ID: 017744
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 366 | ||||||
| 224144239 | 401 | predicted protein [Populus trichocarpa] | 0.972 | 0.887 | 0.861 | 0.0 | |
| 449507378 | 423 | PREDICTED: ethanolamine-phosphate cytidy | 0.961 | 0.832 | 0.831 | 1e-171 | |
| 225462533 | 431 | PREDICTED: ethanolamine-phosphate cytidy | 0.972 | 0.825 | 0.812 | 1e-170 | |
| 356513223 | 420 | PREDICTED: ethanolamine-phosphate cytidy | 0.950 | 0.828 | 0.802 | 1e-168 | |
| 356523761 | 420 | PREDICTED: ethanolamine-phosphate cytidy | 0.950 | 0.828 | 0.805 | 1e-168 | |
| 224090479 | 395 | predicted protein [Populus trichocarpa] | 0.898 | 0.832 | 0.802 | 1e-165 | |
| 357520661 | 418 | Ethanolamine-phosphate cytidylyltransfer | 0.961 | 0.842 | 0.784 | 1e-159 | |
| 217074798 | 418 | unknown [Medicago truncatula] gi|3885155 | 0.961 | 0.842 | 0.781 | 1e-159 | |
| 357520663 | 431 | Ethanolamine-phosphate cytidylyltransfer | 0.961 | 0.816 | 0.754 | 1e-156 | |
| 255570558 | 377 | conserved hypothetical protein [Ricinus | 0.800 | 0.777 | 0.864 | 1e-145 |
| >gi|224144239|ref|XP_002325231.1| predicted protein [Populus trichocarpa] gi|222866665|gb|EEF03796.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 643 bits (1659), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 310/360 (86%), Positives = 334/360 (92%), Gaps = 4/360 (1%)
Query: 3 MEYESNSWIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSD--CFHKKKC 60
MEYES+S IWDG+YYYPH FGGLMLTAALLG+STSYFGG+G SLP++WSD FHKKKC
Sbjct: 1 MEYESSSSIWDGVYYYPHLFGGLMLTAALLGLSTSYFGGLGFSSLPYMWSDLGIFHKKKC 60
Query: 61 GKKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPVLSMEERL 120
+KKR+RVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEI+ANKGPPVLSMEERL
Sbjct: 61 -QKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPVLSMEERL 119
Query: 121 ALVSGLKWVDEVIANAPYAITEQFMNRLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKVG 180
ALVSGLKWVDEVIA+APYAITE+FMN LFNEHKIDYIIHGDDPCLLPDGTDAYALAKK G
Sbjct: 120 ALVSGLKWVDEVIADAPYAITEKFMNSLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKAG 179
Query: 181 RYKQIKRTEGVSSTDIVGRILSSMEDTKACEDHNN-ASLPRDPLRAIQSKDAHLSQFLPT 239
RYKQIKRTEGVSSTDIVGRILSS++DTKACE+H++ +SLP L+ QS AH+SQFLPT
Sbjct: 180 RYKQIKRTEGVSSTDIVGRILSSLKDTKACENHDDSSSLPGIALKGSQSNSAHISQFLPT 239
Query: 240 SRRIVQFSNCKGPGPNARVVYIDGAFDLFHAGHVEILKKARQLGDFLLVGIYTDQIVSEH 299
SRRIVQFSN KGPGPNARVVYIDGAFDLFHAGHVEIL+ ARQLGDFLLVGI+TDQIVSEH
Sbjct: 240 SRRIVQFSNGKGPGPNARVVYIDGAFDLFHAGHVEILRSARQLGDFLLVGIHTDQIVSEH 299
Query: 300 RGSYHPIMHLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFNICLVVHGTVSETNTPLT 359
RG HPIMHLHERSLSVLACRYVDEVIIGAPWEVTKDM+TTFNI LVVHGTV+E N+ L
Sbjct: 300 RGKGHPIMHLHERSLSVLACRYVDEVIIGAPWEVTKDMVTTFNITLVVHGTVAENNSLLA 359
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449507378|ref|XP_004163014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225462533|ref|XP_002265606.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356513223|ref|XP_003525313.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356523761|ref|XP_003530503.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224090479|ref|XP_002308992.1| predicted protein [Populus trichocarpa] gi|222854968|gb|EEE92515.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357520661|ref|XP_003630619.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula] gi|355524641|gb|AET05095.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217074798|gb|ACJ85759.1| unknown [Medicago truncatula] gi|388515515|gb|AFK45819.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357520663|ref|XP_003630620.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula] gi|355524642|gb|AET05096.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255570558|ref|XP_002526236.1| conserved hypothetical protein [Ricinus communis] gi|223534430|gb|EEF36133.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 366 | ||||||
| TAIR|locus:2064123 | 421 | PECT1 "phosphorylethanolamine | 0.792 | 0.688 | 0.715 | 1.9e-113 | |
| DICTYBASE|DDB_G0270298 | 360 | pctA "cytidylyltransferase dom | 0.754 | 0.766 | 0.536 | 2.3e-78 | |
| RGD|619970 | 404 | Pcyt2 "phosphate cytidylyltran | 0.360 | 0.326 | 0.529 | 2.3e-70 | |
| MGI|MGI:1915921 | 404 | Pcyt2 "phosphate cytidylyltran | 0.360 | 0.326 | 0.529 | 2.3e-70 | |
| UNIPROTKB|F5H8B1 | 407 | PCYT2 "Ethanolamine-phosphate | 0.360 | 0.324 | 0.529 | 2.3e-70 | |
| UNIPROTKB|I3L2Q1 | 308 | PCYT2 "Ethanolamine-phosphate | 0.729 | 0.866 | 0.486 | 2.6e-70 | |
| UNIPROTKB|Q99447 | 389 | PCYT2 "Ethanolamine-phosphate | 0.756 | 0.712 | 0.470 | 4.9e-69 | |
| WB|WBGene00021352 | 377 | Y37E3.11 [Caenorhabditis elega | 0.806 | 0.782 | 0.446 | 1.3e-68 | |
| UNIPROTKB|Q5EA75 | 389 | PCYT2 "Ethanolamine-phosphate | 0.756 | 0.712 | 0.470 | 1.7e-68 | |
| ZFIN|ZDB-GENE-041010-132 | 397 | pcyt2 "phosphate cytidylyltran | 0.756 | 0.697 | 0.465 | 7.2e-68 |
| TAIR|locus:2064123 PECT1 "phosphorylethanolamine cytidylyltransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1119 (399.0 bits), Expect = 1.9e-113, P = 1.9e-113
Identities = 214/299 (71%), Positives = 251/299 (83%)
Query: 66 VRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPVLSMEERLALVSG 125
VRVYMDGCFD+MHYGH NALRQA+ALGD+LVVGVVSDEEIIANKGPPV + ER+ +V
Sbjct: 55 VRVYMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPVTPLHERMTMVKA 114
Query: 126 LKWVDEVIANAPYAITEQFMNRLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKVGRYKQI 185
+KWVDEVI++APYAITE FM +LF+E++IDYIIHGDDPC+LPDGTDAYALAKK GRYKQI
Sbjct: 115 VKWVDEVISDAPYAITEDFMKKLFDEYQIDYIIHGDDPCVLPDGTDAYALAKKAGRYKQI 174
Query: 186 KRTEGVSSTDIVGRILSSMEDTKACEDHNNASLPRD-------PL--RAIQSKDAHLSQF 236
KRTEGVSSTDIVGR+L + + + H+ +SL R P S +S F
Sbjct: 175 KRTEGVSSTDIVGRMLLCVRERSISDTHSRSSLQRQFSHGHSSPKFEDGASSAGTRVSHF 234
Query: 237 LPTSRRIVQFSNCKGPGPNARVVYIDGAFDLFHAGHVEILKKARQLGDFLLVGIYTDQIV 296
LPTSRRIVQFSN KGPGP+AR++YIDGAFDLFHAGHVEIL++AR+LGDFLLVGI+ DQ V
Sbjct: 235 LPTSRRIVQFSNGKGPGPDARIIYIDGAFDLFHAGHVEILRRARELGDFLLVGIHNDQTV 294
Query: 297 SEHRGSYHPIMHLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFNICLVVHGTVSETN 355
S RG++ PIM+LHERSLSVLACRYVDEVIIGAPWEV++D ITTF+I LVVHGTV+E++
Sbjct: 295 SAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESD 353
|
|
| DICTYBASE|DDB_G0270298 pctA "cytidylyltransferase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| RGD|619970 Pcyt2 "phosphate cytidylyltransferase 2, ethanolamine" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915921 Pcyt2 "phosphate cytidylyltransferase 2, ethanolamine" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H8B1 PCYT2 "Ethanolamine-phosphate cytidylyltransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L2Q1 PCYT2 "Ethanolamine-phosphate cytidylyltransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99447 PCYT2 "Ethanolamine-phosphate cytidylyltransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00021352 Y37E3.11 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5EA75 PCYT2 "Ethanolamine-phosphate cytidylyltransferase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041010-132 pcyt2 "phosphate cytidylyltransferase 2, ethanolamine" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_XVIII0261 | ethanolamine-phosphate cytidylyltransferase (EC-2.7.7.14) (401 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| grail3.0028024201 | • | • | 0.901 | ||||||||
| gw1.III.525.1 | • | 0.900 | |||||||||
| gw1.X.421.1 | • | 0.899 | |||||||||
| gw1.I.6971.1 | • | 0.899 | |||||||||
| fgenesh4_pg.C_LG_II000596 | • | 0.899 | |||||||||
| estExt_Genewise1_v1.C_LG_VIII2313 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 366 | |||
| PLN02406 | 418 | PLN02406, PLN02406, ethanolamine-phosphate cytidyl | 0.0 | |
| PTZ00308 | 353 | PTZ00308, PTZ00308, ethanolamine-phosphate cytidyl | 1e-133 | |
| cd02174 | 150 | cd02174, CCT, CTP:phosphocholine cytidylyltransfer | 2e-75 | |
| cd02173 | 152 | cd02173, ECT, CTP:phosphoethanolamine cytidylyltra | 1e-57 | |
| COG0615 | 140 | COG0615, TagD, Cytidylyltransferase [Cell envelope | 7e-41 | |
| cd02170 | 136 | cd02170, cytidylyltransferase, cytidylyltransferas | 3e-38 | |
| PLN02413 | 294 | PLN02413, PLN02413, choline-phosphate cytidylyltra | 5e-35 | |
| cd02173 | 152 | cd02173, ECT, CTP:phosphoethanolamine cytidylyltra | 6e-35 | |
| PTZ00308 | 353 | PTZ00308, PTZ00308, ethanolamine-phosphate cytidyl | 2e-29 | |
| cd02174 | 150 | cd02174, CCT, CTP:phosphocholine cytidylyltransfer | 1e-28 | |
| COG0615 | 140 | COG0615, TagD, Cytidylyltransferase [Cell envelope | 1e-24 | |
| cd02170 | 136 | cd02170, cytidylyltransferase, cytidylyltransferas | 4e-23 | |
| PTZ00308 | 353 | PTZ00308, PTZ00308, ethanolamine-phosphate cytidyl | 7e-22 | |
| PLN02406 | 418 | PLN02406, PLN02406, ethanolamine-phosphate cytidyl | 1e-20 | |
| TIGR00125 | 66 | TIGR00125, cyt_tran_rel, cytidyltransferase-like d | 8e-19 | |
| TIGR02199 | 144 | TIGR02199, rfaE_dom_II, rfaE bifunctional protein, | 9e-19 | |
| cd02171 | 129 | cd02171, G3P_Cytidylyltransferase, glycerol-3-phos | 6e-16 | |
| TIGR00125 | 66 | TIGR00125, cyt_tran_rel, cytidyltransferase-like d | 8e-16 | |
| PLN02413 | 294 | PLN02413, PLN02413, choline-phosphate cytidylyltra | 1e-15 | |
| COG2870 | 467 | COG2870, RfaE, ADP-heptose synthase, bifunctional | 4e-15 | |
| TIGR01518 | 125 | TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate c | 9e-15 | |
| TIGR01518 | 125 | TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate c | 2e-14 | |
| PRK11316 | 473 | PRK11316, PRK11316, bifunctional heptose 7-phospha | 3e-14 | |
| cd02172 | 144 | cd02172, RfaE_N, N-terminal domain of RfaE | 7e-14 | |
| pfam01467 | 148 | pfam01467, CTP_transf_2, Cytidylyltransferase | 9e-14 | |
| TIGR02199 | 144 | TIGR02199, rfaE_dom_II, rfaE bifunctional protein, | 1e-13 | |
| cd02171 | 129 | cd02171, G3P_Cytidylyltransferase, glycerol-3-phos | 3e-13 | |
| cd02172 | 144 | cd02172, RfaE_N, N-terminal domain of RfaE | 3e-12 | |
| COG2870 | 467 | COG2870, RfaE, ADP-heptose synthase, bifunctional | 9e-11 | |
| PRK00777 | 153 | PRK00777, PRK00777, phosphopantetheine adenylyltra | 4e-10 | |
| PRK11316 | 473 | PRK11316, PRK11316, bifunctional heptose 7-phospha | 1e-09 | |
| pfam01467 | 148 | pfam01467, CTP_transf_2, Cytidylyltransferase | 3e-09 | |
| PRK00777 | 153 | PRK00777, PRK00777, phosphopantetheine adenylyltra | 2e-08 | |
| COG1019 | 158 | COG1019, COG1019, Predicted nucleotidyltransferase | 9e-06 | |
| PRK01170 | 322 | PRK01170, PRK01170, phosphopantetheine adenylyltra | 7e-05 | |
| cd02156 | 105 | cd02156, nt_trans, nucleotidyl transferase superfa | 2e-04 | |
| PRK01170 | 322 | PRK01170, PRK01170, phosphopantetheine adenylyltra | 3e-04 | |
| cd02064 | 180 | cd02064, FAD_synthetase_N, FAD synthetase, N-termi | 3e-04 | |
| cd02163 | 153 | cd02163, PPAT, Phosphopantetheine adenylyltransfer | 6e-04 | |
| TIGR01510 | 155 | TIGR01510, coaD_prev_kdtB, pantetheine-phosphate a | 6e-04 | |
| COG1019 | 158 | COG1019, COG1019, Predicted nucleotidyltransferase | 7e-04 | |
| COG0669 | 159 | COG0669, CoaD, Phosphopantetheine adenylyltransfer | 0.001 | |
| COG0196 | 304 | COG0196, RibF, FAD synthase [Coenzyme metabolism] | 0.002 | |
| PRK00168 | 159 | PRK00168, coaD, phosphopantetheine adenylyltransfe | 0.003 | |
| PRK13964 | 140 | PRK13964, coaD, phosphopantetheine adenylyltransfe | 0.003 |
| >gnl|CDD|215227 PLN02406, PLN02406, ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
Score = 617 bits (1592), Expect = 0.0
Identities = 251/354 (70%), Positives = 281/354 (79%), Gaps = 11/354 (3%)
Query: 9 SWIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSDCFHKKKCGKKKRVRV 68
I Y GGLML A++LG+S + FG SLP+ W D KK KKK VRV
Sbjct: 1 MSISSAKYVASCLIGGLMLGASVLGLSLAGFG----SSLPYAWPDLGIFKKKKKKKPVRV 56
Query: 69 YMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPVLSMEERLALVSGLKW 128
YMDGCFD+MHYGHANALRQA+ALGDELVVGVVSDEEIIANKGPPV M ER+ +VSG+KW
Sbjct: 57 YMDGCFDMMHYGHANALRQARALGDELVVGVVSDEEIIANKGPPVTPMHERMIMVSGVKW 116
Query: 129 VDEVIANAPYAITEQFMNRLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKVGRYKQIKRT 188
VDEVI +APYAITE+FMN+LFNE+ IDYIIHGDDPCLLPDGTDAYALAKK GRYKQIKRT
Sbjct: 117 VDEVIPDAPYAITEEFMNKLFNEYNIDYIIHGDDPCLLPDGTDAYALAKKAGRYKQIKRT 176
Query: 189 EGVSSTDIVGRILSSMEDTKACEDHNNASLPRD-------PLRAIQSKDAHLSQFLPTSR 241
EGVSSTDIVGR+L + + + HN++SL R +S FLPTSR
Sbjct: 177 EGVSSTDIVGRMLLCVRERSISDSHNHSSLQRQFSHGHSQFEDGGSGSGTRVSHFLPTSR 236
Query: 242 RIVQFSNCKGPGPNARVVYIDGAFDLFHAGHVEILKKARQLGDFLLVGIYTDQIVSEHRG 301
RIVQFSN KGPGP+AR+VYIDGAFDLFHAGHVEIL+ AR LGDFLLVGI+TDQ VS HRG
Sbjct: 237 RIVQFSNGKGPGPDARIVYIDGAFDLFHAGHVEILRLARALGDFLLVGIHTDQTVSAHRG 296
Query: 302 SYHPIMHLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFNICLVVHGTVSETN 355
++ PIM+LHERSLSVLACRYVDEVIIGAPWEV+KDMITTFNI LVVHGTV+E N
Sbjct: 297 AHRPIMNLHERSLSVLACRYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAENN 350
|
Length = 418 |
| >gnl|CDD|140329 PTZ00308, PTZ00308, ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173925 cd02174, CCT, CTP:phosphocholine cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173924 cd02173, ECT, CTP:phosphoethanolamine cytidylyltransferase (ECT) | Back alignment and domain information |
|---|
| >gnl|CDD|223688 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215229 PLN02413, PLN02413, choline-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173924 cd02173, ECT, CTP:phosphoethanolamine cytidylyltransferase (ECT) | Back alignment and domain information |
|---|
| >gnl|CDD|140329 PTZ00308, PTZ00308, ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173925 cd02174, CCT, CTP:phosphocholine cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223688 COG0615, TagD, Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|173921 cd02170, cytidylyltransferase, cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|140329 PTZ00308, PTZ00308, ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215227 PLN02406, PLN02406, ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|232837 TIGR00125, cyt_tran_rel, cytidyltransferase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|131254 TIGR02199, rfaE_dom_II, rfaE bifunctional protein, domain II | Back alignment and domain information |
|---|
| >gnl|CDD|173922 cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|232837 TIGR00125, cyt_tran_rel, cytidyltransferase-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215229 PLN02413, PLN02413, choline-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225425 COG2870, RfaE, ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|130581 TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|130581 TIGR01518, g3p_cytidyltrns, glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|183085 PRK11316, PRK11316, bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173923 cd02172, RfaE_N, N-terminal domain of RfaE | Back alignment and domain information |
|---|
| >gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|131254 TIGR02199, rfaE_dom_II, rfaE bifunctional protein, domain II | Back alignment and domain information |
|---|
| >gnl|CDD|173922 cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|173923 cd02172, RfaE_N, N-terminal domain of RfaE | Back alignment and domain information |
|---|
| >gnl|CDD|225425 COG2870, RfaE, ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234834 PRK00777, PRK00777, phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183085 PRK11316, PRK11316, bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216517 pfam01467, CTP_transf_2, Cytidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|234834 PRK00777, PRK00777, phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223950 COG1019, COG1019, Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234912 PRK01170, PRK01170, phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173912 cd02156, nt_trans, nucleotidyl transferase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|234912 PRK01170, PRK01170, phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185679 cd02064, FAD_synthetase_N, FAD synthetase, N-terminal domain of the bifunctional enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|173914 cd02163, PPAT, Phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233444 TIGR01510, coaD_prev_kdtB, pantetheine-phosphate adenylyltransferase, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|223950 COG1019, COG1019, Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223741 COG0669, CoaD, Phosphopantetheine adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223274 COG0196, RibF, FAD synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234674 PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184424 PRK13964, coaD, phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| PLN02406 | 418 | ethanolamine-phosphate cytidylyltransferase | 100.0 | |
| KOG2803 | 358 | consensus Choline phosphate cytidylyltransferase/P | 100.0 | |
| PTZ00308 | 353 | ethanolamine-phosphate cytidylyltransferase; Provi | 100.0 | |
| cd02174 | 150 | CCT CTP:phosphocholine cytidylyltransferase. CTP:p | 99.97 | |
| PLN02413 | 294 | choline-phosphate cytidylyltransferase | 99.97 | |
| COG0615 | 140 | TagD Cytidylyltransferase [Cell envelope biogenesi | 99.97 | |
| PLN02406 | 418 | ethanolamine-phosphate cytidylyltransferase | 99.96 | |
| KOG2804 | 348 | consensus Phosphorylcholine transferase/cholinepho | 99.96 | |
| cd02173 | 152 | ECT CTP:phosphoethanolamine cytidylyltransferase ( | 99.96 | |
| cd02170 | 136 | cytidylyltransferase cytidylyltransferase. The cyt | 99.95 | |
| cd02172 | 144 | RfaE_N N-terminal domain of RfaE. RfaE is a protei | 99.95 | |
| PTZ00308 | 353 | ethanolamine-phosphate cytidylyltransferase; Provi | 99.95 | |
| cd02173 | 152 | ECT CTP:phosphoethanolamine cytidylyltransferase ( | 99.95 | |
| cd02174 | 150 | CCT CTP:phosphocholine cytidylyltransferase. CTP:p | 99.94 | |
| TIGR02199 | 144 | rfaE_dom_II rfaE bifunctional protein, domain II. | 99.94 | |
| TIGR01518 | 125 | g3p_cytidyltrns glycerol-3-phosphate cytidylyltran | 99.93 | |
| COG0615 | 140 | TagD Cytidylyltransferase [Cell envelope biogenesi | 99.93 | |
| cd02171 | 129 | G3P_Cytidylyltransferase glycerol-3-phosphate cyti | 99.93 | |
| PLN02413 | 294 | choline-phosphate cytidylyltransferase | 99.92 | |
| KOG2803 | 358 | consensus Choline phosphate cytidylyltransferase/P | 99.89 | |
| PRK07143 | 279 | hypothetical protein; Provisional | 99.88 | |
| cd02064 | 180 | FAD_synthetase_N FAD synthetase, N-terminal domain | 99.88 | |
| PRK11316 | 473 | bifunctional heptose 7-phosphate kinase/heptose 1- | 99.86 | |
| PRK05627 | 305 | bifunctional riboflavin kinase/FMN adenylyltransfe | 99.86 | |
| PF06574 | 157 | FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof | 99.83 | |
| COG0669 | 159 | CoaD Phosphopantetheine adenylyltransferase [Coenz | 99.82 | |
| TIGR00083 | 288 | ribF riboflavin kinase/FMN adenylyltransferase. mu | 99.82 | |
| COG2870 | 467 | RfaE ADP-heptose synthase, bifunctional sugar kina | 99.82 | |
| KOG2804 | 348 | consensus Phosphorylcholine transferase/cholinepho | 99.81 | |
| COG2870 | 467 | RfaE ADP-heptose synthase, bifunctional sugar kina | 99.8 | |
| TIGR01518 | 125 | g3p_cytidyltrns glycerol-3-phosphate cytidylyltran | 99.79 | |
| cd02170 | 136 | cytidylyltransferase cytidylyltransferase. The cyt | 99.79 | |
| TIGR02199 | 144 | rfaE_dom_II rfaE bifunctional protein, domain II. | 99.79 | |
| cd02172 | 144 | RfaE_N N-terminal domain of RfaE. RfaE is a protei | 99.78 | |
| COG0196 | 304 | RibF FAD synthase [Coenzyme metabolism] | 99.78 | |
| cd02171 | 129 | G3P_Cytidylyltransferase glycerol-3-phosphate cyti | 99.77 | |
| cd02039 | 143 | cytidylyltransferase_like Cytidylyltransferase-lik | 99.75 | |
| PRK00777 | 153 | phosphopantetheine adenylyltransferase; Provisiona | 99.72 | |
| PRK11316 | 473 | bifunctional heptose 7-phosphate kinase/heptose 1- | 99.72 | |
| PRK13964 | 140 | coaD phosphopantetheine adenylyltransferase; Provi | 99.7 | |
| PRK00168 | 159 | coaD phosphopantetheine adenylyltransferase; Provi | 99.65 | |
| PRK00777 | 153 | phosphopantetheine adenylyltransferase; Provisiona | 99.6 | |
| smart00764 | 182 | Citrate_ly_lig Citrate lyase ligase C-terminal dom | 99.59 | |
| PRK00168 | 159 | coaD phosphopantetheine adenylyltransferase; Provi | 99.57 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 99.57 | |
| PLN02388 | 177 | phosphopantetheine adenylyltransferase | 99.56 | |
| TIGR01527 | 165 | arch_NMN_Atrans nicotinamide-nucleotide adenylyltr | 99.55 | |
| PRK01170 | 322 | phosphopantetheine adenylyltransferase/unknown dom | 99.54 | |
| cd02163 | 153 | PPAT Phosphopantetheine adenylyltransferase. Phosp | 99.51 | |
| TIGR00125 | 66 | cyt_tran_rel cytidyltransferase-related domain. Pr | 99.51 | |
| cd02163 | 153 | PPAT Phosphopantetheine adenylyltransferase. Phosp | 99.49 | |
| PRK01170 | 322 | phosphopantetheine adenylyltransferase/unknown dom | 99.49 | |
| TIGR00125 | 66 | cyt_tran_rel cytidyltransferase-related domain. Pr | 99.45 | |
| PF01467 | 157 | CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 | 99.45 | |
| cd02166 | 163 | NMNAT_Archaea Nicotinamide/nicotinate mononucleoti | 99.45 | |
| TIGR01510 | 155 | coaD_prev_kdtB pantetheine-phosphate adenylyltrans | 99.44 | |
| TIGR01510 | 155 | coaD_prev_kdtB pantetheine-phosphate adenylyltrans | 99.43 | |
| COG1057 | 197 | NadD Nicotinic acid mononucleotide adenylyltransfe | 99.42 | |
| PRK00071 | 203 | nadD nicotinic acid mononucleotide adenylyltransfe | 99.41 | |
| cd02164 | 143 | PPAT_CoAS phosphopantetheine adenylyltransferase d | 99.41 | |
| cd02039 | 143 | cytidylyltransferase_like Cytidylyltransferase-lik | 99.39 | |
| PF01467 | 157 | CTP_transf_2: Cytidylyltransferase; InterPro: IPR0 | 99.39 | |
| PRK06973 | 243 | nicotinic acid mononucleotide adenylyltransferase; | 99.37 | |
| cd02165 | 192 | NMNAT Nicotinamide/nicotinate mononucleotide adeny | 99.36 | |
| TIGR00482 | 193 | nicotinate (nicotinamide) nucleotide adenylyltrans | 99.31 | |
| TIGR01527 | 165 | arch_NMN_Atrans nicotinamide-nucleotide adenylyltr | 99.31 | |
| PRK08887 | 174 | nicotinic acid mononucleotide adenylyltransferase; | 99.3 | |
| cd02064 | 180 | FAD_synthetase_N FAD synthetase, N-terminal domain | 99.28 | |
| COG1019 | 158 | Predicted nucleotidyltransferase [General function | 99.27 | |
| cd02168 | 181 | NMNAT_Nudix Nicotinamide/nicotinate mononucleotide | 99.25 | |
| PRK13964 | 140 | coaD phosphopantetheine adenylyltransferase; Provi | 99.23 | |
| PRK01153 | 174 | nicotinamide-nucleotide adenylyltransferase; Provi | 99.22 | |
| PRK07152 | 342 | nadD putative nicotinate-nucleotide adenylyltransf | 99.22 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.21 | |
| cd02166 | 163 | NMNAT_Archaea Nicotinamide/nicotinate mononucleoti | 99.19 | |
| cd02167 | 158 | NMNAT_NadR Nicotinamide/nicotinate mononucleotide | 99.15 | |
| cd02164 | 143 | PPAT_CoAS phosphopantetheine adenylyltransferase d | 99.14 | |
| cd02156 | 105 | nt_trans nucleotidyl transferase superfamily. nt_t | 99.09 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.06 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 99.02 | |
| cd02167 | 158 | NMNAT_NadR Nicotinamide/nicotinate mononucleotide | 99.02 | |
| cd02168 | 181 | NMNAT_Nudix Nicotinamide/nicotinate mononucleotide | 99.01 | |
| PRK05627 | 305 | bifunctional riboflavin kinase/FMN adenylyltransfe | 99.01 | |
| PRK13670 | 388 | hypothetical protein; Provisional | 99.0 | |
| COG0669 | 159 | CoaD Phosphopantetheine adenylyltransferase [Coenz | 98.97 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.93 | |
| COG1019 | 158 | Predicted nucleotidyltransferase [General function | 98.93 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 98.92 | |
| cd09286 | 225 | NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti | 98.91 | |
| PLN02945 | 236 | nicotinamide-nucleotide adenylyltransferase/nicoti | 98.9 | |
| PRK00071 | 203 | nadD nicotinic acid mononucleotide adenylyltransfe | 98.88 | |
| cd02165 | 192 | NMNAT Nicotinamide/nicotinate mononucleotide adeny | 98.86 | |
| cd00560 | 277 | PanC Pantoate-beta-alanine ligase. PanC Pantoate-b | 98.82 | |
| PLN02388 | 177 | phosphopantetheine adenylyltransferase | 98.81 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 98.81 | |
| PRK01153 | 174 | nicotinamide-nucleotide adenylyltransferase; Provi | 98.81 | |
| PRK07143 | 279 | hypothetical protein; Provisional | 98.8 | |
| PRK08887 | 174 | nicotinic acid mononucleotide adenylyltransferase; | 98.77 | |
| PRK00380 | 281 | panC pantoate--beta-alanine ligase; Reviewed | 98.76 | |
| cd02156 | 105 | nt_trans nucleotidyl transferase superfamily. nt_t | 98.75 | |
| PRK13793 | 196 | nicotinamide-nucleotide adenylyltransferase; Provi | 98.74 | |
| PRK13671 | 298 | hypothetical protein; Provisional | 98.7 | |
| PRK13793 | 196 | nicotinamide-nucleotide adenylyltransferase; Provi | 98.69 | |
| PRK13671 | 298 | hypothetical protein; Provisional | 98.68 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.67 | |
| TIGR00482 | 193 | nicotinate (nicotinamide) nucleotide adenylyltrans | 98.59 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 98.59 | |
| PRK07152 | 342 | nadD putative nicotinate-nucleotide adenylyltransf | 98.51 | |
| smart00764 | 182 | Citrate_ly_lig Citrate lyase ligase C-terminal dom | 98.51 | |
| KOG3351 | 293 | consensus Predicted nucleotidyltransferase [Genera | 98.5 | |
| COG1056 | 172 | NadR Nicotinamide mononucleotide adenylyltransfera | 98.47 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 98.43 | |
| COG1057 | 197 | NadD Nicotinic acid mononucleotide adenylyltransfe | 98.36 | |
| PRK06973 | 243 | nicotinic acid mononucleotide adenylyltransferase; | 98.33 | |
| COG1056 | 172 | NadR Nicotinamide mononucleotide adenylyltransfera | 98.33 | |
| cd09286 | 225 | NMNAT_Eukarya Nicotinamide/nicotinate mononucleoti | 98.18 | |
| PF06574 | 157 | FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof | 98.18 | |
| KOG3351 | 293 | consensus Predicted nucleotidyltransferase [Genera | 98.13 | |
| PLN02945 | 236 | nicotinamide-nucleotide adenylyltransferase/nicoti | 98.05 | |
| TIGR00083 | 288 | ribF riboflavin kinase/FMN adenylyltransferase. mu | 97.93 | |
| PF08218 | 182 | Citrate_ly_lig: Citrate lyase ligase C-terminal do | 97.93 | |
| TIGR00018 | 282 | panC pantoate--beta-alanine ligase. This family is | 97.91 | |
| PLN02660 | 284 | pantoate--beta-alanine ligase | 97.82 | |
| PRK13670 | 388 | hypothetical protein; Provisional | 97.8 | |
| COG1323 | 358 | Predicted nucleotidyltransferase [General function | 97.44 | |
| PF08218 | 182 | Citrate_ly_lig: Citrate lyase ligase C-terminal do | 97.38 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 97.33 | |
| PF05636 | 388 | HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr | 97.26 | |
| COG0196 | 304 | RibF FAD synthase [Coenzyme metabolism] | 97.23 | |
| COG1323 | 358 | Predicted nucleotidyltransferase [General function | 97.06 | |
| TIGR00339 | 383 | sopT ATP sulphurylase. Members of this family also | 96.92 | |
| PF05636 | 388 | HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPr | 96.77 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 96.54 | |
| TIGR00018 | 282 | panC pantoate--beta-alanine ligase. This family is | 96.01 | |
| PRK00380 | 281 | panC pantoate--beta-alanine ligase; Reviewed | 96.01 | |
| PLN02660 | 284 | pantoate--beta-alanine ligase | 95.7 | |
| cd00560 | 277 | PanC Pantoate-beta-alanine ligase. PanC Pantoate-b | 94.99 | |
| PF02569 | 280 | Pantoate_ligase: Pantoate-beta-alanine ligase; Int | 94.7 | |
| COG0414 | 285 | PanC Panthothenate synthetase [Coenzyme metabolism | 94.27 | |
| COG2046 | 397 | MET3 ATP sulfurylase (sulfate adenylyltransferase) | 93.82 | |
| PRK04149 | 391 | sat sulfate adenylyltransferase; Reviewed | 93.82 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 93.68 | |
| TIGR00339 | 383 | sopT ATP sulphurylase. Members of this family also | 93.41 | |
| cd00517 | 353 | ATPS ATP-sulfurylase. ATP-sulfurylase (ATPS), also | 92.68 | |
| PF01747 | 215 | ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002 | 92.61 | |
| PF02569 | 280 | Pantoate_ligase: Pantoate-beta-alanine ligase; Int | 92.34 | |
| KOG3199 | 234 | consensus Nicotinamide mononucleotide adenylyl tra | 92.33 | |
| COG0414 | 285 | PanC Panthothenate synthetase [Coenzyme metabolism | 92.03 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 90.99 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 90.8 | |
| KOG3042 | 283 | consensus Panthothenate synthetase [Coenzyme trans | 90.44 | |
| KOG3199 | 234 | consensus Nicotinamide mononucleotide adenylyl tra | 84.89 | |
| KOG3042 | 283 | consensus Panthothenate synthetase [Coenzyme trans | 82.38 |
| >PLN02406 ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-76 Score=587.96 Aligned_cols=341 Identities=73% Similarity=1.133 Sum_probs=305.4
Q ss_pred cccccccccccchhhhHHHHHhhhhccccccCcccccCcccchHHhhhcccCCCCCeEEEEecccCcCCHHHHHHHHHHH
Q 017744 10 WIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSDCFHKKKCGKKKRVRVYMDGCFDLMHYGHANALRQAK 89 (366)
Q Consensus 10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~~G~FD~lH~GH~~lL~qAk 89 (366)
+.|.+.++++|++|++|+++|+||+++++++. ..|++|+..-..+++++.++.|||++||||++|.||.++|+||+
T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~rV~~~G~FDllH~GH~~~L~qAk 77 (418)
T PLN02406 2 SISSAKYVASCLIGGLMLGASVLGLSLAGFGS----SLPYAWPDLGIFKKKKKKKPVRVYMDGCFDMMHYGHANALRQAR 77 (418)
T ss_pred CccccceeeehhhHHHHHHHHHHHHHhccccc----cccccchhhhhhccccCCCceEEEEcCeeCCCCHHHHHHHHHHH
Confidence 45678889999999999999999999998872 25666766222244555677899999999999999999999999
Q ss_pred HhCCeeEEEEccchhhhhcCCCCCCcHHHHHHHHhcCccccEEEecCCccccHHHHHHHhhccCccEEEEcCCCCCCCCC
Q 017744 90 ALGDELVVGVVSDEEIIANKGPPVLSMEERLALVSGLKWVDEVIANAPYAITEQFMNRLFNEHKIDYIIHGDDPCLLPDG 169 (366)
Q Consensus 90 ~lgd~LvVgv~sd~~i~~~K~~pi~t~eER~~ll~~~~~VD~vv~~~p~~~~~eFl~~ll~~l~~d~VV~G~D~~fg~~g 169 (366)
++||+|+|||++|+++.++|++|+++++||++++++|+|||+|++++||.++.+|+.+++++++||++|||+||+...++
T Consensus 78 ~lGd~LIVGV~SDe~i~~~Kg~PV~~~eER~~~v~alk~VD~Vv~~apy~~~~d~~~~li~~~~~D~vVhGdD~~~~~~g 157 (418)
T PLN02406 78 ALGDELVVGVVSDEEIIANKGPPVTPMHERMIMVSGVKWVDEVIPDAPYAITEEFMNKLFNEYNIDYIIHGDDPCLLPDG 157 (418)
T ss_pred HhCCEEEEEEecChhhhccCCCCcCCHHHHHHHHHhcCCCceEEeCCccccchHHHHHHHHHhCCCEEEECCCccccCCc
Confidence 99999999999999998889999999999999999999999999999999999999888899999999999999988899
Q ss_pred CchHHHHHhCCeEEEeccCCCCCHHHHHHHHHhccccccccccccCCCCCCCchh-------hhccCcccccccccccce
Q 017744 170 TDAYALAKKVGRYKQIKRTEGVSSTDIVGRILSSMEDTKACEDHNNASLPRDPLR-------AIQSKDAHLSQFLPTSRR 242 (366)
Q Consensus 170 ~~~~~~lk~~g~~~~v~r~~~vSST~Ir~rI~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~ 242 (366)
.+.|...+..|++++++|++++|||+|++||+.++++++....+...++.++|+. .+.+..+.+++|++|+++
T Consensus 158 ~d~y~~~k~~Gr~~~i~rt~GvSTTdIv~Ril~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~ 237 (418)
T PLN02406 158 TDAYALAKKAGRYKQIKRTEGVSSTDIVGRMLLCVRERSISDSHNHSSLQRQFSHGHSQFEDGGSGSGTRVSHFLPTSRR 237 (418)
T ss_pred hHHHHHHHhCCEEEEEecCCCCCHHHHHHHHHHhhhccccccccchhhhhhhhccccccccccCCCCCCCcccccccHHH
Confidence 9999999999999999999999999999999999999875433333333333331 122344677899999999
Q ss_pred eecccCCCCCCCCCeEEEEcCccccCChHHHHHHHHHHhcCCEEEEEEecCchhhcccCCCCCCCCHHHHHHHHHhcCCC
Q 017744 243 IVQFSNCKGPGPNARVVYIDGAFDLFHAGHVEILKKARQLGDFLLVGIYTDQIVSEHRGSYHPIMHLHERSLSVLACRYV 322 (366)
Q Consensus 243 i~~~~~~~~~~~~~~~v~~~GsFD~~h~GHi~~L~~A~~~gd~LiVgV~sD~~v~~~Kg~~~pi~~~~eR~~~v~~~~~V 322 (366)
|.||++|+.|.+++++||++|+||+||.||+++|++|+++||+|||||++|+.++++||+++|+|+++||++++++|+||
T Consensus 238 i~qf~~g~~p~~~~~iVyv~G~FDlfH~GHi~~L~~Ak~lGd~LIVGV~sD~~v~~~KG~~~Pi~~~~ER~~~v~ack~V 317 (418)
T PLN02406 238 IVQFSNGKGPGPDARIVYIDGAFDLFHAGHVEILRLARALGDFLLVGIHTDQTVSAHRGAHRPIMNLHERSLSVLACRYV 317 (418)
T ss_pred HHHHhccCCCCCCCeEEEECCeeccCCHHHHHHHHHHHHhCCEEEEEEeccHHHHHhcCCCCCCCCHHHHHHHHhccCcc
Confidence 99999999999999999999999999999999999999999999999999999999999889999999999999999999
Q ss_pred CcEEEcCCCCchHHHHHHcCCcEEEECCCCCC
Q 017744 323 DEVIIGAPWEVTKDMITTFNICLVVHGTVSET 354 (366)
Q Consensus 323 d~Vvi~~~~~~~~d~i~~~~~~~vv~G~~~~~ 354 (366)
|+|++++|+..+.+++++++||++|||++|+.
T Consensus 318 D~VVi~ap~~~~~~~i~~~~~d~vvhG~~~~~ 349 (418)
T PLN02406 318 DEVIIGAPWEVSKDMITTFNISLVVHGTVAEN 349 (418)
T ss_pred cEEEeCCCCCCCHHHHHHhCCCEEEECCcCCC
Confidence 99999999999999999999999999998854
|
|
| >KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02174 CCT CTP:phosphocholine cytidylyltransferase | Back alignment and domain information |
|---|
| >PLN02413 choline-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02406 ethanolamine-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) | Back alignment and domain information |
|---|
| >cd02170 cytidylyltransferase cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02172 RfaE_N N-terminal domain of RfaE | Back alignment and domain information |
|---|
| >PTZ00308 ethanolamine-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) | Back alignment and domain information |
|---|
| >cd02174 CCT CTP:phosphocholine cytidylyltransferase | Back alignment and domain information |
|---|
| >TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II | Back alignment and domain information |
|---|
| >TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] | Back alignment and domain information |
|---|
| >cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PLN02413 choline-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >KOG2803 consensus Choline phosphate cytidylyltransferase/Predicted CDP-ethanolamine synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme | Back alignment and domain information |
|---|
| >PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 | Back alignment and domain information |
|---|
| >COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase | Back alignment and domain information |
|---|
| >COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02170 cytidylyltransferase cytidylyltransferase | Back alignment and domain information |
|---|
| >TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II | Back alignment and domain information |
|---|
| >cd02172 RfaE_N N-terminal domain of RfaE | Back alignment and domain information |
|---|
| >COG0196 RibF FAD synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02171 G3P_Cytidylyltransferase glycerol-3-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain | Back alignment and domain information |
|---|
| >PRK00777 phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00777 phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain | Back alignment and domain information |
|---|
| >PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PLN02388 phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >cd02163 PPAT Phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR00125 cyt_tran_rel cytidyltransferase-related domain | Back alignment and domain information |
|---|
| >cd02163 PPAT Phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00125 cyt_tran_rel cytidyltransferase-related domain | Back alignment and domain information |
|---|
| >PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal | Back alignment and domain information |
|---|
| >TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial | Back alignment and domain information |
|---|
| >TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase, bacterial | Back alignment and domain information |
|---|
| >COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes | Back alignment and domain information |
|---|
| >cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain | Back alignment and domain information |
|---|
| >PF01467 CTP_transf_2: Cytidylyltransferase; InterPro: IPR004820 This family includes []: Cholinephosphate cytidyltransferase (P49585 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme | Back alignment and domain information |
|---|
| >COG1019 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain | Back alignment and domain information |
|---|
| >PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd02166 NMNAT_Archaea Nicotinamide/nicotinate mononucleotide adenylyltransferase, archaeal | Back alignment and domain information |
|---|
| >cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins | Back alignment and domain information |
|---|
| >cd02164 PPAT_CoAS phosphopantetheine adenylyltransferase domain of eukaryotic and archaeal bifunctional enzymes | Back alignment and domain information |
|---|
| >cd02156 nt_trans nucleotidyl transferase superfamily | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02167 NMNAT_NadR Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional NadR-like proteins | Back alignment and domain information |
|---|
| >cd02168 NMNAT_Nudix Nicotinamide/nicotinate mononucleotide adenylyltransferase of bifunctional proteins, also containing a Nudix hydrolase domain | Back alignment and domain information |
|---|
| >PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13670 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >COG1019 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic | Back alignment and domain information |
|---|
| >PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02165 NMNAT Nicotinamide/nicotinate mononucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >cd00560 PanC Pantoate-beta-alanine ligase | Back alignment and domain information |
|---|
| >PLN02388 phosphopantetheine adenylyltransferase | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00380 panC pantoate--beta-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >cd02156 nt_trans nucleotidyl transferase superfamily | Back alignment and domain information |
|---|
| >PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13671 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13671 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated | Back alignment and domain information |
|---|
| >smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain | Back alignment and domain information |
|---|
| >KOG3351 consensus Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06973 nicotinic acid mononucleotide adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd09286 NMNAT_Eukarya Nicotinamide/nicotinate mononucleotide adenylyltransferase, Eukaryotic | Back alignment and domain information |
|---|
| >PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 | Back alignment and domain information |
|---|
| >KOG3351 consensus Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02945 nicotinamide-nucleotide adenylyltransferase/nicotinate-nucleotide adenylyltransferase | Back alignment and domain information |
|---|
| >TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase | Back alignment and domain information |
|---|
| >PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 | Back alignment and domain information |
|---|
| >TIGR00018 panC pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
| >PLN02660 pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
| >PRK13670 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1323 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08218 Citrate_ly_lig: Citrate lyase ligase C-terminal domain; InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6 | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG0196 RibF FAD synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1323 Predicted nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00339 sopT ATP sulphurylase | Back alignment and domain information |
|---|
| >PF05636 HIGH_NTase1: HIGH Nucleotidyl Transferase; InterPro: IPR008513 This family consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00018 panC pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
| >PRK00380 panC pantoate--beta-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >PLN02660 pantoate--beta-alanine ligase | Back alignment and domain information |
|---|
| >cd00560 PanC Pantoate-beta-alanine ligase | Back alignment and domain information |
|---|
| >PF02569 Pantoate_ligase: Pantoate-beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis [] | Back alignment and domain information |
|---|
| >COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04149 sat sulfate adenylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00339 sopT ATP sulphurylase | Back alignment and domain information |
|---|
| >cd00517 ATPS ATP-sulfurylase | Back alignment and domain information |
|---|
| >PF01747 ATP-sulfurylase: ATP-sulfurylase; InterPro: IPR002650 This entry consists of sulphate adenylyltransferase or ATP-sulfurylase (2 | Back alignment and domain information |
|---|
| >PF02569 Pantoate_ligase: Pantoate-beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis [] | Back alignment and domain information |
|---|
| >KOG3199 consensus Nicotinamide mononucleotide adenylyl transferase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3042 consensus Panthothenate synthetase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3199 consensus Nicotinamide mononucleotide adenylyl transferase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3042 consensus Panthothenate synthetase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 366 | ||||
| 3elb_A | 341 | Human Ctp: Phosphoethanolamine Cytidylyltransferase | 5e-73 | ||
| 3elb_A | 341 | Human Ctp: Phosphoethanolamine Cytidylyltransferase | 2e-14 | ||
| 3hl4_A | 236 | Crystal Structure Of A Mammalian Ctp:phosphocholine | 3e-24 | ||
| 3hl4_A | 236 | Crystal Structure Of A Mammalian Ctp:phosphocholine | 1e-14 | ||
| 1coz_A | 129 | Ctp:glycerol-3-Phosphate Cytidylyltransferase From | 7e-13 | ||
| 2b7l_A | 132 | Crystal Structure Of Ctp:glycerol-3-Phosphate Cytid | 7e-11 | ||
| 3glv_A | 143 | Crystal Structure Of The Lipopolysaccharide Core Bi | 1e-09 | ||
| 3glv_A | 143 | Crystal Structure Of The Lipopolysaccharide Core Bi | 8e-04 |
| >pdb|3ELB|A Chain A, Human Ctp: Phosphoethanolamine Cytidylyltransferase In Complex With Cmp Length = 341 | Back alignment and structure |
|
| >pdb|3ELB|A Chain A, Human Ctp: Phosphoethanolamine Cytidylyltransferase In Complex With Cmp Length = 341 | Back alignment and structure |
| >pdb|3HL4|A Chain A, Crystal Structure Of A Mammalian Ctp:phosphocholine Cytidylyltransferase With Cdp-Choline Length = 236 | Back alignment and structure |
| >pdb|3HL4|A Chain A, Crystal Structure Of A Mammalian Ctp:phosphocholine Cytidylyltransferase With Cdp-Choline Length = 236 | Back alignment and structure |
| >pdb|1COZ|A Chain A, Ctp:glycerol-3-Phosphate Cytidylyltransferase From Bacillus Subtilis Length = 129 | Back alignment and structure |
| >pdb|2B7L|A Chain A, Crystal Structure Of Ctp:glycerol-3-Phosphate Cytidylyltransferase From Staphylococcus Aureus Length = 132 | Back alignment and structure |
| >pdb|3GLV|A Chain A, Crystal Structure Of The Lipopolysaccharide Core Biosynthesis Protein From Thermoplasma Volcanium Gss1 Length = 143 | Back alignment and structure |
| >pdb|3GLV|A Chain A, Crystal Structure Of The Lipopolysaccharide Core Biosynthesis Protein From Thermoplasma Volcanium Gss1 Length = 143 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 366 | |||
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 1e-127 | |
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 7e-48 | |
| 3hl4_A | 236 | Choline-phosphate cytidylyltransferase A; rossmann | 7e-61 | |
| 3hl4_A | 236 | Choline-phosphate cytidylyltransferase A; rossmann | 2e-35 | |
| 2b7l_A | 132 | Glycerol-3-phosphate cytidylyltransferase; rossman | 2e-54 | |
| 2b7l_A | 132 | Glycerol-3-phosphate cytidylyltransferase; rossman | 3e-32 | |
| 1coz_A | 129 | Protein (glycerol-3-phosphate cytidylyltransferase | 2e-54 | |
| 1coz_A | 129 | Protein (glycerol-3-phosphate cytidylyltransferase | 7e-33 | |
| 3glv_A | 143 | Lipopolysaccharide core biosynthesis protein; stru | 6e-23 | |
| 3glv_A | 143 | Lipopolysaccharide core biosynthesis protein; stru | 5e-17 | |
| 3do8_A | 148 | Phosphopantetheine adenylyltransferase; protein wi | 7e-10 | |
| 3do8_A | 148 | Phosphopantetheine adenylyltransferase; protein wi | 3e-07 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 3e-06 | |
| 1ej2_A | 181 | Nicotinamide mononucleotide adenylyltransferase; d | 5e-06 | |
| 1f9a_A | 168 | Hypothetical protein MJ0541; alpha/beta, transfera | 7e-06 | |
| 1f9a_A | 168 | Hypothetical protein MJ0541; alpha/beta, transfera | 1e-04 | |
| 1od6_A | 160 | PPAT, phosphopantetheine adenylyltransferase; coen | 3e-05 | |
| 1qjc_A | 158 | Phosphopantetheine adenylyltransferase; coenzyme A | 5e-05 | |
| 4f3r_A | 162 | Phosphopantetheine adenylyltransferase; phosphopan | 7e-05 | |
| 3k9w_A | 187 | Phosphopantetheine adenylyltransferase; niaid, ssg | 1e-04 | |
| 3nd5_A | 171 | Phosphopantetheine adenylyltransferase; PPAT, coen | 1e-04 | |
| 3f3m_A | 168 | Phosphopantetheine adenylyltransferase; PPAT, coen | 1e-04 | |
| 1o6b_A | 169 | Phosphopantetheine adenylyltransferase; structural | 1e-04 | |
| 1vlh_A | 173 | Phosphopantetheine adenylyltransferase; TM0741, st | 2e-04 | |
| 3nbk_A | 177 | Phosphopantetheine adenylyltransferase; PPAT, PHP; | 3e-04 | |
| 3nv7_A | 157 | Phosphopantetheine adenylyltransferase; helicobact | 3e-04 |
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
Score = 368 bits (946), Expect = e-127
Identities = 133/295 (45%), Positives = 200/295 (67%), Gaps = 10/295 (3%)
Query: 61 GKKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPVLSMEERL 120
G ++ VRV+ DGC+D++HYGH+N LRQA+A+GD L+VGV +DEEI +KGPPV + EER
Sbjct: 3 GGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERY 62
Query: 121 ALVSGLKWVDEVIANAPYAITEQFMNRLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKVG 180
+V +KWVDEV+ APY T + + +++ D+ +HG+D L DG D Y K+ G
Sbjct: 63 KMVQAIKWVDEVVPAAPYVTTLETL----DKYNCDFCVHGNDITLTVDGRDTYEEVKQAG 118
Query: 181 RYKQIKRTEGVSSTDIVGRILSSMEDTKACEDHNNASLPRDPLRAIQSKDA----HLSQF 236
RY++ KRT+GVS+TD+VGR+L + + ++ ++ +SQF
Sbjct: 119 RYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQF 178
Query: 237 LPTSRRIVQFSNCKGPGPNARVVYIDGAFDLFHAGHVEILKKARQLGD--FLLVGIYTDQ 294
L TS++I+QF++ K P P V+Y+ GAFDLFH GHV+ L+K +L + +++ G++ DQ
Sbjct: 179 LQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQ 238
Query: 295 IVSEHRGSYHPIMHLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFNICLVVHG 349
V+ ++G +PIM+LHER+LSVLACRYV EV+IGAP+ VT ++++ F + LV HG
Sbjct: 239 EVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHG 293
|
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 | Back alignment and structure |
|---|
| >2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Length = 132 | Back alignment and structure |
|---|
| >1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 | Back alignment and structure |
|---|
| >1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Length = 129 | Back alignment and structure |
|---|
| >3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Length = 143 | Back alignment and structure |
|---|
| >3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Length = 143 | Back alignment and structure |
|---|
| >3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 | Back alignment and structure |
|---|
| >3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Length = 365 | Back alignment and structure |
|---|
| >1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Length = 181 | Back alignment and structure |
|---|
| >1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Length = 168 | Back alignment and structure |
|---|
| >1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Length = 168 | Back alignment and structure |
|---|
| >1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Length = 160 | Back alignment and structure |
|---|
| >1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Length = 158 | Back alignment and structure |
|---|
| >4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} Length = 162 | Back alignment and structure |
|---|
| >3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* Length = 187 | Back alignment and structure |
|---|
| >3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} PDB: 3nd6_A* 3nd7_A* Length = 171 | Back alignment and structure |
|---|
| >3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} Length = 168 | Back alignment and structure |
|---|
| >1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Length = 169 | Back alignment and structure |
|---|
| >1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Length = 173 | Back alignment and structure |
|---|
| >3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 3lcj_A* 3rba_A* 1tfu_A* 3rff_A 3rhs_A* Length = 177 | Back alignment and structure |
|---|
| >3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* Length = 157 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 100.0 | |
| 3hl4_A | 236 | Choline-phosphate cytidylyltransferase A; rossmann | 99.97 | |
| 3elb_A | 341 | Ethanolamine-phosphate cytidylyltransferase; kenne | 99.94 | |
| 3hl4_A | 236 | Choline-phosphate cytidylyltransferase A; rossmann | 99.91 | |
| 2b7l_A | 132 | Glycerol-3-phosphate cytidylyltransferase; rossman | 99.9 | |
| 1coz_A | 129 | Protein (glycerol-3-phosphate cytidylyltransferase | 99.9 | |
| 3glv_A | 143 | Lipopolysaccharide core biosynthesis protein; stru | 99.89 | |
| 3op1_A | 308 | Macrolide-efflux protein; structural genomics, PSI | 99.86 | |
| 1mrz_A | 293 | Riboflavin kinase/FMN adenylyltransferase; rossman | 99.82 | |
| 2x0k_A | 338 | Riboflavin biosynthesis protein RIBF; riboflavin k | 99.81 | |
| 3nv7_A | 157 | Phosphopantetheine adenylyltransferase; helicobact | 99.8 | |
| 3nbk_A | 177 | Phosphopantetheine adenylyltransferase; PPAT, PHP; | 99.76 | |
| 1coz_A | 129 | Protein (glycerol-3-phosphate cytidylyltransferase | 99.76 | |
| 4f3r_A | 162 | Phosphopantetheine adenylyltransferase; phosphopan | 99.76 | |
| 3glv_A | 143 | Lipopolysaccharide core biosynthesis protein; stru | 99.76 | |
| 2b7l_A | 132 | Glycerol-3-phosphate cytidylyltransferase; rossman | 99.75 | |
| 3k9w_A | 187 | Phosphopantetheine adenylyltransferase; niaid, ssg | 99.73 | |
| 3k9w_A | 187 | Phosphopantetheine adenylyltransferase; niaid, ssg | 99.72 | |
| 1qjc_A | 158 | Phosphopantetheine adenylyltransferase; coenzyme A | 99.72 | |
| 3nd5_A | 171 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.71 | |
| 2qtr_A | 189 | Nicotinate (nicotinamide) nucleotide adenylyltran; | 99.7 | |
| 1o6b_A | 169 | Phosphopantetheine adenylyltransferase; structural | 99.7 | |
| 1kam_A | 194 | Deamido-NAD(+), nicotinate-nucleotide adenylyltran | 99.7 | |
| 3f3m_A | 168 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.68 | |
| 3nv7_A | 157 | Phosphopantetheine adenylyltransferase; helicobact | 99.67 | |
| 4f3r_A | 162 | Phosphopantetheine adenylyltransferase; phosphopan | 99.67 | |
| 1vlh_A | 173 | Phosphopantetheine adenylyltransferase; TM0741, st | 99.65 | |
| 1od6_A | 160 | PPAT, phosphopantetheine adenylyltransferase; coen | 99.65 | |
| 1k4m_A | 213 | NAMN adenylyltransferase; nucleotidyltransferase; | 99.61 | |
| 3f3m_A | 168 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.61 | |
| 1qjc_A | 158 | Phosphopantetheine adenylyltransferase; coenzyme A | 99.57 | |
| 3nd5_A | 171 | Phosphopantetheine adenylyltransferase; PPAT, coen | 99.57 | |
| 3nbk_A | 177 | Phosphopantetheine adenylyltransferase; PPAT, PHP; | 99.57 | |
| 1yum_A | 242 | 'probable nicotinate-nucleotide adenylyltransferas | 99.53 | |
| 2h29_A | 189 | Probable nicotinate-nucleotide adenylyltransferase | 99.52 | |
| 1vlh_A | 173 | Phosphopantetheine adenylyltransferase; TM0741, st | 99.51 | |
| 1o6b_A | 169 | Phosphopantetheine adenylyltransferase; structural | 99.5 | |
| 1od6_A | 160 | PPAT, phosphopantetheine adenylyltransferase; coen | 99.49 | |
| 3h05_A | 177 | Uncharacterized protein VPA0413; nucleotidylyl, tr | 99.46 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.44 | |
| 1ej2_A | 181 | Nicotinamide mononucleotide adenylyltransferase; d | 99.42 | |
| 3do8_A | 148 | Phosphopantetheine adenylyltransferase; protein wi | 99.37 | |
| 3gmi_A | 357 | UPF0348 protein MJ0951; protein with unknown funct | 99.37 | |
| 1kam_A | 194 | Deamido-NAD(+), nicotinate-nucleotide adenylyltran | 99.35 | |
| 1yum_A | 242 | 'probable nicotinate-nucleotide adenylyltransferas | 99.34 | |
| 2qtr_A | 189 | Nicotinate (nicotinamide) nucleotide adenylyltran; | 99.33 | |
| 1f9a_A | 168 | Hypothetical protein MJ0541; alpha/beta, transfera | 99.33 | |
| 1k4m_A | 213 | NAMN adenylyltransferase; nucleotidyltransferase; | 99.31 | |
| 1kqn_A | 279 | Nmnat, nicotinamide mononucleotide adenylyl transf | 99.31 | |
| 2ejc_A | 280 | Pantoate--beta-alanine ligase; X-RAY diffraction, | 99.27 | |
| 3do8_A | 148 | Phosphopantetheine adenylyltransferase; protein wi | 99.25 | |
| 1nup_A | 252 | FKSG76; NAD biosynthesis, mitochondria, pyridine a | 99.23 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 99.21 | |
| 2h29_A | 189 | Probable nicotinate-nucleotide adenylyltransferase | 99.08 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 99.07 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 98.98 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 98.97 | |
| 1ej2_A | 181 | Nicotinamide mononucleotide adenylyltransferase; d | 98.96 | |
| 1v8f_A | 276 | Pantoate-beta-alanine ligase; rossmann fold, dimer | 98.9 | |
| 1f9a_A | 168 | Hypothetical protein MJ0541; alpha/beta, transfera | 98.9 | |
| 1mrz_A | 293 | Riboflavin kinase/FMN adenylyltransferase; rossman | 98.86 | |
| 3h05_A | 177 | Uncharacterized protein VPA0413; nucleotidylyl, tr | 98.85 | |
| 2x0k_A | 338 | Riboflavin biosynthesis protein RIBF; riboflavin k | 98.84 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 98.82 | |
| 3ag6_A | 283 | Pantothenate synthetase; ATP-dependent enzyme, ATP | 98.72 | |
| 1nup_A | 252 | FKSG76; NAD biosynthesis, mitochondria, pyridine a | 98.63 | |
| 1kqn_A | 279 | Nmnat, nicotinamide mononucleotide adenylyl transf | 98.62 | |
| 3op1_A | 308 | Macrolide-efflux protein; structural genomics, PSI | 98.58 | |
| 2ejc_A | 280 | Pantoate--beta-alanine ligase; X-RAY diffraction, | 98.5 | |
| 3cov_A | 301 | Pantothenate synthetase; pantothenate biosynthesis | 98.47 | |
| 3gmi_A | 357 | UPF0348 protein MJ0951; protein with unknown funct | 98.39 | |
| 1v47_A | 349 | ATP sulfurylase; product binding complex, zinc, ri | 98.28 | |
| 1jhd_A | 396 | Sulfate adenylyltransferase; sulfurylase, APS, che | 98.24 | |
| 3uk2_A | 283 | Pantothenate synthetase; AMP, structural genomics, | 97.54 | |
| 3inn_A | 314 | Pantothenate synthetase; ssgcid, SBRI, UW, decode, | 97.03 | |
| 1v8f_A | 276 | Pantoate-beta-alanine ligase; rossmann fold, dimer | 96.85 | |
| 3q12_A | 287 | Pantoate--beta-alanine ligase; structural genomics | 96.48 | |
| 3ag6_A | 283 | Pantothenate synthetase; ATP-dependent enzyme, ATP | 96.18 | |
| 3q12_A | 287 | Pantoate--beta-alanine ligase; structural genomics | 95.96 | |
| 1jhd_A | 396 | Sulfate adenylyltransferase; sulfurylase, APS, che | 95.71 | |
| 3mxt_A | 285 | Pantothenate synthetase; alpha-beta-alpha, structu | 95.32 | |
| 3cov_A | 301 | Pantothenate synthetase; pantothenate biosynthesis | 95.29 | |
| 3mxt_A | 285 | Pantothenate synthetase; alpha-beta-alpha, structu | 95.02 | |
| 3inn_A | 314 | Pantothenate synthetase; ssgcid, SBRI, UW, decode, | 94.72 | |
| 1v47_A | 349 | ATP sulfurylase; product binding complex, zinc, ri | 94.62 | |
| 1r6x_A | 395 | ATP:sulfate adenylyltransferase; APS kinase-like d | 94.52 | |
| 3n8h_A | 264 | Pantothenate synthetase; alpha-beta sandwich, liga | 94.32 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 94.27 | |
| 3uk2_A | 283 | Pantothenate synthetase; AMP, structural genomics, | 94.04 | |
| 3n8h_A | 264 | Pantothenate synthetase; alpha-beta sandwich, liga | 93.02 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 89.79 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 89.39 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 87.19 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 84.36 |
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-65 Score=501.66 Aligned_cols=290 Identities=46% Similarity=0.829 Sum_probs=249.1
Q ss_pred CCCeEEEEecccCcCCHHHHHHHHHHHHhCCeeEEEEccchhhhhcCCCCCCcHHHHHHHHhcCccccEEEecCCccccH
Q 017744 63 KKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPVLSMEERLALVSGLKWVDEVIANAPYAITE 142 (366)
Q Consensus 63 ~~~~~V~~~G~FD~lH~GH~~lL~qAk~lgd~LvVgv~sd~~i~~~K~~pi~t~eER~~ll~~~~~VD~vv~~~p~~~~~ 142 (366)
+++++|++.||||++|.||+++|++|+++||+|+||+++|+.+.+.|++|+++.+||++++++|+|||+|++..|+...+
T Consensus 5 ~~~~~v~~~G~FD~lH~GH~~lL~~A~~l~d~LiVgV~~d~~v~~~K~~pi~s~eER~~~l~~l~~VD~Vv~f~~~~~~~ 84 (341)
T 3elb_A 5 RRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTL 84 (341)
T ss_dssp CCCCEEEEEECCCSCCHHHHHHHHHHHHTSSEEEEEECCHHHHHHHSSCCSSCHHHHHHHHHHBTTCCEEEETCCSSCCH
T ss_pred CCceEEEEEeeCCCCCHHHHHHHHHHHHhCCcCEEEeecCHHHhccCCCCCCCHHHHHHHHHHcCCCCEEEecCCCCCHH
Confidence 55778999999999999999999999999999999999999877677789999999999999999999999977776667
Q ss_pred HHHHHHhhccCccEEEEcCCCCCCCCCCchHHHHHhCCeEEEeccCCCCCHHHHHHHHHhccccccccccccC--CCCCC
Q 017744 143 QFMNRLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSSTDIVGRILSSMEDTKACEDHNN--ASLPR 220 (366)
Q Consensus 143 eFl~~ll~~l~~d~VV~G~D~~fg~~g~~~~~~lk~~g~~~~v~r~~~vSST~Ir~rI~~~~~~~~~~~~~~~--~~~~~ 220 (366)
+|+ ++++||++|+|+||++|.++.+.|+.+++.|+++.+++++++|||+|++||+.+++.++....... .+...
T Consensus 85 efi----~~~~~d~vV~G~D~~~g~~~~~~~~~~k~~G~~~~~~~t~g~STT~ii~ri~~~~~~~~~~~~~~~~~~~~~~ 160 (341)
T 3elb_A 85 ETL----DKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYAD 160 (341)
T ss_dssp HHH----HHTTCSEEEECSCCCBCTTSCBTTHHHHHTTCEEECCCCTTCCHHHHHHHHHC--------------------
T ss_pred HHH----HHhCCCEEEECCCCCCCCCCcchHHHHHhCCEEEEeCCCCCCCHHHHHHHHHHhccccccccccchhhHHHHH
Confidence 887 468999999999999999999999999999999999999999999999999999998875332111 11222
Q ss_pred Cchh--hhccCcccccccccccceeecccCCCCCCCCCeEEEEcCccccCChHHHHHHHHHHhcCC--EEEEEEecCchh
Q 017744 221 DPLR--AIQSKDAHLSQFLPTSRRIVQFSNCKGPGPNARVVYIDGAFDLFHAGHVEILKKARQLGD--FLLVGIYTDQIV 296 (366)
Q Consensus 221 ~~~~--~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~v~~~GsFD~~h~GHi~~L~~A~~~gd--~LiVgV~sD~~v 296 (366)
.++. .+.++++.+++|++++++|.||++|+.|.+++++||++|||||||.||+++|++|+++|| +|||||++|+.+
T Consensus 161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~g~~~~~~~~iv~~~GsFD~~h~GHl~~L~rA~~l~D~~~LiVgV~~d~~v 240 (341)
T 3elb_A 161 SFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEV 240 (341)
T ss_dssp -----------CCCCCCCCCCHHHHHHHCCCCCCCTTCEEEEEEECCTTCCHHHHHHHHHHHTTSSSEEEEEEEECHHHH
T ss_pred hhccCccccCCCcceecccCCcceeeeeccCCCCCCCCEEEEEecccCCCCHHHHHHHHHHHHhCCCCEEEEEEccCHhh
Confidence 3332 234678889999999999999999999999999999999999999999999999999999 999999999999
Q ss_pred hcccCCCCCCCCHHHHHHHHHhcCCCCcEEEcCCCCchHHHHHHcCCcEEEECCCCCCCC
Q 017744 297 SEHRGSYHPIMHLHERSLSVLACRYVDEVIIGAPWEVTKDMITTFNICLVVHGTVSETNT 356 (366)
Q Consensus 297 ~~~Kg~~~pi~~~~eR~~~v~~~~~Vd~Vvi~~~~~~~~d~i~~~~~~~vv~G~~~~~~~ 356 (366)
+++||+++|+|+++||++++++|++||+|++.+|++++.+++++++||++|||++|....
T Consensus 241 ~~~Kg~~~pi~~~~ER~~~v~~~~~vd~V~v~~~~~l~~~~~~~~~~~~iv~G~d~~~~~ 300 (341)
T 3elb_A 241 NHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPD 300 (341)
T ss_dssp HHHHCTTCCSSCHHHHHHHHHTBTTCCEEEEEECSSCCHHHHHHTTCSEEEECSSCCCCC
T ss_pred HhhcCCCCCCCCHHHHHHHHHHcCCCCCEEECCCCcchHHHHHhcCCcEEEECCCCcccc
Confidence 999998789999999999999999999999999999999999999999999999987643
|
| >3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, cytidylyltra SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* | Back alignment and structure |
|---|
| >3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A | Back alignment and structure |
|---|
| >2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} | Back alignment and structure |
|---|
| >3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* | Back alignment and structure |
|---|
| >3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* | Back alignment and structure |
|---|
| >1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* | Back alignment and structure |
|---|
| >4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3glv_A Lipopolysaccharide core biosynthesis protein; structural GEN PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* | Back alignment and structure |
|---|
| >3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infect disease, coenzyme A, COA; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei} PDB: 3ikz_A* 3pxu_A* | Back alignment and structure |
|---|
| >1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A | Back alignment and structure |
|---|
| >3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* | Back alignment and structure |
|---|
| >2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* | Back alignment and structure |
|---|
| >1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* | Back alignment and structure |
|---|
| >3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >3nv7_A Phosphopantetheine adenylyltransferase; helicobacter pylori 26695 strain, mutant I4V/N76Y, phosphopa adenylyltransferase; 1.75A {Helicobacter pylori} PDB: 3otw_A* | Back alignment and structure |
|---|
| >4f3r_A Phosphopantetheine adenylyltransferase; phosphopantetheine adenylyltranferase; 2.25A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* | Back alignment and structure |
|---|
| >3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway, coenzyme A biosynthesis, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A | Back alignment and structure |
|---|
| >3nd5_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A BIO pathway; 2.30A {Enterococcus faecalis} SCOP: c.26.1.0 PDB: 3nd6_A* 3nd7_A* | Back alignment and structure |
|---|
| >3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3pnb_A* 4e1a_A 3lcj_A 3rba_A* 1tfu_A* 3rff_A 3rhs_A* 3uc5_A* | Back alignment and structure |
|---|
| >1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* | Back alignment and structure |
|---|
| >2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* | Back alignment and structure |
|---|
| >1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* | Back alignment and structure |
|---|
| >3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* | Back alignment and structure |
|---|
| >1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* | Back alignment and structure |
|---|
| >2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltran; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesi transferase; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* | Back alignment and structure |
|---|
| >1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* | Back alignment and structure |
|---|
| >1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* | Back alignment and structure |
|---|
| >2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* | Back alignment and structure |
|---|
| >1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A | Back alignment and structure |
|---|
| >1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 | Back alignment and structure |
|---|
| >1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A | Back alignment and structure |
|---|
| >3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structu genomics, PSI; 1.65A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* | Back alignment and structure |
|---|
| >1nup_A FKSG76; NAD biosynthesis, mitochondria, pyridine adenylyltransferase catalysis, transferase; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* | Back alignment and structure |
|---|
| >1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* | Back alignment and structure |
|---|
| >3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... | Back alignment and structure |
|---|
| >3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; 1.91A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} | Back alignment and structure |
|---|
| >1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken STR genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A | Back alignment and structure |
|---|
| >3q12_A Pantoate--beta-alanine ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: PAF; 1.58A {Yersinia pestis} SCOP: c.26.1.4 PDB: 3q10_A* 3mue_A 1iho_A 3guz_A* | Back alignment and structure |
|---|
| >3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* | Back alignment and structure |
|---|
| >3q12_A Pantoate--beta-alanine ligase; structural genomics, center for structural genomics of infec diseases, csgid; HET: PAF; 1.58A {Yersinia pestis} SCOP: c.26.1.4 PDB: 3q10_A* 3mue_A 1iho_A 3guz_A* | Back alignment and structure |
|---|
| >1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3uy4_A* | Back alignment and structure |
|---|
| >3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzym ligase, drug design, ATP-binding, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... | Back alignment and structure |
|---|
| >3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3uy4_A* | Back alignment and structure |
|---|
| >3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} | Back alignment and structure |
|---|
| >1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 | Back alignment and structure |
|---|
| >3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} PDB: 3qtt_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3uk2_A Pantothenate synthetase; AMP, structural genomics, seattle S genomics center for infectious disease, ssgcid, ligase; HET: AMP; 2.25A {Burkholderia thailandensis} SCOP: c.26.1.0 | Back alignment and structure |
|---|
| >3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} PDB: 3qtt_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 366 | ||||
| d1coza_ | 126 | c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltr | 5e-21 | |
| d1coza_ | 126 | c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltr | 5e-12 | |
| d1lw7a1 | 163 | c.26.1.3 (A:57-219) Transcriptional regulator NadR | 1e-12 | |
| d1lw7a1 | 163 | c.26.1.3 (A:57-219) Transcriptional regulator NadR | 1e-06 | |
| d1f9aa_ | 164 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 6e-04 | |
| d1f9aa_ | 164 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 0.004 | |
| d1ej2a_ | 167 | c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) ad | 0.001 | |
| d1tfua_ | 157 | c.26.1.3 (A:) Phosphopantetheine adenylyltransfera | 0.002 |
| >d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 126 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Cytidylyltransferase domain: CTP:glycerol-3-phosphate cytidylyltransferase species: Bacillus subtilis [TaxId: 1423]
Score = 85.3 bits (210), Expect = 5e-21
Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 10/134 (7%)
Query: 67 RVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPVLSMEERLALVSGL 126
+V G FDL+H+GH L +AK LGD LVV + +DE + + S E R ++ +
Sbjct: 3 KVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETI 62
Query: 127 KWVDEVIANAPYAITEQFMNRLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKVGRYKQIK 186
++VDEVI + +Q + +H ID + G D + K +
Sbjct: 63 RYVDEVIPEKNWEQKKQDI----IDHNIDVFVMG------DDWEGKFDFLKDQCEVVYLP 112
Query: 187 RTEGVSSTDIVGRI 200
RTEG+S+T I I
Sbjct: 113 RTEGISTTKIKEEI 126
|
| >d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 126 | Back information, alignment and structure |
|---|
| >d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Length = 163 | Back information, alignment and structure |
|---|
| >d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Length = 163 | Back information, alignment and structure |
|---|
| >d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 164 | Back information, alignment and structure |
|---|
| >d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 164 | Back information, alignment and structure |
|---|
| >d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 167 | Back information, alignment and structure |
|---|
| >d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 157 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 366 | |||
| d1coza_ | 126 | CTP:glycerol-3-phosphate cytidylyltransferase {Bac | 99.96 | |
| d1coza_ | 126 | CTP:glycerol-3-phosphate cytidylyltransferase {Bac | 99.93 | |
| d1mrza2 | 157 | FMN adenylyltransferase domain of bifunctional FAD | 99.85 | |
| d1f9aa_ | 164 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.42 | |
| d1lw7a1 | 163 | Transcriptional regulator NadR, NMN-adenylyltransf | 99.37 | |
| d1ej2a_ | 167 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.3 | |
| d1f9aa_ | 164 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.21 | |
| d1tfua_ | 157 | Phosphopantetheine adenylyltransferase {Mycobacter | 99.17 | |
| d1qjca_ | 157 | Phosphopantetheine adenylyltransferase {Escherichi | 99.17 | |
| d1kr2a_ | 271 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.12 | |
| d1lw7a1 | 163 | Transcriptional regulator NadR, NMN-adenylyltransf | 99.11 | |
| d1od6a_ | 160 | Phosphopantetheine adenylyltransferase {Thermus th | 99.11 | |
| d1kama_ | 189 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.05 | |
| d1k4ma_ | 213 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.05 | |
| d1jhda2 | 223 | ATP sulfurylase catalytic domain {Sulfur-oxidizing | 99.04 | |
| d1o6ba_ | 163 | Phosphopantetheine adenylyltransferase {Bacillus s | 99.04 | |
| d1ej2a_ | 167 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 99.02 | |
| d1o6ba_ | 163 | Phosphopantetheine adenylyltransferase {Bacillus s | 99.01 | |
| d1qjca_ | 157 | Phosphopantetheine adenylyltransferase {Escherichi | 99.0 | |
| d1nuua_ | 233 | Cytosolic NMN/NAMN adenylyltransferase {Human (Hom | 99.0 | |
| d1vlha_ | 157 | Phosphopantetheine adenylyltransferase {Thermotoga | 98.94 | |
| d1od6a_ | 160 | Phosphopantetheine adenylyltransferase {Thermus th | 98.93 | |
| d1tfua_ | 157 | Phosphopantetheine adenylyltransferase {Mycobacter | 98.93 | |
| d1vlha_ | 157 | Phosphopantetheine adenylyltransferase {Thermotoga | 98.74 | |
| d1kama_ | 189 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 98.57 | |
| d1k4ma_ | 213 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 98.34 | |
| d1kr2a_ | 271 | Nicotinamide mononucleotide (NMN) adenylyltransfer | 98.19 | |
| d1nuua_ | 233 | Cytosolic NMN/NAMN adenylyltransferase {Human (Hom | 98.18 | |
| d1mrza2 | 157 | FMN adenylyltransferase domain of bifunctional FAD | 98.09 | |
| d1jhda2 | 223 | ATP sulfurylase catalytic domain {Sulfur-oxidizing | 97.69 | |
| d1v47a2 | 214 | ATP sulfurylase catalytic domain {Thermus thermoph | 96.07 | |
| d1v8fa_ | 276 | Pantothenate synthetase (Pantoate-beta-alanine lig | 95.97 | |
| d1x6va2 | 235 | ATP sulfurylase catalytic domain {Human (Homo sapi | 95.45 | |
| d1g8fa2 | 221 | ATP sulfurylase catalytic domain {Baker's yeast (S | 95.43 | |
| d1ihoa_ | 282 | Pantothenate synthetase (Pantoate-beta-alanine lig | 95.02 | |
| d2a84a1 | 286 | Pantothenate synthetase (Pantoate-beta-alanine lig | 93.77 | |
| d1ihoa_ | 282 | Pantothenate synthetase (Pantoate-beta-alanine lig | 92.52 | |
| d1v8fa_ | 276 | Pantothenate synthetase (Pantoate-beta-alanine lig | 92.51 | |
| d2a84a1 | 286 | Pantothenate synthetase (Pantoate-beta-alanine lig | 89.54 |
| >d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Cytidylyltransferase domain: CTP:glycerol-3-phosphate cytidylyltransferase species: Bacillus subtilis [TaxId: 1423]
Probab=99.96 E-value=4.9e-30 Score=215.80 Aligned_cols=126 Identities=34% Similarity=0.495 Sum_probs=111.9
Q ss_pred CeEEEEecccCcCCHHHHHHHHHHHHhCCeeEEEEccchhhhhcCCCCCCcHHHHHHHHhcCccccEEEecCCccccHHH
Q 017744 65 RVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPVLSMEERLALVSGLKWVDEVIANAPYAITEQF 144 (366)
Q Consensus 65 ~~~V~~~G~FD~lH~GH~~lL~qAk~lgd~LvVgv~sd~~i~~~K~~pi~t~eER~~ll~~~~~VD~vv~~~p~~~~~eF 144 (366)
|++|++.|+||++|.||+++|++|+++||.|+||+++|+.+..+|++|++|.+||+++|++|+|||+|++..|++...++
T Consensus 1 Mk~V~~~G~FD~lH~GH~~~l~~Ak~~gd~liV~v~sD~~~~~~k~~pi~~~~eR~~~l~~~~~Vd~v~~~~~~~~~~~~ 80 (126)
T d1coza_ 1 MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETIRYVDEVIPEKNWEQKKQD 80 (126)
T ss_dssp CCEEEEEECCCSCCHHHHHHHHHHHTTSSEEEEEEECHHHHHHHTCCCSSCHHHHHHHHTTBTTCCEEEEECCSTTHHHH
T ss_pred CcEEEEeeEeCCCCHHHHHHHHHHHhhCceeeeeeeccchhhhccCcccCCHHHHHHHhhhhcccceeeecccccccHhh
Confidence 46899999999999999999999999999999999999988777889999999999999999999999998877655555
Q ss_pred HHHHhhccCccEEEEcCCCCCCCCCCchHHHHHhCCeEEEeccCCCCCHHHHHHHH
Q 017744 145 MNRLFNEHKIDYIIHGDDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSSTDIVGRI 200 (366)
Q Consensus 145 l~~ll~~l~~d~VV~G~D~~fg~~g~~~~~~lk~~g~~~~v~r~~~vSST~Ir~rI 200 (366)
+ .+++||++++|+||.. .+..++..++++.+++++++|||.||++|
T Consensus 81 i----~~~~~d~~v~G~D~~~------~~~~~~~~~~~i~~~~~~~iSST~i~~~I 126 (126)
T d1coza_ 81 I----IDHNIDVFVMGDDWEG------KFDFLKDQCEVVYLPRTEGISTTKIKEEI 126 (126)
T ss_dssp H----HHTTCSEEEEEGGGTT------TTGGGTTTSEEEEECCCTTCCHHHHHHTC
T ss_pred h----hccCCCEeeecccccc------chHHHHcCCEEEEECCCCCccHHHHHHhC
Confidence 4 4689999999999842 24456778899999999999999999875
|
| >d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} | Back information, alignment and structure |
|---|
| >d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qjca_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1od6a_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tfua_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vlha_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k4ma_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kr2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nuua_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} | Back information, alignment and structure |
|---|
| >d1v47a2 c.26.1.5 (A:136-349) ATP sulfurylase catalytic domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa2 c.26.1.5 (A:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|