Citrus Sinensis ID: 018028

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MLSALLFLTLHLLFVLSSLSTKALTKHTKTKKSHFFFFSSSNMAVEARRIDLLPSQLISHRDFIKSNQVNANTQMDSFFPFAEPMPEQTMLPFYQAFDCNPISTKTSMDKADSGLTYNIPAPRKRQRDSINDLDAFSLVSQKQKLSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVGGEGDDCAGGGATLAAAAEDDAESSCGSSDFGRSTIAGEGAQDKAVGGGRMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS
cHHHHHHHHHHHHHHHHcccccHHHHcccccccEEEEEcccccEEccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHcccccccccccccccccccHHHcccccccccccccccccEEEEEccccccccccHHHcccccccccccccccEEEEEEc
cHHHHHHHHHHHHHHHHHHcHHHHHHcccccccEEEEEccccHEEEccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccHHHHHHHHccccccccccccccccccHccccccccHHHcccccEEEEEEccccccccHHHHHHHHHcccccccccccEEEEEcc
MLSALLFLTLHLLFVLSSLSTKaltkhtktkkshffffsssNMAVEARRIdllpsqlishrdfiksnqvnantqmdsffpfaepmpeqtmlpfyqafdcnpistktsmdkadsgltynipaprkrqrdsindldafslvsQKQKLSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVggegddcagggATLAAaaeddaesscgssdfgrstiagegaqdkavgggrmlcrrcgekessvlllpcrhlclctvcgscligscpvcnfvvdaslhvnls
MLSALLFLTLHLLFVLSSLSTKALTKHTKTKKSHFFFFSSSNMAVEARRIDLLPSQLISHRDFIKSNQVNANTQMDSFFPFAEPMPEQTMLPFYQAFDCNPISTktsmdkadsgltynipaprkrqrdSINDLDAFSLVSQKQKLSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAiqegvanklkekdeEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVGGEGDDCAGGGATLAAAAEDDAESSCGSSDFGrstiagegaqdkavggGRMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS
MlsallfltlhllfvlsslstkaltkhtktkkshffffsssNMAVEARRIDLLPSQLISHRDFIKSNQVNANTQMDSFFPFAEPMPEQTMLPFYQAFDCNPISTKTSMDKADSGLTYNIPAPRKRQRDSINDLDAFSLVSQKQKLSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVggegddcagggatlaaaaeddaesscgssdFGRSTIAGEGAQDKAVGGGRMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS
***ALLFLTLHLLFVLSSLSTKALTKHTKTKKSHFFFFSSSNMAVEARRIDLLPSQLISHRDFIKSNQVNANTQMDSFFPFAEPM*EQTMLPFYQAFDCNPI*********************************FSLV*****LSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILEL***********I**I**************IHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVGGEG**C**************************************VGGGRMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHV***
**SALLFLTLHLLFVLSSLST*******KTKKSHFFFFSSSNMAVEARRIDLLPSQLISHRDFIK***VNANTQMDSFFPFAEPMPEQTMLPFYQAFDC*************************************************************QQQQSEIDRYIAQHTEK*************************************MRKLNWVLQERVKSLFVENQIWRDLAQTNE*******************************************************************MLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS
MLSALLFLTLHLLFVLSSLSTKALTKHTKTKKSHFFFFSSSNMAVEARRIDLLPSQLISHRDFIKSNQVNANTQMDSFFPFAEPMPEQTMLPFYQAFDCNPISTKTSMDKADSGLTYNIPAPRKRQRDSINDLDAFSLVSQKQKLSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVGGEGDDCAGGGATLA***************FGRSTIAGEGAQDKAVGGGRMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS
*LSALLFLTLHLLFVLSSLSTKALTKHTKTKKSHFFFFSSSNMAVEARRIDLLPSQLISHRDFIKSNQVNANTQMDSFFPFAEPMPEQTMLPFYQAFDCNPISTKTSM*KADSGLTY****************************SGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVG************************************************RMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSALLFLTLHLLFVLSSLSTKALTKHTKTKKSHFFFFSSSNMAVEARRIDLLPSQLISHRDFIKSNQVNANTQMDSFFPFAEPMPEQTMLPFYQAFDCNPISTKTSMDKADSGLTYNIPAPRKRQRDSINDLDAFSLVSQKQKLSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVxxxxxxxxxxxxxxxxxxxxxGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVGGEGDDCAGGGATLAAAAEDDAESSCGSSDFGRSTIAGEGAQDKAVGGGRMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query362 2.2.26 [Sep-21-2011]
O10296275 Apoptosis inhibitor 1 OS= N/A no 0.146 0.192 0.425 0.0002
>sp|O10296|IAP1_NPVOP Apoptosis inhibitor 1 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=IAP1 PE=4 SV=1 Back     alignment and function desciption
 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 296 TIAGEGAQDKAVGGGRMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVC 349
           T  GE A   A G   + C+ C E++   +LLPCRH C+C  C   L G CP C
Sbjct: 210 TAPGEPAPAFA-GSEALECKVCLERQRDAVLLPCRHFCVCMQCYFALDGKCPTC 262
Acts by blocking cellular apoptosis rather than by preventing viral stimulation of apoptosis.
Orgyia pseudotsugata (taxid: 33414)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
224136548326 predicted protein [Populus trichocarpa] 0.845 0.938 0.623 1e-105
255587457349 conserved hypothetical protein [Ricinus 0.883 0.916 0.601 1e-102
118486096334 unknown [Populus trichocarpa] gi|1184864 0.859 0.931 0.641 1e-100
224115518334 predicted protein [Populus trichocarpa] 0.859 0.931 0.638 1e-100
356555839313 PREDICTED: uncharacterized protein LOC10 0.828 0.958 0.570 1e-90
356532980310 PREDICTED: uncharacterized protein LOC10 0.814 0.951 0.561 2e-90
224115204337 predicted protein [Populus trichocarpa] 0.875 0.940 0.491 1e-78
357448357319 Baculoviral IAP repeat-containing protei 0.809 0.918 0.520 2e-78
217075472318 unknown [Medicago truncatula] 0.809 0.921 0.515 3e-78
118488869340 unknown [Populus trichocarpa x Populus d 0.875 0.932 0.504 2e-76
>gi|224136548|ref|XP_002322357.1| predicted protein [Populus trichocarpa] gi|222869353|gb|EEF06484.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 212/340 (62%), Positives = 253/340 (74%), Gaps = 34/340 (10%)

Query: 43  MAVEARRIDL-LPSQLISHRDFIKSNQVNAN---TQMDSFFPFAEPMPEQTMLPFYQA-F 97
           MAVE   + L  PSQLI++RD +K+N  N N   TQMDS   F EP+PE T++ FYQ+  
Sbjct: 1   MAVETPHMSLNFPSQLITNRDLVKANHANMNLYNTQMDSGLVFNEPVPE-TLMSFYQSSL 59

Query: 98  DCNPISTKTSMDKADSGLTYNIPA---PRKRQRDSIND--LDAFSLVSQKQKLSGFSSLL 152
            C+PIS   + +K DS LTYN+PA   PRKR RDSIND   DAF   SQK K+S  SS +
Sbjct: 60  GCDPISAAKASNKDDSSLTYNVPAVAAPRKRARDSINDDNFDAFH-ASQKTKVSPLSSFI 118

Query: 153 DQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEI 212
           D DI+F++QQQQSEIDR+I  H +KV +ELEE++KRQSRML+SAIQEG+  K+KEKDEEI
Sbjct: 119 DHDILFQIQQQQSEIDRFIDDHNQKVRMELEERKKRQSRMLVSAIQEGMIKKVKEKDEEI 178

Query: 213 HRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHVGGEGDDCAGGG 272
            RM K+NW LQE+ KSL+VENQIWRDLAQ NEATAN+LRSNLEQVLAH        +GG 
Sbjct: 179 QRMGKINWFLQEKAKSLYVENQIWRDLAQANEATANSLRSNLEQVLAHA-------SGGA 231

Query: 273 ATLAAAAEDDAESS-CGSSDFGRSTIAG--EGA-QDKAV------GGGRMLCRRCGEKES 322
           ATLA    DDAESS CGSSD GR T+AG  EGA +DK V         RM C++CGE+ES
Sbjct: 232 ATLA----DDAESSCCGSSDHGRCTLAGGEEGAVKDKMVVVKDNLNHNRM-CKKCGERES 286

Query: 323 SVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS 362
           SVLLLPCRHLCLCT+CGS LIGSCPVC+ V+ AS+HVN+S
Sbjct: 287 SVLLLPCRHLCLCTLCGSNLIGSCPVCDSVMTASVHVNMS 326

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255587457|ref|XP_002534279.1| conserved hypothetical protein [Ricinus communis] gi|223525588|gb|EEF28104.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|118486096|gb|ABK94891.1| unknown [Populus trichocarpa] gi|118486429|gb|ABK95054.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115518|ref|XP_002332154.1| predicted protein [Populus trichocarpa] gi|222875204|gb|EEF12335.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356555839|ref|XP_003546237.1| PREDICTED: uncharacterized protein LOC100797512 [Glycine max] Back     alignment and taxonomy information
>gi|356532980|ref|XP_003535047.1| PREDICTED: uncharacterized protein LOC100781461 [Glycine max] Back     alignment and taxonomy information
>gi|224115204|ref|XP_002332187.1| predicted protein [Populus trichocarpa] gi|222875294|gb|EEF12425.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357448357|ref|XP_003594454.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|355483502|gb|AES64705.1| Baculoviral IAP repeat-containing protein [Medicago truncatula] gi|388490676|gb|AFK33404.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217075472|gb|ACJ86096.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|118488869|gb|ABK96244.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
TAIR|locus:2153227294 BRG1 "BOI-related gene 1" [Ara 0.563 0.693 0.531 4.8e-66
TAIR|locus:2133990304 RING [Arabidopsis thaliana (ta 0.814 0.970 0.463 3.8e-62
TAIR|locus:2089225335 BRG3 "BOI-related gene 3" [Ara 0.602 0.650 0.389 3.3e-51
TAIR|locus:2207385358 BRG2 "BOI-related gene 2" [Ara 0.588 0.594 0.482 4.2e-49
TAIR|locus:2019983339 AT1G10650 [Arabidopsis thalian 0.309 0.330 0.336 2.4e-21
TAIR|locus:2036596340 AT1G60610 [Arabidopsis thalian 0.549 0.585 0.313 4.9e-21
TAIR|locus:2825812325 SBP1 "S-ribonuclease binding p 0.306 0.341 0.324 9e-19
TAIR|locus:2131571265 AT4G35070 "AT4G35070" [Arabido 0.273 0.373 0.323 1.6e-18
TAIR|locus:2035564312 AT1G32740 "AT1G32740" [Arabido 0.546 0.634 0.279 1.6e-17
TAIR|locus:2129336314 AT4G17680 [Arabidopsis thalian 0.712 0.821 0.253 7.9e-17
TAIR|locus:2153227 BRG1 "BOI-related gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 490 (177.5 bits), Expect = 4.8e-66, Sum P(2) = 4.8e-66
 Identities = 118/222 (53%), Positives = 154/222 (69%)

Query:    43 MAVEARRIDLLPSQLISHRDFIKSNQVNANT-QMDSFFPFAEPMPEQTMLPFYQAFDCNP 101
             MAVEAR ++L  SQ I++R+ +KS Q N N  Q  +   F   + ++ +    Q  D  P
Sbjct:     1 MAVEARHMNLFSSQYITNRECVKS-QTNMNNGQQIAGGGFPVTIGDRNL----QYID--P 53

Query:   102 ISTKTSMDKADSGLTYNIPAPRKRQRDSINDLDAFSLVSQKQKLSGFS--SLLDQDIIFR 159
             I+   S +K++S LT    A  KRQRDS  D DA  + SQK++   FS  SL+D +++ +
Sbjct:    54 IN---SFNKSESELT----AISKRQRDSTFDSDAL-IASQKRRAIAFSPASLIDAELVSQ 105

Query:   160 LQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEIHRMRKLN 219
             +QQQ SEIDR++AQ TE + +ELE +++ Q+RML SA+Q  +  KLK KDEEI RM KLN
Sbjct:   106 IQQQNSEIDRFVAQQTETLRIELEARQRTQTRMLASAVQNAILKKLKAKDEEIIRMGKLN 165

Query:   220 WVLQERVKSLFVENQIWRDLAQTNEATANTLRSNLEQVLAHV 261
             WVLQERVK+L+VENQIWRDLAQTNEATAN LRSNLEQVLA V
Sbjct:   166 WVLQERVKNLYVENQIWRDLAQTNEATANNLRSNLEQVLAQV 207
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0043067 "regulation of programmed cell death" evidence=IMP
TAIR|locus:2133990 RING [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089225 BRG3 "BOI-related gene 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207385 BRG2 "BOI-related gene 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019983 AT1G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036596 AT1G60610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825812 SBP1 "S-ribonuclease binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131571 AT4G35070 "AT4G35070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035564 AT1G32740 "AT1G32740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129336 AT4G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 5e-10
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 53.9 bits (130), Expect = 5e-10
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 311 RMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGS--CPVCNFVVDAS 356
             LC  C E+  +V+ LPC HLCLC  C   L     CP+C   +++ 
Sbjct: 2   DDLCVICLERPRNVVFLPCGHLCLCEECAKRLRSKKKCPICRQPIESV 49

Length = 49

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 362
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.19
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.86
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.78
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.78
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.64
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.45
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.25
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.07
PHA02929238 N1R/p28-like protein; Provisional 96.96
PF1463444 zf-RING_5: zinc-RING finger domain 96.94
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 96.86
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.84
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.71
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.71
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.61
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.45
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.34
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.17
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 95.94
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 95.75
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 95.42
PHA02926242 zinc finger-like protein; Provisional 94.92
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 94.91
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.67
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 94.64
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 94.51
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.49
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 94.08
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 93.74
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.33
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 93.04
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 92.27
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 91.12
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 90.86
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 89.41
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 89.34
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 87.83
PF00038312 Filament: Intermediate filament protein; InterPro: 86.91
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 86.73
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 86.51
KOG3002 299 consensus Zn finger protein [General function pred 86.18
KOG2113394 consensus Predicted RNA binding protein, contains 86.04
PF12240205 Angiomotin_C: Angiomotin C terminal; InterPro: IPR 85.17
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 84.59
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 84.51
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 83.97
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 83.18
KOG3039303 consensus Uncharacterized conserved protein [Funct 83.15
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 81.1
PRK09039343 hypothetical protein; Validated 81.09
PF04641260 Rtf2: Rtf2 RING-finger 80.68
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 80.5
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.7e-38  Score=289.76  Aligned_cols=189  Identities=49%  Similarity=0.829  Sum_probs=158.4

Q ss_pred             HHHHHHHhhhHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHhhH
Q 018028          155 DIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRMLISAIQEGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQ  234 (362)
Q Consensus       155 ~l~~~l~qQ~~EID~~i~~q~ErLR~~LeE~RqRh~r~Ll~avE~~~~~rLReKEeEIera~rrn~ELEErlrql~~E~Q  234 (362)
                      ++++++++|..|||+|+..|.++||..+.+.++++++.++.++|..+.++||+|++||++++++|++|+++++++.+|+|
T Consensus        15 ~~~~~~~~q~~~id~f~~~~~~~l~~~~~~~~~~~~~~~l~~~e~~~~~~l~~k~~ei~~~~~~~~~l~~~~~~~~~e~~   94 (207)
T KOG1100|consen   15 DLASDIQRQSDEIDRFLKIQGEQLRRELEENRQRELRNLLKAVEEALVKKLREKDEEIERIGNLNWELEERVKSLYVEAQ   94 (207)
T ss_pred             cceeecccccchhhHHHHhhHHHHHHHHHHhChHHHHHHHHHHHHHHHHHhhcchhHHHhcccccceehhhhhhhhhhHH
Confidence            78889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhhHHHHHHHHHHHHHHHhc----CCCCCCCCCCCCCccCCccchhhhccCCCCCCCcccccCCccccccCCC
Q 018028          235 IWRDLAQTNEATANTLRSNLEQVLAHV----GGEGDDCAGGGATLAAAAEDDAESSCGSSDFGRSTIAGEGAQDKAVGGG  310 (362)
Q Consensus       235 aWq~~A~~nEA~A~~Lra~LeQ~l~q~----~~l~~~~eG~g~s~~~~~adDAeScc~~~~~~r~~l~geea~~~~~~~~  310 (362)
                      .|+++|++||+++++|+.+|+|++.+.    ....++..++|+.    +.||++|+.+..          +....  ...
T Consensus        95 ~w~~~a~~ne~~~~~l~~nl~q~~~~~~~~~~~~~~~~~~~g~~----~~~~~~s~~~~~----------~~~~~--~~~  158 (207)
T KOG1100|consen   95 IWRDRAQTNEATVNSLRTNLDQVLAQCPASAPAEERGQKSCGDR----EADDGKSSYVDP----------SVDNF--KRM  158 (207)
T ss_pred             HHHHHHHhChHHHHHHHHHHHHHHHhcccccCchhhhccccCcc----ccccccccccch----------hhhhh--hcc
Confidence            999999999999999999999999984    1111111112211    234444421111          11111  111


Q ss_pred             ccccccccccccceEEeCCCCcccCcccccccCCcCccccccccceEEEee
Q 018028          311 RMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNL  361 (362)
Q Consensus       311 ~~~C~iC~~~~a~vlLlPCrHlclC~~C~~~l~~~CPvCR~~i~~~V~V~l  361 (362)
                      + .|+.|+++++.|+|+||+|+|+|..|+.. ...||+|+.+++.+++||+
T Consensus       159 ~-~Cr~C~~~~~~VlllPCrHl~lC~~C~~~-~~~CPiC~~~~~s~~~v~~  207 (207)
T KOG1100|consen  159 R-SCRKCGEREATVLLLPCRHLCLCGICDES-LRICPICRSPKTSSVEVNF  207 (207)
T ss_pred             c-cceecCcCCceEEeecccceEeccccccc-CccCCCCcChhhceeeccC
Confidence            2 29999999999999999999999999998 8899999999999999986

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 2e-04
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
Query: 314 CRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS 362
           C+ C +KE SV+ +PC HL +C  C   L   CP+C  ++  ++   LS
Sbjct: 298 CKVCMDKEVSVVFIPCGHLVVCQECAPSL-RKCPICRGIIKGTVRTFLS 345

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-11
2ea5_A68 Cell growth regulator with ring finger domain prot 7e-11
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 4e-10
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 4e-09
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 1e-06
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-05
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
 Score = 63.1 bits (151), Expect = 3e-11
 Identities = 43/290 (14%), Positives = 94/290 (32%), Gaps = 18/290 (6%)

Query: 73  TQMDSFFPFAEPMPEQTMLPFYQAFDCNPISTKTSMDKADSGLTYNIPAPRKRQRDSIND 132
            +M       E       L          I        ++  +  N P  +       N 
Sbjct: 74  IRMKGQEFVDEIQGRYPHLLEQLLSTPPIIHYGPGESSSEDAVMMNTPVVKSALEMGFNR 133

Query: 133 LDAFSLVSQKQKLSGFSSLLDQDIIFRLQQQQSEIDRYIAQHTEKVILELEEQRKRQSRM 192
                 V  K   +G +     DI+  L   + E      +   + +   +    R++RM
Sbjct: 134 DLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRM 193

Query: 193 LISAIQEGVANKLKEKDEEIHRMRKLNWVLQERVKSLFVENQIWRDLAQTNEATANTLRS 252
            +      V   L    +     ++ + +++++ +      ++   +     A AN  ++
Sbjct: 194 ALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKN 253

Query: 253 NLEQVLAHVGGEGDDCAGGGATLAAAAEDDAESSCGSSDFGRSTIAGEGAQDKAVGGGRM 312
           +L+++ + +                   D       + D    ++     +         
Sbjct: 254 SLKEIDSTLYKN-------------LFVDKNMKYIPTEDVSGLSLE----EQLRRLQEER 296

Query: 313 LCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNLS 362
            C+ C +KE SV+ +PC HL +C  C   L   CP+C  ++  ++   LS
Sbjct: 297 TCKVCMDKEVSVVFIPCGHLVVCQECAPSL-RKCPICRGIIKGTVRTFLS 345
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
2ea5_A68 Cell growth regulator with ring finger domain prot 99.25
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.22
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.19
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.15
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.14
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.08
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.86
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.14
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.1
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.98
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.97
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.89
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.89
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.85
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.84
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.76
2ect_A78 Ring finger protein 126; metal binding protein, st 97.75
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.74
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.73
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.73
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.71
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.7
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.64
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.64
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.6
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.56
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.53
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.52
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.52
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.51
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.48
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.47
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.44
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.43
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.4
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.35
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.33
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.29
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.29
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.28
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.24
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.23
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.19
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.15
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.14
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.12
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.05
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.95
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.95
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.86
2f42_A179 STIP1 homology and U-box containing protein 1; cha 96.8
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.79
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 96.63
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.47
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.36
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.28
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.15
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 95.99
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 95.79
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 95.75
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 94.93
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 94.72
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 93.93
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 93.1
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 92.91
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 92.55
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.44
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 89.5
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 89.38
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 88.62
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 86.59
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 86.2
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 84.78
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 84.48
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 83.45
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 82.13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 80.95
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.25  E-value=1.9e-12  Score=99.12  Aligned_cols=50  Identities=34%  Similarity=0.769  Sum_probs=47.5

Q ss_pred             ccccccccccccceEEeCCCCcccCcccccccCCcCccccccccceEEEee
Q 018028          311 RMLCRRCGEKESSVLLLPCRHLCLCTVCGSCLIGSCPVCNFVVDASLHVNL  361 (362)
Q Consensus       311 ~~~C~iC~~~~a~vlLlPCrHlclC~~C~~~l~~~CPvCR~~i~~~V~V~l  361 (362)
                      ...|+||++++++++|+||+|+++|..|... ...||+||.+|...++||.
T Consensus        15 ~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~-~~~CP~CR~~i~~~~~i~~   64 (68)
T 2ea5_A           15 SKDCVVCQNGTVNWVLLPCRHTCLCDGCVKY-FQQCPMCRQFVQESFALSG   64 (68)
T ss_dssp             SSCCSSSSSSCCCCEETTTTBCCSCTTHHHH-CSSCTTTCCCCCCEECCCS
T ss_pred             CCCCCCcCcCCCCEEEECCCChhhhHHHHhc-CCCCCCCCcchhceEEeec
Confidence            4589999999999999999999999999999 9999999999999999985
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 362
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.001
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.4 bits (81), Expect = 0.001
 Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 3/52 (5%)

Query: 313 LCRRCGEKESSVLLLPCRHLCLCTVCGSCLIG---SCPVCNFVVDASLHVNL 361
           LC+ C E +  V + PC HL   +   S        CP C   +  +  + +
Sbjct: 25  LCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVV 76

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.97
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.9
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.69
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.59
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.55
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.37
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.29
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.17
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.02
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.5
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.39
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.11
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.1
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 95.88
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 95.17
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 94.36
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.13  E-value=2.2e-07  Score=71.04  Aligned_cols=47  Identities=32%  Similarity=0.820  Sum_probs=39.7

Q ss_pred             cccccccccccceEEeCCCCcccCccccccc----CCcCccccccccceEEE
Q 018028          312 MLCRRCGEKESSVLLLPCRHLCLCTVCGSCL----IGSCPVCNFVVDASLHV  359 (362)
Q Consensus       312 ~~C~iC~~~~a~vlLlPCrHlclC~~C~~~l----~~~CPvCR~~i~~~V~V  359 (362)
                      ..|.||++...+.+++||||. .|..|....    ...||+||..++..-.|
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i   74 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPI   74 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCS
T ss_pred             CCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCcee
Confidence            369999999999999999998 799997543    46799999999876444
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure