Citrus Sinensis ID: 018247

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQIQASIAQTFQRQTEALGRKRTPKSTSALRRSHGRYRDTPLRGRRNYRMTELQGSDENDDANGDAGKDSSSADERSTEVRPKRRKRWYGARFSQSSSAAAGTDGGGDENDSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHGSVSGSNGKNARNNRLSKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQNLGHGFLLLAYQKILLN
ccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHcc
ccHHHHHHHHHHHHHHHHccccccHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccHHcccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHcccccccccEEEEEEEEcccccccccccccccccccEEHHHHHHHHHHHccccHcHEEEEEEEccccccccccccccccccccccHHHHHcccccHHcccccccccccEEHHHHHHHcc
MECLHRFCRECIDKAMrlgnnecpacrthcasrrslrddlNYDALIAALYPDIDKYEEEELAFQDEEAARNKQIQASIAQTFQRQTealgrkrtpkstsalrrshgryrdtplrgrrnyrmtelqgsdenddangdagkdsssaderstevrpkrrkrwygarfsqsssaaagtdgggdendsevhresmgasvgligpserlawgkggirshtrhgsvsgsngknarnNRLSKLVDYLQSLEEKDDQLDMHLVLVSLdeqripglqqpylccrptlsvrHLCQYVAHQTALQASEIEIYLVKELHskinlpsssnslmidpckdKLQVLNEQetltglqtqnlgHGFLLLAYQKILLN
MECLHRFCRECIDKAmrlgnnecpACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQIQASIAQTFqrqtealgrkrtpkstsalrrshgryrdtplrgrrnYRMTelqgsdenddangdagkdsssaderstevrpkrrkrwygarfsqsssaaagtdgggDENDSEVHRESMGASVGLIGPSERLAWGKGGIRShtrhgsvsgsngknarnnrLSKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINLPSSSNSLMIDPCKDKLQVLNEQETLtglqtqnlghGFLLLAYQKILLN
MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYeeeelafqdeeaaRNKQIQASIAQTFQRQTEALGRKRTPKSTSALRRSHGRYRDTPLRGRRNYRMTELQGSDENDDANGDAGKDSSSADERSTEVRPKRRKRWYGARFsqsssaaagtdgggDENDSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHGSVSGSNGKNARNNRLSKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQNLGHGFLLLAYQKILLN
**CLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYE**********************************************************************************************************************************************************************************VDYLQ******DQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINL******LMIDPCKDKLQVLNEQETLTGLQTQNLGHGFLLLAYQKIL**
MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKY**************************************************************************************************************************************************************************************************MHLVLVSLDE****G****YLCCRPTLSVRHLCQYVAHQTALQASEIEIYLV***************************LNEQETLTGLQTQNLGHGFLLLAYQKIL**
MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQIQASIAQTFQR**********************RYRDTPLRGRRNYRMTELQGS*****************************KRWY*****************************MGASVGLIGPSERLAWGKGGIRSH************NARNNRLSKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQNLGHGFLLLAYQKILLN
*ECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQIQASIAQTFQRQTEALGRKRT************************************************************************************************GASVG*IGPSERL*W***********************NNRLSKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELH***************PCKDKLQVLNEQETLTGLQTQNLGHGFLLLAYQKILLN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQIQASIAQTFQRQTEALGRKRTPKSTSALRRSHGRYRDTPLRGRRNYRMTELQGSDENDDANGDAGKDSSSADERSTEVRPKRRKRWYGARFSQSSSAAAGTDGGGDENDSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHGSVSGSNGKNARNNRLSKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQNLGHGFLLLAYQKILLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query359 2.2.26 [Sep-21-2011]
Q9FKW0522 Putative E3 ubiquitin-pro yes no 0.986 0.678 0.489 6e-83
Q0WX00460 Putative E3 ubiquitin-pro no no 0.938 0.732 0.469 8e-69
Q5R9J5336 E3 ubiquitin-protein liga yes no 0.155 0.166 0.607 4e-15
Q9CQJ4336 E3 ubiquitin-protein liga yes no 0.155 0.166 0.607 4e-15
Q99496336 E3 ubiquitin-protein liga yes no 0.155 0.166 0.607 4e-15
Q803I4336 E3 ubiquitin-protein liga yes no 0.155 0.166 0.607 4e-15
Q7ZWM8343 E3 ubiquitin-protein liga N/A no 0.181 0.189 0.550 4e-15
Q66J69344 E3 ubiquitin-protein liga N/A no 0.181 0.188 0.550 5e-15
Q4KLY4308 E3 ubiquitin-protein liga yes no 0.155 0.181 0.607 5e-15
Q6MGB6406 E3 ubiquitin-protein liga no no 0.155 0.137 0.589 1e-14
>sp|Q9FKW0|RNG1A_ARATH Putative E3 ubiquitin-protein ligase RING1a OS=Arabidopsis thaliana GN=RING1A PE=1 SV=2 Back     alignment and function desciption
 Score =  308 bits (788), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 181/370 (48%), Positives = 248/370 (67%), Gaps = 16/370 (4%)

Query: 1   MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEE 60
           MECLHRFCRECIDK+MRLGNNECPACR HCASRRSLRDD  +DALIAAL+ +ID YEEEE
Sbjct: 150 MECLHRFCRECIDKSMRLGNNECPACRKHCASRRSLRDDPKFDALIAALFTNIDSYEEEE 209

Query: 61  LAFQDEEAARNKQIQASIAQTFQRQTEALGRKRTPKSTSALRRSHGRYRDTPLRGRRNYR 120
           LAF ++E ARNKQIQASIAQ  QRQ+EAL ++R+    +A+     R      R R +  
Sbjct: 210 LAFHEDEMARNKQIQASIAQISQRQSEALVKRRSLGKEAAVLMRSPRIASGSRRRRNSRN 269

Query: 121 MTELQGSDENDDANGDA----GKDS-SSADERSTEVRPKRRKRWYGARFSQ--SSSAAAG 173
           M +   S+ ++D + D     G+D  SS+DER TEVR K+R++   +R +Q  SSS A  
Sbjct: 270 MEQQNASEAHEDDDNDDNNNRGRDKDSSSDERGTEVRQKKRRKRSTSRSTQHPSSSGANK 329

Query: 174 TDGGGDENDSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHG-SVSGSNGKNARNNRL 232
            +G   +ND+EV+R++ G S GL+   E LAWG+GG RS+TRHG + SG + K+ RN R+
Sbjct: 330 NNGNCADNDTEVYRDTKGISPGLVWNPEILAWGRGGTRSNTRHGNNTSGGSSKSVRNARV 389

Query: 233 SKLVDYLQ-SLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTA 291
           +KLV+YL+ S++    +LD+H+ LVSLD + IP L QPYLCCRPTL V+ L ++VA Q  
Sbjct: 390 NKLVEYLRSSVDGSSVELDIHVKLVSLDTKCIPDLPQPYLCCRPTLLVKQLREFVALQIH 449

Query: 292 LQASEIEIYL----VKELHSKINLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQNLG-- 345
           L+  E+E+ +    V E  +  NLP+ + +      KD++  L + ETL+ L+   +   
Sbjct: 450 LKTEEVELLVTRRRVGEDAAIENLPAVTPASAA-ASKDEMLSLEDNETLSRLKIDFISSH 508

Query: 346 HGFLLLAYQK 355
              L++AY+K
Sbjct: 509 EQHLIIAYRK 518
As part of the PRC1-like complex, repress class I KNOX gene expression. PcG PRC1 complex maintains the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q0WX00|RNG1B_ARATH Putative E3 ubiquitin-protein ligase RING1b OS=Arabidopsis thaliana GN=RING1B PE=1 SV=1 Back     alignment and function description
>sp|Q5R9J5|RING2_PONAB E3 ubiquitin-protein ligase RING2 OS=Pongo abelii GN=RNF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9CQJ4|RING2_MOUSE E3 ubiquitin-protein ligase RING2 OS=Mus musculus GN=Rnf2 PE=1 SV=1 Back     alignment and function description
>sp|Q99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 OS=Homo sapiens GN=RNF2 PE=1 SV=1 Back     alignment and function description
>sp|Q803I4|RING2_DANRE E3 ubiquitin-protein ligase RING2 OS=Danio rerio GN=rnf2 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZWM8|RNG2B_XENLA E3 ubiquitin-protein ligase RING2-B OS=Xenopus laevis GN=rnf2-b PE=2 SV=2 Back     alignment and function description
>sp|Q66J69|RNG2A_XENLA E3 ubiquitin-protein ligase RING2-A OS=Xenopus laevis GN=rnf2-a PE=2 SV=1 Back     alignment and function description
>sp|Q4KLY4|RING2_RAT E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus GN=Rnf2 PE=2 SV=1 Back     alignment and function description
>sp|Q6MGB6|RING1_RAT E3 ubiquitin-protein ligase RING1 OS=Rattus norvegicus GN=Ring1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
255536761418 ring finger protein, putative [Ricinus c 0.986 0.846 0.730 1e-141
224125396445 predicted protein [Populus trichocarpa] 0.958 0.773 0.675 1e-138
224079177 463 predicted protein [Populus trichocarpa] 0.974 0.755 0.699 1e-133
359483484 534 PREDICTED: putative E3 ubiquitin-protein 0.983 0.661 0.699 1e-129
297740412433 unnamed protein product [Vitis vinifera] 0.983 0.815 0.699 1e-129
302143319 568 unnamed protein product [Vitis vinifera] 0.988 0.625 0.629 1e-109
359485403412 PREDICTED: putative E3 ubiquitin-protein 0.988 0.861 0.629 1e-108
224133478 497 predicted protein [Populus trichocarpa] 0.955 0.690 0.596 1e-100
111183164433 putative zinc finger protein [Solanum ly 0.966 0.801 0.580 9e-99
147774461 636 hypothetical protein VITISV_001902 [Viti 0.838 0.473 0.594 3e-97
>gi|255536761|ref|XP_002509447.1| ring finger protein, putative [Ricinus communis] gi|223549346|gb|EEF50834.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 268/367 (73%), Positives = 303/367 (82%), Gaps = 13/367 (3%)

Query: 1   MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEE 60
           MECLHRFCRECIDK+MRLGNNECPACRTHCASRRSLRDD NYDALIAALYPDIDKYEEEE
Sbjct: 54  MECLHRFCRECIDKSMRLGNNECPACRTHCASRRSLRDDPNYDALIAALYPDIDKYEEEE 113

Query: 61  LAFQDEEAARNKQIQASIAQTFQRQTEALGRKRT-PKSTSA--LRRSHGRYRDTPLRGRR 117
           LAF +EE ARNKQIQASI QT +RQ EALGRKRT  K+T A   RR+ GRYRD   RGRR
Sbjct: 114 LAFHEEEKARNKQIQASITQTIRRQAEALGRKRTTAKATVAPFARRTQGRYRDAHSRGRR 173

Query: 118 NYRMTELQGSDENDDANGDAGKDSSSADERSTEVRPKRRKRWYGARFSQSSSAAAGTDGG 177
           NYR  +LQGSDE +D NGD GKDSSSA+E S EV+PKR KRW GAR     S AA  DGG
Sbjct: 174 NYRTADLQGSDEIEDVNGDGGKDSSSAEEHSAEVKPKRIKRWGGAR-----SGAANADGG 228

Query: 178 GDENDSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHGSVSGSNGKNARNNRLSKLVD 237
           GDENDSEV+RESMG+S GL+GPSERLAWG+GGIRSHTR+GS +  NGKNARN+R+ KL D
Sbjct: 229 GDENDSEVNRESMGSSAGLVGPSERLAWGRGGIRSHTRYGSANAGNGKNARNSRIFKLAD 288

Query: 238 YLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEI 297
           YL++LEE +++LD+ L+LVS DE++IP LQ+PYLCCRPTLSV+HL QYVA QTALQ  EI
Sbjct: 289 YLRNLEENNNELDICLMLVSFDEEKIPSLQRPYLCCRPTLSVKHLRQYVALQTALQTEEI 348

Query: 298 EIYLVKELHSKIN-LPSSSNSL----MIDPCKDKLQVLNEQETLTGLQTQNLGHGFLLLA 352
           EIYLVKEL+SK N LPS+S S+    +IDP KDKLQVL EQET+ GL+T N   G +LLA
Sbjct: 349 EIYLVKELNSKFNSLPSTSISISKPGIIDPRKDKLQVLEEQETVGGLKTNNFTQGHVLLA 408

Query: 353 YQKILLN 359
           YQK L N
Sbjct: 409 YQKRLWN 415

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125396|ref|XP_002329795.1| predicted protein [Populus trichocarpa] gi|222870857|gb|EEF07988.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224079177|ref|XP_002305782.1| predicted protein [Populus trichocarpa] gi|222848746|gb|EEE86293.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359483484|ref|XP_002273941.2| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740412|emb|CBI30594.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143319|emb|CBI21880.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485403|ref|XP_002274885.2| PREDICTED: putative E3 ubiquitin-protein ligase RING1a-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224133478|ref|XP_002328052.1| predicted protein [Populus trichocarpa] gi|222837461|gb|EEE75840.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|111183164|gb|ABH07901.1| putative zinc finger protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|147774461|emb|CAN59794.1| hypothetical protein VITISV_001902 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
TAIR|locus:2158705525 RING1A "RING 1A" [Arabidopsis 0.930 0.636 0.434 1.8e-62
TAIR|locus:2825930274 AT1G28327 "AT1G28327" [Arabido 0.721 0.945 0.278 4.9e-21
RGD|1305491308 Rnf2 "ring finger protein 2" [ 0.153 0.178 0.6 2.7e-15
ZFIN|ZDB-GENE-030131-5243336 rnf2 "ring finger protein 2" [ 0.200 0.214 0.486 4.8e-15
UNIPROTKB|E1BQF7336 RNF2 "Uncharacterized protein" 0.200 0.214 0.486 5.5e-15
UNIPROTKB|Q99496336 RNF2 "E3 ubiquitin-protein lig 0.153 0.163 0.6 6e-15
UNIPROTKB|Q5R9J5336 RNF2 "E3 ubiquitin-protein lig 0.153 0.163 0.6 6e-15
UNIPROTKB|A6QLQ0336 RNF2 "RNF2 protein" [Bos tauru 0.153 0.163 0.6 7.6e-15
MGI|MGI:1101759336 Rnf2 "ring finger protein 2" [ 0.153 0.163 0.6 7.6e-15
UNIPROTKB|F1S3N6336 RNF2 "Uncharacterized protein" 0.153 0.163 0.6 9.6e-15
TAIR|locus:2158705 RING1A "RING 1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 638 (229.6 bits), Expect = 1.8e-62, P = 1.8e-62
 Identities = 153/352 (43%), Positives = 213/352 (60%)

Query:    20 NNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYXXXXXXXXXXXXXRNKQIQASIA 79
             NNECPACR HCASRRSLRDD  +DALIAAL+ +ID Y             RNKQIQASIA
Sbjct:   172 NNECPACRKHCASRRSLRDDPKFDALIAALFTNIDSYEEEELAFHEDEMARNKQIQASIA 231

Query:    80 QTFQRQTEALGRKRT-PKSTSALRRS----HGRYRDTPLRGRRNYRMTELQGSDENDDAN 134
             Q  QRQ+EAL ++R+  K  + L RS     G  R    R       +E    D+NDD N
Sbjct:   232 QISQRQSEALVKRRSLGKEAAVLMRSPRIASGSRRRRNSRNMEQQNASEAHEDDDNDD-N 290

Query:   135 GDAGKDS-SSADERSTEVRPKRRKRWYGARFXXXXXXXXXXXXXXD--ENDSEVHRESMG 191
              + G+D  SS+DER TEVR K+R++   +R               +  +ND+EV+R++ G
Sbjct:   291 NNRGRDKDSSSDERGTEVRQKKRRKRSTSRSTQHPSSSGANKNNGNCADNDTEVYRDTKG 350

Query:   192 ASVGLIGPSERLAWGKGGIRSHTRHGS-VSGSNGKNARNNRLSKLVDYLQS-LEEKDDQL 249
              S GL+   E LAWG+GG RS+TRHG+  SG + K+ RN R++KLV+YL+S ++    +L
Sbjct:   351 ISPGLVWNPEILAWGRGGTRSNTRHGNNTSGGSSKSVRNARVNKLVEYLRSSVDGSSVEL 410

Query:   250 DMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKEL---H 306
             D+H+ LVSLD + IP L QPYLCCRPTL V+ L ++VA Q  L+  E+E+ + +      
Sbjct:   411 DIHVKLVSLDTKCIPDLPQPYLCCRPTLLVKQLREFVALQIHLKTEEVELLVTRRRVGED 470

Query:   307 SKI-NLPSSSNSLMIDPCKDKLQVLNEQETLTGLQTQNLG-HG-FLLLAYQK 355
             + I NLP+ + +      KD++  L + ETL+ L+   +  H   L++AY+K
Sbjct:   471 AAIENLPAVTPASAA-ASKDEMLSLEDNETLSRLKIDFISSHEQHLIIAYRK 521
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0001709 "cell fate determination" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0010076 "maintenance of floral meristem identity" evidence=IMP
GO:0010077 "maintenance of inflorescence meristem identity" evidence=IMP
GO:0010492 "maintenance of shoot apical meristem identity" evidence=IMP
GO:0035102 "PRC1 complex" evidence=IPI
GO:0045814 "negative regulation of gene expression, epigenetic" evidence=IGI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IGI
TAIR|locus:2825930 AT1G28327 "AT1G28327" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1305491 Rnf2 "ring finger protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5243 rnf2 "ring finger protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQF7 RNF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q99496 RNF2 "E3 ubiquitin-protein ligase RING2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R9J5 RNF2 "E3 ubiquitin-protein ligase RING2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLQ0 RNF2 "RNF2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1101759 Rnf2 "ring finger protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3N6 RNF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-08
smart0018440 smart00184, RING, Ring finger 2e-06
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-06
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-04
COG5222427 COG5222, COG5222, Uncharacterized conserved protei 0.002
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information 
 Score = 49.4 bits (118), Expect = 2e-08
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 1  MECLHRFCRECIDKAMRLGNNECPACRTHC 30
          + C H FCR CIDK ++ G N CP CRT  
Sbjct: 16 LPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45

Length = 45
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 359
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 99.97
KOG2660331 consensus Locus-specific chromosome binding protei 99.44
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.44
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 98.35
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.28
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.21
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.12
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.11
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.06
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.05
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.03
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.0
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.97
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.96
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.92
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.89
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.85
PF1463444 zf-RING_5: zinc-RING finger domain 97.77
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.71
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.54
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.25
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.16
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.11
PF11816331 DUF3337: Domain of unknown function (DUF3337); Int 97.03
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.95
KOG4739233 consensus Uncharacterized protein involved in syna 96.31
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.2
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 95.64
COG5222427 Uncharacterized conserved protein, contains RING Z 95.51
KOG0297391 consensus TNF receptor-associated factor [Signal t 95.34
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 95.18
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.7
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 94.28
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 94.27
KOG0825 1134 consensus PHD Zn-finger protein [General function 94.13
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.98
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 93.82
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 92.69
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.05
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 91.98
PF04641260 Rtf2: Rtf2 RING-finger 90.7
KOG149384 consensus Anaphase-promoting complex (APC), subuni 90.43
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 89.49
KOG1001674 consensus Helicase-like transcription factor HLTF/ 88.86
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 88.02
cd01611112 GABARAP Ubiquitin domain of GABA-receptor-associat 87.91
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 86.05
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 85.8
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 85.02
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 84.77
cd0161287 APG12_C Ubiquitin-like domain of APG12. APG12_C Th 84.2
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 83.82
KOG3039303 consensus Uncharacterized conserved protein [Funct 81.24
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 80.76
PHA03096284 p28-like protein; Provisional 80.69
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.97  E-value=1.5e-31  Score=261.87  Aligned_cols=308  Identities=34%  Similarity=0.468  Sum_probs=231.5

Q ss_pred             CCCccccHHHHHHHHhcCCCCcccccccccCCCCCCCChHHHHHHHHHCCChHHHHHHHHhhhHHHHHHHHH-Hhhhhhh
Q 018247            2 ECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEELAFQDEEAARNKQ-IQASIAQ   80 (359)
Q Consensus         2 ~CGHtFCR~CI~k~~~~~~~~CPvCR~~~~~~~~LRpn~~L~~Liekl~P~l~~~e~~e~af~e~~k~~~~~-iq~~i~~   80 (359)
                      +|+|.||..||.+.++.+++.||.||+.+.++++|++|++|..||.++||.++.|+..+..|.+++...+.+ |+.+|.+
T Consensus        61 eClhrfc~~ci~~a~r~gn~ecptcRk~l~SkrsLr~Dp~fdaLis~i~~sie~~e~~q~~~~ekd~~~~~q~i~~si~~  140 (381)
T KOG0311|consen   61 ECLHRFCFDCIWKALRSGNNECPTCRKKLVSKRSLRIDPNFDALISKIYPSIEEYEAPQPRFMEKDDSAQIQYIKTSINA  140 (381)
T ss_pred             HHHHHHHHHHHHHHHHhcCCCCchHHhhccccccCCCCccHHHHHHHHhccHHHHhccchhHHhhHHHHhHHHHhhhHHH
Confidence            699999999999999888999999999999999999999999999999999999999999999988887777 9999999


Q ss_pred             hHHHHHHHhhccCCCCcchhhhccccCCCCCccCCCCCCcccccCC-CC-CcccCCC---CCCCCCCCCcccccccchhh
Q 018247           81 TFQRQTEALGRKRTPKSTSALRRSHGRYRDTPLRGRRNYRMTELQG-SD-ENDDANG---DAGKDSSSADERSTEVRPKR  155 (359)
Q Consensus        81 ~~~rq~~sl~~~~~~~~~~~~rrt~~~~r~~~~~~r~~~~~~~~~~-~~-~~~~~~~---~~~~~sss~d~~~~~~~~kr  155 (359)
                      ..++|+..++++......    |+.+..-  .++++++.+..+.+. +. +++++|.   +-++++|+ |+..   ...|
T Consensus       141 ~~~~qs~~~~kr~a~~~~----~s~r~g~--Gs~~~gn~r~~~~s~~~a~~ea~~~~~~n~rg~~ss~-d~~~---~~~~  210 (381)
T KOG0311|consen  141 AVDHQSSYLTKRKALEEL----RSIRWGG--GSRRRGNVRNVEQSKKSAPKEADGNDDENDRGKDSSS-DELM---DFPR  210 (381)
T ss_pred             HHhhhhhhhhhhhccccc----ccccccC--CCCCCCCcccchhccccCCccCCCccccccccccccc-cccc---cccc
Confidence            999999999988876222    3333332  345666666532221 11 1112222   12344444 5552   2222


Q ss_pred             hcccccCCCCC-CCCCcCC-CCCCCCCCchhhhhhhcCCCCCCCCCccccccccCCcccccccCCC-CCCCCCCCcchhh
Q 018247          156 RKRWYGARFSQ-SSSAAAG-TDGGGDENDSEVHRESMGASVGLIGPSERLAWGKGGIRSHTRHGSV-SGSNGKNARNNRL  232 (359)
Q Consensus       156 ~~~~~~~~~~q-~~~~~~~-~~~g~~~~~~e~~~e~~~~~~~l~~~~~~l~wgk~g~RS~~R~gs~-~gs~~~~~r~~r~  232 (359)
                      ..+.. .+-.+ +++++++ .++.++.+|.|..++...++.+++|+.|..+||.+|+|+.||+|+. -|+-....|+++.
T Consensus       211 ~~~S~-d~~~~~~~~s~as~~~~~~~~a~te~~~~~~~i~r~~v~~~e~~~s~r~~~~~~t~n~~~~~~~k~~~vr~a~~  289 (381)
T KOG0311|consen  211 EIRSS-DREQTHPSSSGASMNDSNCAGADTEDVRDSSTISRTLVWNRESSESGRGGTRSNTRNGNNKMGRKSLAVRNALE  289 (381)
T ss_pred             ccccc-ccccCCCCccccccCCCcccCCCCcccccccccccccccccccchhccCCccccccccccccccchhhhhHHHH
Confidence            22222 22112 3344444 5666677777777999999999999999999999999999999985 3333344588999


Q ss_pred             HHHHHHhhhhhcccCceeeEEEEeecCCCCCCCCCCCceeccCCccHHHHHHHHHhhccCCcccEEEEEEeccccCCCCC
Q 018247          233 SKLVDYLQSLEEKDDQLDMHLVLVSLDEQRIPGLQQPYLCCRPTLSVRHLCQYVAHQTALQASEIEIYLVKELHSKINLP  312 (359)
Q Consensus       233 ~klvd~L~~~~e~d~e~di~l~Lvs~d~q~iP~L~~PYL~CrPTlsVkhLcqyvA~q~sl~~eEvEi~v~k~~~~~~~~~  312 (359)
                      .++++|++..+...++                                    |||.+..+..+++|+.+.....-.. ..
T Consensus       290 ~~~~e~~~~~~G~S~~------------------------------------~~~~~~~~~~~~~~~~~~~~~~~d~-~~  332 (381)
T KOG0311|consen  290 VRLSEYDGSVEGTSNI------------------------------------KVAKKKPLKREEVELLVELIHPLDT-AS  332 (381)
T ss_pred             HHhhhhcccccccccc------------------------------------cccccCCcccccccccccccccccc-cc
Confidence            9999999977777777                                    9999999999999999887632111 00


Q ss_pred             CCCCCcccCCCcchhhhccccccccccccc-cCCCcceeehhhhhh
Q 018247          313 SSSNSLMIDPCKDKLQVLNEQETLTGLQTQ-NLGHGFLLLAYQKIL  357 (359)
Q Consensus       313 ~~~~~~~~d~~~d~le~L~~~~tl~~L~~~-~~~~g~L~l~Y~~k~  357 (359)
                      -+-..--+.+.+|++..|++.+||+.++.+ |..++.++|-|..|.
T Consensus       333 enn~~iy~a~~~~~~~~Lng~~Tls~v~~df~kvn~~m~l~~~~kk  378 (381)
T KOG0311|consen  333 ENNYTIYIATSKDQFTSLNGDETLSLVKEDFWKVNEPMELSYHEKK  378 (381)
T ss_pred             cccceeEeecCCCceEEecccchHHHHhhhhhhcccchhhhhchhc
Confidence            011112567899999999999999999999 999999999998763

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>cd01612 APG12_C Ubiquitin-like domain of APG12 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
2ckl_B165 Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 5e-15
3rpg_C121 Bmi1RING1B-Ubch5c Complex Structure Length = 121 8e-14
2h0d_B100 Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti 2e-12
>pdb|2CKL|B Chain B, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 165 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (72%)
Query: 2   ECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKY 56
           ECLHRFC +CI  A+R GN ECP CR    S+RSLR D N+DALI+ +YP  D+Y
Sbjct: 72  ECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEY 126
>pdb|3RPG|C Chain C, Bmi1RING1B-Ubch5c Complex Structure Length = 121 Back     alignment and structure
>pdb|2H0D|B Chain B, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 100 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 4e-21
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 5e-13
1z6u_A150 NP95-like ring finger protein isoform B; structura 5e-11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 7e-11
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-09
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 4e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 9e-08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 4e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 5e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 9e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 5e-06
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 2e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 3e-05
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 4e-05
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 9e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-04
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 4e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 6e-04
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
 Score = 88.1 bits (218), Expect = 4e-21
 Identities = 39/88 (44%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 1   MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEEE 60
            ECLHRFC +CI  A+R GN ECP CR    S+RSLR D N+DALI+ +YP  D+YE  +
Sbjct: 71  KECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQ 130

Query: 61  LAFQDEEAARNKQ--IQASIAQTFQRQT 86
                     N Q  +  SI +  + Q 
Sbjct: 131 ERVLARINKHNNQQALSHSIEEGLKIQA 158
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.29
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.23
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.14
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.04
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.01
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.88
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.87
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.87
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.85
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.82
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.81
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.78
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.73
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.72
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.7
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.69
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.68
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.67
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.62
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.6
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.57
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.56
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.55
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.54
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.52
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.51
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.51
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.49
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.47
2ect_A78 Ring finger protein 126; metal binding protein, st 98.46
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.44
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.43
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.39
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.38
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.37
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.36
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.35
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.33
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.29
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.29
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.29
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.27
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.27
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.26
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.24
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.24
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.2
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.97
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.88
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.83
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.78
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.78
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.78
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.67
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.54
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.46
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.4
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.17
2ea5_A68 Cell growth regulator with ring finger domain prot 97.13
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 93.92
3h9d_A119 ATG8, microtubule-associated protein 1A/1B, light 90.01
3rui_B118 Autophagy-related protein 8; autophagosome formati 89.66
3m95_A125 Autophagy related protein ATG8; alpha slash beta, 87.11
2r2q_A110 Gamma-aminobutyric acid receptor-associated protei 85.7
3gs2_A111 E3 ubiquitin-protein ligase RING2; RING1B, CBOX, C 84.75
1eo6_A117 GATE-16, golgi-associated ATPase enhancer of 16 KD 84.13
1wz3_A96 Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla 83.89
4gdk_A91 Ubiquitin-like protein ATG12; protein-protein conj 83.63
2zjd_A130 Microtubule-associated proteins 1A/1B light chain 82.84
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 82.84
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 82.82
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
Probab=99.29  E-value=1.1e-12  Score=113.86  Aligned_cols=86  Identities=44%  Similarity=0.834  Sum_probs=45.7

Q ss_pred             CCCCccccHHHHHHHHhcCCCCcccccccccCCCCCCCChHHHHHHHHHCCChHHHHHH-HHhhhHHHHHH-HHHHhhhh
Q 018247            1 MECLHRFCRECIDKAMRLGNNECPACRTHCASRRSLRDDLNYDALIAALYPDIDKYEEE-ELAFQDEEAAR-NKQIQASI   78 (359)
Q Consensus         1 t~CGHtFCR~CI~k~~~~~~~~CPvCR~~~~~~~~LRpn~~L~~Liekl~P~l~~~e~~-e~af~e~~k~~-~~~iq~~i   78 (359)
                      ++|||+||+.||.+|+..+...||+||..+.....+++|..|.+++..+++....++.+ +..|.+..+.. ...++.++
T Consensus        71 ~~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~l~~~~~l~~~i~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~s~  150 (165)
T 2ckl_B           71 KECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSI  150 (165)
T ss_dssp             TTTCCEEEHHHHHHHHHTTCCBCTTTCCBCCSGGGEEECHHHHHHHHHHC------------------------------
T ss_pred             CCCCChhHHHHHHHHHHhCcCCCCCCCCcCCCcccCCcCHHHHHHHHHHHcchhHHHHHHHHHHHHHHhhhhHHHHHHhH
Confidence            38999999999999998557789999999876678999999999999999998888763 34454433333 33445666


Q ss_pred             hhhHHHHH
Q 018247           79 AQTFQRQT   86 (359)
Q Consensus        79 ~~~~~rq~   86 (359)
                      ...++.|+
T Consensus       151 ~~~~~~q~  158 (165)
T 2ckl_B          151 EEGLKIQA  158 (165)
T ss_dssp             --------
T ss_pred             HHHHHHHH
Confidence            66555444
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 Back     alignment and structure
>3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Back     alignment and structure
>3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 Back     alignment and structure
>2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Back     alignment and structure
>3gs2_A E3 ubiquitin-protein ligase RING2; RING1B, CBOX, CBX7, polycomb, E3-ligase, chromosomal protein transcription regulation, chromatin regulator; 1.70A {Homo sapiens} PDB: 3ixs_A* 3h8h_A* Back     alignment and structure
>1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Back     alignment and structure
>1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 Back     alignment and structure
>4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A Back     alignment and structure
>2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 359
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-08
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-07
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-06
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-04
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 3e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-04
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 48.4 bits (115), Expect = 3e-08
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 1  MECLHRFCRECIDKAMRLGNNECPACRTHCASR------RSLRDDLN 41
            C H FCR CI + +++  + CP+CR  C         +S  + LN
Sbjct: 39 TSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLNILN 85
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.98
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.91
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.9
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.89
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.76
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.58
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.51
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.46
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.36
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.29
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.21
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.2
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.14
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.06
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.59
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.85
d3d32a1118 GABA(A) receptor associated protein GABARAP {Human 84.11
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.98  E-value=6.7e-11  Score=94.35  Aligned_cols=48  Identities=29%  Similarity=0.760  Sum_probs=40.3

Q ss_pred             CCCCccccHHHHHHHHhcC--CCCcccccccccCCCCCCCChHHHHHHHHH
Q 018247            1 MECLHRFCRECIDKAMRLG--NNECPACRTHCASRRSLRDDLNYDALIAAL   49 (359)
Q Consensus         1 t~CGHtFCR~CI~k~~~~~--~~~CPvCR~~~~~~~~LRpn~~L~~Liekl   49 (359)
                      ++|||+||+.||.+||...  ...||+||..+. ...+++|..+.++++.+
T Consensus        37 ~~CgH~fC~~Ci~~~~~~~~~~~~CP~Cr~~~~-~~~l~~n~~l~~~ve~l   86 (103)
T d1jm7a_          37 TKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDIT-KRSLQESTRFSQLVEEL   86 (103)
T ss_dssp             CTTSCCCCSHHHHHHHHSSSSSCCCTTTSCCCC-TTTCBCCCSSSHHHHHH
T ss_pred             cCCCCchhhHHHHHHHHHCCCCCcCcCCCCcCC-hhhCCcCHHHHHHHHHH
Confidence            5899999999999999752  357999999985 45789999888888766
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure