Citrus Sinensis ID: 018252

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MSSLEEPLGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAYL
cccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHcccccccccEEEcccHHHHHHHHHccccEEEEEEcccHHHHHHcccccHHHHHHHHHHHHHHHHHccccEEEEEEcEEcccccccccHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHccccEEEcccccccc
ccccccccccccccccccHHHHHcccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccEEEcccccEEcccccccccccccHHHHHHccHHHHcccccEEEEEEEccccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHcccccEEcEcccccHHHHHHHHccccEEEEEEccHHHHccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHccHHHHEEHcccHHHHHHHHHHHHHHccccEEcccEEEEEc
mssleeplgldklpsmstidriqrfssnacrpsgdgmgmgscwiegsscstsnsydedydeytreafpwrrhtrdmshgdsfsrrtvslgrnhkmFGSACDiynsncndkdiRDITNKFLKGIPRFVKIVevgprdglqnekntvptgVKVELIRRLVSsglpvveatsfvspkwvpqlaDARDVMEAVRDLegarlpvltpnlKGFEAAIAAGAKEVAIFASASEafsksnincsieDSLVRYRAVAHAAKVLSIPVRGYVSCvvgcpvegaippskVAYVAKELHdmgcfeislgdtigvgtpgtvvPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLqvspmhakpcftfayl
mssleeplgldklpsmstiDRIQRfssnacrpsgdGMGMGSCWIEGSSCSTSNSYDEDYDEYTReafpwrrhtrdmshgdsfsrrtvslgrNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVevgprdglqnekntvptgvkVELIRRLVSSglpvveatsfvspkwvpqLADARDVMEAVRDLEgarlpvltpnLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAYL
MSSLEEPLGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLkgfeaaiaagakevaifaSASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAYL
***************************************GSCWIE****************YTREAFPW******************SLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAY*
*****EPLGLDKLPSMSTIDRIQ******************CWIE***************************************************************************KGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAYL
********GLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGS************DEYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAYL
*******LGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAYL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLEEPLGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYDEYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFTFAYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query359 2.2.26 [Sep-21-2011]
O81027468 Hydroxymethylglutaryl-CoA yes no 0.958 0.735 0.713 1e-143
Q29448325 Hydroxymethylglutaryl-CoA yes no 0.651 0.72 0.628 3e-82
P35915298 Hydroxymethylglutaryl-CoA yes no 0.618 0.744 0.657 3e-82
P97519325 Hydroxymethylglutaryl-CoA yes no 0.651 0.72 0.615 1e-81
P38060325 Hydroxymethylglutaryl-CoA yes no 0.654 0.723 0.608 3e-81
Q8JZS7343 3-hydroxymethyl-3-methylg no no 0.629 0.658 0.623 3e-81
Q5R9E1325 Hydroxymethylglutaryl-CoA yes no 0.654 0.723 0.612 8e-81
Q8HXZ6325 Hydroxymethylglutaryl-CoA N/A no 0.651 0.72 0.611 6e-80
Q8TB92370 3-hydroxymethyl-3-methylg no no 0.629 0.610 0.610 6e-80
P35914325 Hydroxymethylglutaryl-CoA no no 0.654 0.723 0.604 7e-80
>sp|O81027|HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana GN=HMGCL PE=1 SV=2 Back     alignment and function desciption
 Score =  506 bits (1304), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 251/352 (71%), Positives = 288/352 (81%), Gaps = 8/352 (2%)

Query: 1   MSSLEEPLGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYD 60
           MSSLEEPL  DKLPSMST+DRIQRFSS ACRP  D +GMG  WIEG  C+TSNS  +D  
Sbjct: 36  MSSLEEPLSFDKLPSMSTMDRIQRFSSGACRPRDD-VGMGHRWIEGRDCTTSNSCIDDDK 94

Query: 61  EYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACD-------IYNSNCNDKDIR 113
            + +E+FPWRRHTR +S G+   R     GR   + G+  +        Y++  N+    
Sbjct: 95  SFAKESFPWRRHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTFSNENGTS 154

Query: 114 DITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSP 173
            I+NK  KGIP+FVKIVEVGPRDGLQNEKN VPT VKVELI+RLVSSGLPVVEATSFVSP
Sbjct: 155 HISNKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSP 214

Query: 174 KWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNI 233
           KWVPQLADA+DVM+AV  L+GARLPVLTPNLKGF+AA++AGAKEVAIFASASE+FS SNI
Sbjct: 215 KWVPQLADAKDVMDAVNTLDGARLPVLTPNLKGFQAAVSAGAKEVAIFASASESFSLSNI 274

Query: 234 NCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFE 293
           NC+IE+SL+RYR VA AAK  S+PVRGYVSCVVGCPVEG + PSKVAYV KEL+DMGCFE
Sbjct: 275 NCTIEESLLRYRVVATAAKEHSVPVRGYVSCVVGCPVEGPVLPSKVAYVVKELYDMGCFE 334

Query: 294 ISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQV 345
           ISLGDTIG+GTPG+VVPMLEAVMAVVP +KLAVH HDTYGQ+L NIL+SLQ+
Sbjct: 335 ISLGDTIGIGTPGSVVPMLEAVMAVVPADKLAVHFHDTYGQALANILVSLQM 386
Involved in the catabolism of branched amino acids such as leucine.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 1EC: .EC: 3EC: .EC: 4
>sp|Q29448|HMGCL_BOVIN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Bos taurus GN=HMGCL PE=2 SV=2 Back     alignment and function description
>sp|P35915|HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus GN=HMGCL PE=1 SV=1 Back     alignment and function description
>sp|P97519|HMGCL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Rattus norvegicus GN=Hmgcl PE=2 SV=1 Back     alignment and function description
>sp|P38060|HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus GN=Hmgcl PE=1 SV=2 Back     alignment and function description
>sp|Q8JZS7|HMGC2_MOUSE 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Mus musculus GN=Hmgcll1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R9E1|HMGCL_PONAB Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Pongo abelii GN=HMGCL PE=2 SV=1 Back     alignment and function description
>sp|Q8HXZ6|HMGCL_MACFA Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Macaca fascicularis GN=HMGCL PE=2 SV=1 Back     alignment and function description
>sp|Q8TB92|HMGC2_HUMAN 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Homo sapiens GN=HMGCLL1 PE=1 SV=3 Back     alignment and function description
>sp|P35914|HMGCL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens GN=HMGCL PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
225435868432 PREDICTED: hydroxymethylglutaryl-CoA lya 0.958 0.796 0.795 1e-161
224105993429 predicted protein [Populus trichocarpa] 0.949 0.794 0.801 1e-160
356521713433 PREDICTED: hydroxymethylglutaryl-CoA lya 0.961 0.796 0.786 1e-159
356574064435 PREDICTED: hydroxymethylglutaryl-CoA lya 0.961 0.793 0.762 1e-155
356499297433 PREDICTED: hydroxymethylglutaryl-CoA lya 0.961 0.796 0.754 1e-154
357458799433 Hydroxymethylglutaryl-CoA lyase [Medicag 0.961 0.796 0.747 1e-153
356554185433 PREDICTED: hydroxymethylglutaryl-CoA lya 0.961 0.796 0.751 1e-152
84453198433 putative hydroxymethylglutaryl-CoA lyase 0.961 0.796 0.738 1e-149
449444847432 PREDICTED: hydroxymethylglutaryl-CoA lya 0.952 0.791 0.745 1e-145
30683260433 Hydroxymethylglutaryl-CoA lyase [Arabido 0.958 0.794 0.713 1e-141
>gi|225435868|ref|XP_002263865.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial [Vitis vinifera] gi|296083893|emb|CBI24281.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  573 bits (1476), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 280/352 (79%), Positives = 309/352 (87%), Gaps = 8/352 (2%)

Query: 1   MSSLEEPLGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYD 60
           MSSLEEPLGLD L S+STID +QRFSSNACRP  + MGMGSCWI+G +CS+SN+ +EDY+
Sbjct: 1   MSSLEEPLGLDNLSSLSTID-LQRFSSNACRPRAEDMGMGSCWIDGRTCSSSNNCNEDYE 59

Query: 61  EYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDIYNSN-------CNDKDIR 113
            YTREAF W+R TR+ S GDS  RRT S GR+  ++GS+CD + S+       CN+K +R
Sbjct: 60  GYTREAFQWKRQTRETSQGDSLKRRTSSQGRSCMVYGSSCDSWYSSDHQYGFQCNNKGVR 119

Query: 114 DITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSP 173
            + NKFL GIP+FVKIVEVGPRDGLQNEKN VPT VKVELI RLVS GLPVVEATSFVSP
Sbjct: 120 GMANKFLGGIPKFVKIVEVGPRDGLQNEKNIVPTAVKVELIHRLVSCGLPVVEATSFVSP 179

Query: 174 KWVPQLADARDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNI 233
           KWVPQLADA+DVMEAVR+LEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASE+FSKSNI
Sbjct: 180 KWVPQLADAKDVMEAVRNLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASESFSKSNI 239

Query: 234 NCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFE 293
           NCSIE+SL RYRAVA AAK LSIPVRGYVSCVVGCPVEGAI PSKVAYVAKEL+DMGCFE
Sbjct: 240 NCSIEESLTRYRAVALAAKKLSIPVRGYVSCVVGCPVEGAISPSKVAYVAKELYDMGCFE 299

Query: 294 ISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQV 345
           ISLGDTIGV TPG +VPMLEAVMAVVPVEKLAVH HDTYGQSLPNIL+SLQ+
Sbjct: 300 ISLGDTIGVATPGAIVPMLEAVMAVVPVEKLAVHFHDTYGQSLPNILLSLQM 351

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224105993|ref|XP_002314006.1| predicted protein [Populus trichocarpa] gi|222850414|gb|EEE87961.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521713|ref|XP_003529496.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356574064|ref|XP_003555172.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356499297|ref|XP_003518478.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357458799|ref|XP_003599680.1| Hydroxymethylglutaryl-CoA lyase [Medicago truncatula] gi|355488728|gb|AES69931.1| Hydroxymethylglutaryl-CoA lyase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356554185|ref|XP_003545429.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|84453198|dbj|BAE71196.1| putative hydroxymethylglutaryl-CoA lyase [Trifolium pratense] Back     alignment and taxonomy information
>gi|449444847|ref|XP_004140185.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like [Cucumis sativus] gi|449481007|ref|XP_004156054.1| PREDICTED: hydroxymethylglutaryl-CoA lyase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30683260|ref|NP_850087.1| Hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana] gi|22136060|gb|AAM91612.1| putative hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana] gi|23197746|gb|AAN15400.1| putative hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana] gi|330252794|gb|AEC07888.1| Hydroxymethylglutaryl-CoA lyase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
TAIR|locus:2039548468 AT2G26800 [Arabidopsis thalian 0.958 0.735 0.670 6.7e-120
UNIPROTKB|E1BU09342 HMGCLL1 "Uncharacterized prote 0.623 0.654 0.584 7.2e-68
UNIPROTKB|F1NWD1298 HMGCL "Hydroxymethylglutaryl-C 0.618 0.744 0.599 1.2e-67
UNIPROTKB|F1P1E7301 HMGCL "Hydroxymethylglutaryl-C 0.618 0.737 0.599 1.2e-67
ZFIN|ZDB-GENE-040426-958340 hmgcl "3-hydroxymethyl-3-methy 0.623 0.658 0.602 1.2e-67
MGI|MGI:2446108343 Hmgcll1 "3-hydroxymethyl-3-met 0.629 0.658 0.579 4e-67
UNIPROTKB|P35915298 HMGCL "Hydroxymethylglutaryl-C 0.618 0.744 0.594 5.1e-67
UNIPROTKB|Q8TB92370 HMGCLL1 "3-hydroxymethyl-3-met 0.629 0.610 0.570 1.7e-66
UNIPROTKB|Q29448325 HMGCL "Hydroxymethylglutaryl-C 0.651 0.72 0.564 3.6e-66
DICTYBASE|DDB_G0283813 406 hmgL "hydroxymethylglutaryl-Co 0.727 0.642 0.509 4.5e-66
TAIR|locus:2039548 AT2G26800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1180 (420.4 bits), Expect = 6.7e-120, P = 6.7e-120
 Identities = 236/352 (67%), Positives = 270/352 (76%)

Query:     1 MSSLEEPLGLDKLPSMSTIDRIQRFSSNACRPSGDGMGMGSCWIEGSSCSTSNSYDEDYD 60
             MSSLEEPL  DKLPSMST+DRIQRFSS ACRP  D +GMG  WIEG  C+TSNS  +D  
Sbjct:    36 MSSLEEPLSFDKLPSMSTMDRIQRFSSGACRPRDD-VGMGHRWIEGRDCTTSNSCIDDDK 94

Query:    61 EYTREAFPWRRHTRDMSHGDSFSRRTVSLGRNHKMFGSACDI-------YNSNCNDKDIR 113
              + +E+FPWRRHTR +S G+   R     GR   + G+  +        Y++  N+    
Sbjct:    95 SFAKESFPWRRHTRKLSEGEHMFRNISFAGRTSTVSGTLRESKSFKEQKYSTFSNENGTS 154

Query:   114 DITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSP 173
              I+NK  KGIP+FVKIVEVGPRDGLQNEKN VPT VKVELI+RLVSSGLPVVEATSFVSP
Sbjct:   155 HISNKISKGIPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSP 214

Query:   174 KWVPQLADARDVMEAVRDLEGARLPVLTPNLXXXXXXXXXXXXXXXXXXSASEAFSKSNI 233
             KWVPQLADA+DVM+AV  L+GARLPVLTPNL                  SASE+FS SNI
Sbjct:   215 KWVPQLADAKDVMDAVNTLDGARLPVLTPNLKGFQAAVSAGAKEVAIFASASESFSLSNI 274

Query:   234 NCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFE 293
             NC+IE+SL+RYR VA AAK  S+PVRGYVSCVVGCPVEG + PSKVAYV KEL+DMGCFE
Sbjct:   275 NCTIEESLLRYRVVATAAKEHSVPVRGYVSCVVGCPVEGPVLPSKVAYVVKELYDMGCFE 334

Query:   294 ISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQV 345
             ISLGDTIG+GTPG+VVPMLEAVMAVVP +KLAVH HDTYGQ+L NIL+SLQ+
Sbjct:   335 ISLGDTIGIGTPGSVVPMLEAVMAVVPADKLAVHFHDTYGQALANILVSLQM 386
GO:0003824 "catalytic activity" evidence=IEA
GO:0004419 "hydroxymethylglutaryl-CoA lyase activity" evidence=ISS;IDA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006551 "leucine metabolic process" evidence=ISS
UNIPROTKB|E1BU09 HMGCLL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWD1 HMGCL "Hydroxymethylglutaryl-CoA lyase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1E7 HMGCL "Hydroxymethylglutaryl-CoA lyase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-958 hmgcl "3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (hydroxymethylglutaricaciduria)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2446108 Hmgcll1 "3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P35915 HMGCL "Hydroxymethylglutaryl-CoA lyase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TB92 HMGCLL1 "3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q29448 HMGCL "Hydroxymethylglutaryl-CoA lyase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283813 hmgL "hydroxymethylglutaryl-CoA lyase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81027HMGCL_ARATH4, ., 1, ., 3, ., 40.71300.95820.7350yesno
P38060HMGCL_MOUSE4, ., 1, ., 3, ., 40.60850.65450.7230yesno
Q29448HMGCL_BOVIN4, ., 1, ., 3, ., 40.62820.65180.72yesno
P35915HMGCL_CHICK4, ., 1, ., 3, ., 40.65760.61830.7449yesno
P97519HMGCL_RAT4, ., 1, ., 3, ., 40.61530.65180.72yesno
Q5R9E1HMGCL_PONAB4, ., 1, ., 3, ., 40.61270.65450.7230yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.3.40.946
3rd Layer4.1.30.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
PLN02746347 PLN02746, PLN02746, hydroxymethylglutaryl-CoA lyas 1e-173
cd07938274 cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl- 1e-128
PRK05692287 PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyas 1e-125
cd03174265 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyas 3e-75
COG0119 409 COG0119, LeuA, Isopropylmalate/homocitrate/citrama 2e-46
pfam00682236 pfam00682, HMGL-like, HMGL-like 7e-43
TIGR02660 365 TIGR02660, nifV_homocitr, homocitrate synthase Nif 5e-04
TIGR00973 494 TIGR00973, leuA_bact, 2-isopropylmalate synthase, 7e-04
PRK11858 378 PRK11858, aksA, trans-homoaconitate synthase; Revi 0.003
TIGR02090 363 TIGR02090, LEU1_arch, isopropylmalate/citramalate/ 0.003
>gnl|CDD|178347 PLN02746, PLN02746, hydroxymethylglutaryl-CoA lyase Back     alignment and domain information 
 Score =  484 bits (1248), Expect = e-173
 Identities = 206/264 (78%), Positives = 228/264 (86%)

Query: 81  SFSRRTVSLGRNHKMFGSACDIYNSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQN 140
           S    +   G     +      Y+S+ N+  +  + NK LKG+P+FVKIVEVGPRDGLQN
Sbjct: 1   SRGSTSTVSGTLGSSWSFKEHQYSSSSNEVGVAHMHNKLLKGLPKFVKIVEVGPRDGLQN 60

Query: 141 EKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVL 200
           EKN VPT VKVELI+RLVSSGLPVVEATSFVSPKWVPQLADA+DVM AVR+LEGAR PVL
Sbjct: 61  EKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWVPQLADAKDVMAAVRNLEGARFPVL 120

Query: 201 TPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRG 260
           TPNLKGFEAAIAAGAKEVA+FASASE+FSKSNINCSIE+SLVRYR VA AAK  SIPVRG
Sbjct: 121 TPNLKGFEAAIAAGAKEVAVFASASESFSKSNINCSIEESLVRYREVALAAKKHSIPVRG 180

Query: 261 YVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVP 320
           YVSCVVGCP+EG +PPSKVAYVAKEL+DMGC+EISLGDTIGVGTPGTVVPMLEAVMAVVP
Sbjct: 181 YVSCVVGCPIEGPVPPSKVAYVAKELYDMGCYEISLGDTIGVGTPGTVVPMLEAVMAVVP 240

Query: 321 VEKLAVHLHDTYGQSLPNILISLQ 344
           V+KLAVH HDTYGQ+L NIL+SLQ
Sbjct: 241 VDKLAVHFHDTYGQALANILVSLQ 264

Length = 347
>gnl|CDD|163676 cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>gnl|CDD|180206 PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>gnl|CDD|163674 cd03174, DRE_TIM_metallolyase, DRE-TIM metallolyase superfamily Back     alignment and domain information
>gnl|CDD|223197 COG0119, LeuA, Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|201390 pfam00682, HMGL-like, HMGL-like Back     alignment and domain information
>gnl|CDD|233965 TIGR02660, nifV_homocitr, homocitrate synthase NifV Back     alignment and domain information
>gnl|CDD|130046 TIGR00973, leuA_bact, 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>gnl|CDD|183341 PRK11858, aksA, trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|233719 TIGR02090, LEU1_arch, isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 359
PLN02746347 hydroxymethylglutaryl-CoA lyase 100.0
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 100.0
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 100.0
KOG2368316 consensus Hydroxymethylglutaryl-CoA lyase [Energy 100.0
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 100.0
PRK14847333 hypothetical protein; Provisional 100.0
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 100.0
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 100.0
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 100.0
TIGR00970 564 leuA_yeast 2-isopropylmalate synthase, yeast type. 100.0
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 100.0
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 100.0
PRK00915 513 2-isopropylmalate synthase; Validated 100.0
PLN03228 503 methylthioalkylmalate synthase; Provisional 100.0
cd07942284 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and 100.0
PRK03739 552 2-isopropylmalate synthase; Validated 100.0
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 100.0
PLN02321 632 2-isopropylmalate synthase 100.0
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 100.0
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 100.0
COG0119 409 LeuA Isopropylmalate/homocitrate/citramalate synth 100.0
PRK09389 488 (R)-citramalate synthase; Provisional 100.0
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 100.0
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 100.0
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 100.0
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 100.0
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 100.0
PF00682237 HMGL-like: HMGL-like of this family is not conserv 100.0
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 100.0
PRK08195 337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 100.0
TIGR03217 333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 100.0
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 100.0
KOG2367 560 consensus Alpha-isopropylmalate synthase/homocitra 100.0
PRK12331 448 oxaloacetate decarboxylase; Provisional 100.0
PRK14041 467 oxaloacetate decarboxylase; Provisional 100.0
PRK12330 499 oxaloacetate decarboxylase; Provisional 100.0
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 100.0
PRK09282 592 pyruvate carboxylase subunit B; Validated 100.0
PRK14040 593 oxaloacetate decarboxylase; Provisional 100.0
PRK12581 468 oxaloacetate decarboxylase; Provisional 100.0
TIGR02146 344 LysS_fung_arch homocitrate synthase. This model in 100.0
PRK12999 1146 pyruvate carboxylase; Reviewed 100.0
PRK14042 596 pyruvate carboxylase subunit B; Provisional 100.0
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 99.97
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 99.97
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 99.84
KOG0369 1176 consensus Pyruvate carboxylase [Energy production 99.76
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 98.37
PRK07094323 biotin synthase; Provisional 98.29
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 98.12
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 98.1
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 98.03
PLN02389379 biotin synthase 97.96
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 97.95
PLN02591250 tryptophan synthase 97.93
PRK06256336 biotin synthase; Validated 97.9
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 97.88
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 97.85
PRK07315293 fructose-bisphosphate aldolase; Provisional 97.78
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 97.78
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 97.77
PRK07084321 fructose-bisphosphate aldolase; Provisional 97.76
PRK06801286 hypothetical protein; Provisional 97.74
PRK07360371 FO synthase subunit 2; Reviewed 97.72
PRK08445348 hypothetical protein; Provisional 97.66
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 97.66
PRK08185283 hypothetical protein; Provisional 97.62
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.61
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 97.61
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 97.6
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 97.59
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 97.58
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 97.55
PRK08444353 hypothetical protein; Provisional 97.54
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 97.52
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 97.51
PRK08610286 fructose-bisphosphate aldolase; Reviewed 97.5
PRK15108345 biotin synthase; Provisional 97.49
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 97.49
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.48
PRK07709285 fructose-bisphosphate aldolase; Provisional 97.47
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.46
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.44
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 97.44
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 97.42
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 97.4
PRK05835307 fructose-bisphosphate aldolase; Provisional 97.38
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 97.37
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 97.34
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 97.34
PTZ00413398 lipoate synthase; Provisional 97.32
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 97.31
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 97.31
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 97.28
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 97.26
PRK12928290 lipoyl synthase; Provisional 97.22
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 97.21
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 97.21
PLN02428349 lipoic acid synthase 97.19
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 97.19
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 97.19
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 97.17
PRK09613 469 thiH thiamine biosynthesis protein ThiH; Reviewed 97.17
PRK05927350 hypothetical protein; Provisional 97.13
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 97.13
PRK09197350 fructose-bisphosphate aldolase; Provisional 97.09
PRK05301 378 pyrroloquinoline quinone biosynthesis protein PqqE 97.08
PRK06806281 fructose-bisphosphate aldolase; Provisional 97.05
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 97.04
PRK00507221 deoxyribose-phosphate aldolase; Provisional 97.03
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 97.01
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 96.96
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.96
TIGR02109 358 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. 96.95
TIGR00510302 lipA lipoate synthase. The family shows strong seq 96.95
TIGR01496257 DHPS dihydropteroate synthase. This model represen 96.9
PRK05926370 hypothetical protein; Provisional 96.9
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 96.89
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coen 96.87
PLN02951373 Molybderin biosynthesis protein CNX2 96.85
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 96.83
COG0191286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 96.82
PRK05481289 lipoyl synthase; Provisional 96.8
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.78
PRK09234843 fbiC FO synthase; Reviewed 96.78
COG0826 347 Collagenase and related proteases [Posttranslation 96.72
PRK08508279 biotin synthase; Provisional 96.72
PLN028581378 fructose-bisphosphate aldolase 96.71
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 96.66
PRK15452 443 putative protease; Provisional 96.62
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 96.55
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.55
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 96.52
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav 96.52
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 96.51
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 96.48
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM 96.43
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 96.42
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.4
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 96.37
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 96.37
TIGR00284 499 dihydropteroate synthase-related protein. This pro 96.37
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 96.35
PRK07226267 fructose-bisphosphate aldolase; Provisional 96.27
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 96.27
TIGR01210313 conserved hypothetical protein TIGR01210. This fam 96.25
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 96.24
PRK06245336 cofG FO synthase subunit 1; Reviewed 96.24
PRK06267350 hypothetical protein; Provisional 96.24
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 96.23
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 96.22
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 96.22
TIGR03586327 PseI pseudaminic acid synthase. 96.2
PRK08091228 ribulose-phosphate 3-epimerase; Validated 96.16
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 96.15
PRK08005210 epimerase; Validated 96.14
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 96.14
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 96.14
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 96.13
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 96.1
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 96.08
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 96.04
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 95.97
TIGR02668302 moaA_archaeal probable molybdenum cofactor biosynt 95.87
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM 95.85
TIGR00539 360 hemN_rel putative oxygen-independent coproporphyri 95.84
cd04740 296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 95.82
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 95.75
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 95.75
cd00423258 Pterin_binding Pterin binding enzymes. This family 95.74
PRK11613282 folP dihydropteroate synthase; Provisional 95.7
smart00518273 AP2Ec AP endonuclease family 2. These endonuclease 95.65
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 95.64
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 95.63
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 95.61
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 95.58
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 95.56
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 95.54
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 95.54
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM 95.5
TIGR00538 455 hemN oxygen-independent coproporphyrinogen III oxi 95.46
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 95.4
PRK13347 453 coproporphyrinogen III oxidase; Provisional 95.36
TIGR02146 344 LysS_fung_arch homocitrate synthase. This model in 95.32
PRK08227264 autoinducer 2 aldolase; Validated 95.29
PRK14057254 epimerase; Provisional 95.27
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of th 95.25
PRK09249 453 coproporphyrinogen III oxidase; Provisional 95.23
PRK07259 301 dihydroorotate dehydrogenase 1B; Reviewed 95.21
PRK08446 350 coproporphyrinogen III oxidase; Provisional 95.14
PLN03033290 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 95.12
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 95.11
PRK09250348 fructose-bisphosphate aldolase; Provisional 95.1
TIGR01211 522 ELP3 histone acetyltransferase, ELP3 family. The S 95.07
PRK05660 378 HemN family oxidoreductase; Provisional 95.07
TIGR01579414 MiaB-like-C MiaB-like tRNA modifying enzyme. This 94.99
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.94
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 94.87
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 94.86
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 94.85
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 94.79
PRK05628 375 coproporphyrinogen III oxidase; Validated 94.77
PRK09856275 fructoselysine 3-epimerase; Provisional 94.77
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 94.74
PRK13753279 dihydropteroate synthase; Provisional 94.73
PRK13523337 NADPH dehydrogenase NamA; Provisional 94.72
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 94.7
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 94.7
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 94.67
PRK06294 370 coproporphyrinogen III oxidase; Provisional 94.64
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 94.63
PRK07565 334 dihydroorotate dehydrogenase 2; Reviewed 94.62
TIGR01212302 radical SAM protein, TIGR01212 family. This unchar 94.6
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 94.57
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 94.53
PRK08599 377 coproporphyrinogen III oxidase; Provisional 94.51
PRK13210284 putative L-xylulose 5-phosphate 3-epimerase; Revie 94.5
TIGR00587274 nfo apurinic endonuclease (APN1). All proteins in 94.44
PRK06852304 aldolase; Validated 94.44
PRK14338459 (dimethylallyl)adenosine tRNA methylthiotransferas 94.43
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 94.42
COG1856275 Uncharacterized homolog of biotin synthetase [Func 94.41
TIGR03822321 AblA_like_2 lysine-2,3-aminomutase-related protein 94.38
cd04739 325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 94.37
PRK05904 353 coproporphyrinogen III oxidase; Provisional 94.37
PF04055166 Radical_SAM: Radical SAM superfamily; InterPro: IP 94.36
PRK09989258 hypothetical protein; Provisional 94.27
PRK05799 374 coproporphyrinogen III oxidase; Provisional 94.26
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 94.25
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 94.23
cd01320 325 ADA Adenosine deaminase (ADA) is a monomeric zinc 94.2
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 94.1
PLN02334229 ribulose-phosphate 3-epimerase 94.05
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 94.03
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 93.98
PF00701 289 DHDPS: Dihydrodipicolinate synthetase family; Inte 93.97
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 93.95
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 93.93
TIGR00089429 RNA modification enzyme, MiaB family. This subfami 93.92
PRK14332449 (dimethylallyl)adenosine tRNA methylthiotransferas 93.91
COG0535347 Predicted Fe-S oxidoreductases [General function p 93.91
PRK14334440 (dimethylallyl)adenosine tRNA methylthiotransferas 93.87
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 93.8
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 93.78
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 93.77
PRK14325444 (dimethylallyl)adenosine tRNA methylthiotransferas 93.75
PRK07379 400 coproporphyrinogen III oxidase; Provisional 93.73
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 93.64
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 93.64
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 93.61
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 93.55
TIGR01290 442 nifB nitrogenase cofactor biosynthesis protein Nif 93.46
PRK08207488 coproporphyrinogen III oxidase; Provisional 93.43
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 93.35
PRK05283257 deoxyribose-phosphate aldolase; Provisional 93.33
PRK01060281 endonuclease IV; Provisional 93.26
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 93.25
TIGR01496 257 DHPS dihydropteroate synthase. This model represen 93.25
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 93.25
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 93.22
COG2100414 Predicted Fe-S oxidoreductase [General function pr 93.21
PRK12677 384 xylose isomerase; Provisional 93.2
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related 93.18
cd00954 288 NAL N-Acetylneuraminic acid aldolase, also called 93.18
PRK14340445 (dimethylallyl)adenosine tRNA methylthiotransferas 93.16
PRK08208 430 coproporphyrinogen III oxidase; Validated 93.04
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 92.96
PRK10605362 N-ethylmaleimide reductase; Provisional 92.94
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 92.92
COG2089 347 SpsE Sialic acid synthase [Cell envelope biogenesi 92.9
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 92.88
PRK05718 212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.87
cd00952 309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 92.86
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 92.83
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 92.82
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 92.81
PRK13745 412 anaerobic sulfatase-maturase; Provisional 92.78
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 92.78
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 92.72
PRK14327509 (dimethylallyl)adenosine tRNA methylthiotransferas 92.71
TIGR03551 343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 92.7
PRK10481224 hypothetical protein; Provisional 92.69
TIGR03821321 AblA_like_1 lysine-2,3-aminomutase-related protein 92.68
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 92.67
PRK14024241 phosphoribosyl isomerase A; Provisional 92.64
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 92.59
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 92.59
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 92.58
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 92.55
TIGR02631 382 xylA_Arthro xylose isomerase, Arthrobacter type. T 92.49
TIGR01125430 MiaB-like tRNA modifying enzyme YliG, TIGR01125. T 92.46
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 92.45
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 92.44
cd00950 284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 92.37
PRK14331437 (dimethylallyl)adenosine tRNA methylthiotransferas 92.36
PRK09206470 pyruvate kinase; Provisional 92.35
COG0821 361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 92.35
PRK14335455 (dimethylallyl)adenosine tRNA methylthiotransferas 92.32
cd00952 309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 92.3
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 92.28
PRK08508 279 biotin synthase; Provisional 92.25
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 92.25
COG1242312 Predicted Fe-S oxidoreductase [General function pr 92.24
PRK14330434 (dimethylallyl)adenosine tRNA methylthiotransferas 92.14
TIGR01859 282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 92.13
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 92.02
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 92.0
cd00951 289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 91.99
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 91.98
cd01321 345 ADGF Adenosine deaminase-related growth factors (A 91.95
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 91.92
PRK14336418 (dimethylallyl)adenosine tRNA methylthiotransferas 91.92
PRK03170 292 dihydrodipicolinate synthase; Provisional 91.86
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 91.81
PRK09358 340 adenosine deaminase; Provisional 91.77
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 91.72
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 91.6
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 91.46
PTZ00300454 pyruvate kinase; Provisional 91.45
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 91.4
TIGR01334277 modD putative molybdenum utilization protein ModD. 91.36
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 91.36
TIGR03151 307 enACPred_II putative enoyl-(acyl-carrier-protein) 91.35
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 91.33
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 91.32
PTZ00170 228 D-ribulose-5-phosphate 3-epimerase; Provisional 91.32
PLN02925 733 4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha 91.31
PRK03170 292 dihydrodipicolinate synthase; Provisional 91.28
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 91.24
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 91.23
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 91.23
PRK04165 450 acetyl-CoA decarbonylase/synthase complex subunit 91.21
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 91.15
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 91.05
TIGR01574438 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3 91.03
PRK14328439 (dimethylallyl)adenosine tRNA methylthiotransferas 90.98
PRK09058 449 coproporphyrinogen III oxidase; Provisional 90.95
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 90.95
PRK13758 370 anaerobic sulfatase-maturase; Provisional 90.88
TIGR01037 300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 90.87
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 90.75
PRK09234 843 fbiC FO synthase; Reviewed 90.73
KOG0256 471 consensus 1-aminocyclopropane-1-carboxylate syntha 90.69
TIGR03700 351 mena_SCO4494 putative menaquinone biosynthesis pro 90.68
PRK14337446 (dimethylallyl)adenosine tRNA methylthiotransferas 90.6
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 90.6
PRK14339420 (dimethylallyl)adenosine tRNA methylthiotransferas 90.53
PRK14326502 (dimethylallyl)adenosine tRNA methylthiotransferas 90.52
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 90.51
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 90.48
PRK09057 380 coproporphyrinogen III oxidase; Provisional 90.48
PLN02623 581 pyruvate kinase 90.44
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 90.43
COG1082274 IolE Sugar phosphate isomerases/epimerases [Carboh 90.41
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 90.36
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 90.35
TIGR00683 290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 90.31
TIGR03249 296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 90.23
PRK08898 394 coproporphyrinogen III oxidase; Provisional 90.21
cd00950 284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 90.14
TIGR00674 285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 90.11
PRK07360 371 FO synthase subunit 2; Reviewed 90.11
TIGR02319 294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 90.11
PRK06354 590 pyruvate kinase; Provisional 90.07
PRK09997258 hydroxypyruvate isomerase; Provisional 90.06
TIGR00683 290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 90.06
PF00809210 Pterin_bind: Pterin binding enzyme This Prosite en 89.98
PRK09196 347 fructose-1,6-bisphosphate aldolase; Reviewed 89.96
cd04727 283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 89.93
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 89.92
PRK12737 284 gatY tagatose-bisphosphate aldolase; Reviewed 89.92
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 89.91
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 89.88
TIGR01430 324 aden_deam adenosine deaminase. This family include 89.87
PRK05581220 ribulose-phosphate 3-epimerase; Validated 89.78
PTZ00066513 pyruvate kinase; Provisional 89.75
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 89.69
TIGR00612 346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 89.67
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 89.64
PRK03620 303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 89.62
PRK02048 611 4-hydroxy-3-methylbut-2-en-1-yl diphosphate syntha 89.6
TIGR00674 285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 89.51
PRK12738 286 kbaY tagatose-bisphosphate aldolase; Reviewed 89.47
PTZ00372413 endonuclease 4-like protein; Provisional 89.44
PF01702238 TGT: Queuine tRNA-ribosyltransferase; InterPro: IP 89.43
PRK04147 293 N-acetylneuraminate lyase; Provisional 89.39
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 89.39
COG0854243 PdxJ Pyridoxal phosphate biosynthesis protein [Coe 89.38
PRK06582 390 coproporphyrinogen III oxidase; Provisional 89.35
TIGR01521 347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 89.33
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 89.33
PLN02417 280 dihydrodipicolinate synthase 89.3
PRK08185 283 hypothetical protein; Provisional 89.24
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 89.17
PRK14329467 (dimethylallyl)adenosine tRNA methylthiotransferas 89.14
PF04551 359 GcpE: GcpE protein; InterPro: IPR004588 This prote 89.14
PRK04147 293 N-acetylneuraminate lyase; Provisional 89.09
TIGR01858 282 tag_bisphos_ald class II aldolase, tagatose bispho 89.06
COG0635 416 HemN Coproporphyrinogen III oxidase and related Fe 89.03
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 89.03
PRK05835 307 fructose-bisphosphate aldolase; Provisional 89.02
PRK06096284 molybdenum transport protein ModD; Provisional 88.98
PRK05826465 pyruvate kinase; Provisional 88.94
PRK09195 284 gatY tagatose-bisphosphate aldolase; Reviewed 88.9
TIGR02313 294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 88.87
TIGR01431 479 adm_rel adenosine deaminase-related growth factor. 88.86
cd00288 480 Pyruvate_Kinase Pyruvate kinase (PK): Large allost 88.8
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 88.76
TIGR03581236 EF_0839 conserved hypothetical protein EF_0839/AHA 88.76
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 88.75
PRK06801 286 hypothetical protein; Provisional 88.73
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 88.73
TIGR00167 288 cbbA ketose-bisphosphate aldolases. fructose-bisph 88.72
cd00951 289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 88.67
PRK14333448 (dimethylallyl)adenosine tRNA methylthiotransferas 88.63
PRK00115346 hemE uroporphyrinogen decarboxylase; Validated 88.6
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 88.6
PRK08444 353 hypothetical protein; Provisional 88.53
TIGR01064473 pyruv_kin pyruvate kinase. This enzyme is a homote 88.53
PRK04180 293 pyridoxal biosynthesis lyase PdxS; Provisional 88.5
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 88.46
PRK12290 437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 88.4
PLN02433345 uroporphyrinogen decarboxylase 88.38
PRK13210 284 putative L-xylulose 5-phosphate 3-epimerase; Revie 88.31
cd00945 201 Aldolase_Class_I Class I aldolases. The class I al 88.13
PLN02826409 dihydroorotate dehydrogenase 88.12
TIGR03249 296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 88.12
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 88.1
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 88.07
cd00452 190 KDPG_aldolase KDPG and KHG aldolase. This family b 88.06
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 88.03
PRK07094 323 biotin synthase; Provisional 87.98
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 87.97
PRK03620 303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 87.89
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 87.87
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 87.86
cd01299 342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 87.82
PRK13399 347 fructose-1,6-bisphosphate aldolase; Provisional 87.77
cd00954 288 NAL N-Acetylneuraminic acid aldolase, also called 87.73
PF07555 306 NAGidase: beta-N-acetylglucosaminidase ; InterPro: 87.7
PRK09240 371 thiH thiamine biosynthesis protein ThiH; Reviewed 87.68
PLN02495 385 oxidoreductase, acting on the CH-CH group of donor 87.66
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 87.6
COG0469477 PykF Pyruvate kinase [Carbohydrate transport and m 87.41
cd00947 276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 87.39
PRK07709 285 fructose-bisphosphate aldolase; Provisional 87.32
PRK06252339 methylcobalamin:coenzyme M methyltransferase; Vali 87.3
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 87.2
PRK06247 476 pyruvate kinase; Provisional 87.19
TIGR00542279 hxl6Piso_put hexulose-6-phosphate isomerase, putat 87.11
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 87.09
PRK12857 284 fructose-1,6-bisphosphate aldolase; Reviewed 87.07
COG0191 286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 87.01
TIGR00433 296 bioB biotin synthetase. Catalyzes the last step of 87.01
PRK14041 467 oxaloacetate decarboxylase; Provisional 86.83
cd00740252 MeTr MeTr subgroup of pterin binding enzymes. This 86.83
PRK08610 286 fructose-bisphosphate aldolase; Reviewed 86.82
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 86.79
PRK01060281 endonuclease IV; Provisional 86.72
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 86.68
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 86.68
PLN02461 511 Probable pyruvate kinase 86.65
PRK10550 312 tRNA-dihydrouridine synthase C; Provisional 86.6
PRK00112366 tgt queuine tRNA-ribosyltransferase; Provisional 86.58
TIGR01578420 MiaB-like-B MiaB-like tRNA modifying enzyme, archa 86.54
PLN02417280 dihydrodipicolinate synthase 86.43
PRK02227238 hypothetical protein; Provisional 86.3
cd00953 279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 86.18
cd03307326 Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, al 86.17
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 86.15
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 86.12
PRK13753 279 dihydropteroate synthase; Provisional 86.11
COG0329 299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 85.96
PRK06806 281 fructose-bisphosphate aldolase; Provisional 85.93
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 85.86
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 85.81
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 85.79
cd06810 368 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phos 85.67
PRK05927 350 hypothetical protein; Provisional 85.67
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 85.62
PRK08091228 ribulose-phosphate 3-epimerase; Validated 85.58
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 85.53
PRK09997258 hydroxypyruvate isomerase; Provisional 85.42
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 85.24
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 85.14
TIGR00737 319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 85.09
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 85.07
PRK11613 282 folP dihydropteroate synthase; Provisional 85.06
PRK00115346 hemE uroporphyrinogen decarboxylase; Validated 84.96
TIGR01464338 hemE uroporphyrinogen decarboxylase. This model re 84.94
smart00518273 AP2Ec AP endonuclease family 2. These endonuclease 84.89
PRK07998 283 gatY putative fructose-1,6-bisphosphate aldolase; 84.88
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 84.7
PTZ00124 362 adenosine deaminase; Provisional 84.66
PRK02506 310 dihydroorotate dehydrogenase 1A; Reviewed 84.6
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 84.57
PF00224348 PK: Pyruvate kinase, barrel domain; InterPro: IPR0 84.39
TIGR03699 340 mena_SCO4550 menaquinone biosynthesis protein, SCO 84.37
COG0042 323 tRNA-dihydrouridine synthase [Translation, ribosom 84.28
cd01714202 ETF_beta The electron transfer flavoprotein (ETF) 84.17
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information 
Probab=100.00  E-value=4.5e-60  Score=465.60  Aligned_cols=252  Identities=81%  Similarity=1.218  Sum_probs=242.1

Q ss_pred             ccccCccchhhhhhhhhcCCCCccEEEeCCCcccCCCCCCCCCHHHHHHHHHHHHhCCCCEEEEeccCCCCCcCCCCCHH
Q 018252          104 NSNCNDKDIRDITNKFLKGIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADAR  183 (359)
Q Consensus       104 ~~~~~~~~~~~~~~~~~~~~p~~V~I~D~TLRDG~Q~~~~~~~~~~k~~ia~~L~~aGv~~IEvG~fvspk~vPq~~D~~  183 (359)
                      ++..+....+.+++++..+||++|+|+|||||||+|+++..|++++|++|++.|+++||+.||+|+|++||++|||+|.+
T Consensus        24 ~~~~~~~~~~~~~~~~~~~m~~~V~I~DtTlRDG~Q~~g~~~s~e~Ki~ia~~L~~~GV~~IEvGs~vspk~vPqmad~~  103 (347)
T PLN02746         24 SSSSNEVGVAHMHNKLLKGLPKFVKIVEVGPRDGLQNEKNIVPTSVKVELIQRLVSSGLPVVEATSFVSPKWVPQLADAK  103 (347)
T ss_pred             ccccccccccccccchhhcCCCceEEEECCCCccCcCCCCCCCHHHHHHHHHHHHHcCCCEEEECCCcCcccccccccHH
Confidence            34444556789999999899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhcCCCeEEEEeCChHhHHHHHHcCCCEEEEecCCchHHHHhhhcCCHHHHHHHHHHHHHHHHhCCCcEEEEEe
Q 018252          184 DVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVS  263 (359)
Q Consensus       184 ev~~~l~~~~~~~l~~l~~n~~gie~a~~aGv~~V~i~~s~S~~~~~~n~~~t~~e~l~~i~~~i~~Ak~~G~~V~~~is  263 (359)
                      ++++.++..+++++.++++|.+|+++|+++|++.|++++|+|+.|.+.|+|+|++|+++++.+++++||++|++|+++|+
T Consensus       104 ev~~~i~~~~~~~~~~l~~n~~die~A~~~g~~~v~i~~s~Sd~h~~~n~~~t~~e~l~~~~~~v~~Ak~~Gl~v~~~is  183 (347)
T PLN02746        104 DVMAAVRNLEGARFPVLTPNLKGFEAAIAAGAKEVAVFASASESFSKSNINCSIEESLVRYREVALAAKKHSIPVRGYVS  183 (347)
T ss_pred             HHHHHHHhccCCceeEEcCCHHHHHHHHHcCcCEEEEEEecCHHHHHHHhCCCHHHHHHHHHHHHHHHHHcCCeEEEEEE
Confidence            99999988788899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCCCCCCHHHHHHHHHHHHHCCcCEEEEcCCCCCCcHHHHHHHHHHHHHhCCCceEEEEeCCCCCcHHHHHHHHH
Q 018252          264 CVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISL  343 (359)
Q Consensus       264 ~~fg~~~~~r~~~e~l~~~a~~l~~~Gad~I~L~DT~G~~~P~~v~~lv~~l~~~~p~~~L~~H~HNd~GLAlANalaAv  343 (359)
                      ++|+||++++++++++.++++++.++|+++|+|+||+|+++|.+++++++.+++.+|..+|++|+|||+|||+||+++|+
T Consensus       184 ~~fg~p~~~r~~~~~l~~~~~~~~~~Gad~I~l~DT~G~a~P~~v~~lv~~l~~~~~~~~i~~H~Hnd~GlA~AN~lAA~  263 (347)
T PLN02746        184 CVVGCPIEGPVPPSKVAYVAKELYDMGCYEISLGDTIGVGTPGTVVPMLEAVMAVVPVDKLAVHFHDTYGQALANILVSL  263 (347)
T ss_pred             eeecCCccCCCCHHHHHHHHHHHHHcCCCEEEecCCcCCcCHHHHHHHHHHHHHhCCCCeEEEEECCCCChHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999877899999999999999999999


Q ss_pred             HcCCCEEeceee
Q 018252          344 QVSPMHAKPCFT  355 (359)
Q Consensus       344 ~AGa~~ID~tl~  355 (359)
                      ++||++||+|+.
T Consensus       264 ~aGa~~vd~sv~  275 (347)
T PLN02746        264 QMGISTVDSSVA  275 (347)
T ss_pred             HhCCCEEEEecc
Confidence            999999999986

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>KOG2368 consensus Hydroxymethylglutaryl-CoA lyase [Energy production and conversion; Amino acid transport and metabolism] Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK14847 hypothetical protein; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00970 leuA_yeast 2-isopropylmalate synthase, yeast type Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK03739 2-isopropylmalate synthase; Validated Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>KOG2367 consensus Alpha-isopropylmalate synthase/homocitrate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02146 LysS_fung_arch homocitrate synthase Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PLN02951 Molybderin biosynthesis protein CNX2 Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR01210 conserved hypothetical protein TIGR01210 Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd00423 Pterin_binding Pterin binding enzymes Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02146 LysS_fung_arch homocitrate synthase Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01212 radical SAM protein, TIGR01212 family Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>TIGR00587 nfo apurinic endonuclease (APN1) Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation Back     alignment and domain information
>PRK09989 hypothetical protein; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>TIGR00089 RNA modification enzyme, MiaB family Back     alignment and domain information
>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12677 xylose isomerase; Provisional Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>TIGR02631 xylA_Arthro xylose isomerase, Arthrobacter type Back     alignment and domain information
>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125 Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK09206 pyruvate kinase; Provisional Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK09358 adenosine deaminase; Provisional Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PTZ00300 pyruvate kinase; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PLN02925 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB Back     alignment and domain information
>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK06354 pyruvate kinase; Provisional Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PF00809 Pterin_bind: Pterin binding enzyme This Prosite entry is a subset of the Pfam family; InterPro: IPR000489 The ~250-residue pterin-binding domain has been shown to adopt a (beta/alpha)8 barrel fold, which has the overall shape of a distorted cylinder Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PTZ00066 pyruvate kinase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PTZ00372 endonuclease 4-like protein; Provisional Back     alignment and domain information
>PF01702 TGT: Queuine tRNA-ribosyltransferase; InterPro: IPR002616 This is a family of queuine, archaeosine and general tRNA-ribosyltransferases 2 Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK05826 pyruvate kinase; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>TIGR01431 adm_rel adenosine deaminase-related growth factor Back     alignment and domain information
>cd00288 Pyruvate_Kinase Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR03581 EF_0839 conserved hypothetical protein EF_0839/AHA_3917 Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK00115 hemE uroporphyrinogen decarboxylase; Validated Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PLN02433 uroporphyrinogen decarboxylase Back     alignment and domain information
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PF07555 NAGidase: beta-N-acetylglucosaminidase ; InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>COG0469 PykF Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06252 methylcobalamin:coenzyme M methyltransferase; Validated Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06247 pyruvate kinase; Provisional Back     alignment and domain information
>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd00740 MeTr MeTr subgroup of pterin binding enzymes Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PLN02461 Probable pyruvate kinase Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>cd03307 Mta_CmuA_like MtaA_CmuA_like family Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd06810 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PRK00115 hemE uroporphyrinogen decarboxylase; Validated Back     alignment and domain information
>TIGR01464 hemE uroporphyrinogen decarboxylase Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PF00224 PK: Pyruvate kinase, barrel domain; InterPro: IPR015793 Pyruvate kinase (2 Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
2cw6_A298 Crystal Structure Of Human Hmg-Coa Lyase: Insights 3e-69
3mp4_A298 Crystal Structure Of Human Lyase R41m Mutant Length 1e-68
2ftp_A302 Crystal Structure Of Hydroxymethylglutaryl-Coa Lyas 7e-60
1ydn_A295 Crystal Structure Of The Hmg-Coa Lyase From Brucell 2e-55
1ydo_A307 Crystal Structure Of The Bacillis Subtilis Hmg-Coa 7e-40
>pdb|2CW6|A Chain A, Crystal Structure Of Human Hmg-Coa Lyase: Insights Into Catalysis And The Molecular Basis For Hydroxymethylglutaric Aciduria Length = 298 Back     alignment and structure 
Iteration: 1

 Score =  258 bits (660), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 126/223 (56%), Positives = 156/223 (69%)
Query: 123 IPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADA 182
           +P+ VKIVEVGPRDGLQNEKN V T VK++LI  L  +GL V+E TSFVSPKWVPQ+ D 
Sbjct: 2   LPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDH 61
Query: 183 RDVMEAVRDLEGARLPVLTPNLXXXXXXXXXXXXXXXXXXSASEAFSKSNINCSIEDSLV 242
            +V++ ++   G   PVLTPNL                  +ASE F+K NINCSIE+S  
Sbjct: 62  TEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQ 121
Query: 243 RYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGV 302
           R+ A+  AA+  +I VRGYVSC +GCP EG I P+KVA V K+ + MGC+EISLGDTIGV
Sbjct: 122 RFDAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEISLGDTIGV 181
Query: 303 GTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQV 345
           GTPG +  ML AVM  VP+  LAVH HDTYGQ+L N L++LQ+
Sbjct: 182 GTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQM 224
>pdb|3MP4|A Chain A, Crystal Structure Of Human Lyase R41m Mutant Length = 298 Back     alignment and structure
>pdb|2FTP|A Chain A, Crystal Structure Of Hydroxymethylglutaryl-Coa Lyase From Pseudomonas Aeruginosa Length = 302 Back     alignment and structure
>pdb|1YDN|A Chain A, Crystal Structure Of The Hmg-Coa Lyase From Brucella Melitensis, Northeast Structural Genomics Target Lr35. Length = 295 Back     alignment and structure
>pdb|1YDO|A Chain A, Crystal Structure Of The Bacillis Subtilis Hmg-Coa Lyase, Northeast Structural Genomics Target Sr181. Length = 307 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 1e-135
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 1e-134
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 1e-134
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 1e-134
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 4e-05
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 9e-04
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Length = 298 Back     alignment and structure
 Score =  386 bits (994), Expect = e-135
 Identities = 141/222 (63%), Positives = 171/222 (77%)

Query: 123 IPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADA 182
           +P+ VKIVEVGPRDGLQNEKN V T VK++LI  L  +GL V+E TSFVSPKWVPQ+ D 
Sbjct: 2   LPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDH 61

Query: 183 RDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLV 242
            +V++ ++   G   PVLTPNLKGFEAA+AAGAKEV IF +ASE F+K NINCSIE+S  
Sbjct: 62  TEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQ 121

Query: 243 RYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAYVAKELHDMGCFEISLGDTIGV 302
           R+ A+  AA+  +I VRGYVSC +GCP EG I P+KVA V K+ + MGC+EISLGDTIGV
Sbjct: 122 RFDAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEISLGDTIGV 181

Query: 303 GTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQ 344
           GTPG +  ML AVM  VP+  LAVH HDTYGQ+L N L++LQ
Sbjct: 182 GTPGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQ 223
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Length = 307 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Length = 295 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Length = 302 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Length = 345 Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 100.0
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 100.0
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 100.0
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 100.0
3rmj_A 370 2-isopropylmalate synthase; LEUA, truncation, neis 100.0
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 100.0
3ble_A337 Citramalate synthase from leptospira interrogans; 100.0
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 100.0
3hq1_A 644 2-isopropylmalate synthase; LEUA, mycobacterium tu 100.0
3ivs_A 423 Homocitrate synthase, mitochondrial; TIM barrel, m 100.0
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 100.0
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 100.0
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 100.0
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 100.0
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 100.0
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 100.0
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 100.0
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 100.0
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.77
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 98.52
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.32
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.28
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 98.27
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.12
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.98
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 97.89
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 97.68
3tha_A252 Tryptophan synthase alpha chain; structural genomi 97.56
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.43
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 97.42
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 97.4
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 97.39
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 97.36
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 97.25
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 97.21
2dqw_A294 Dihydropteroate synthase; dimer, structural genomi 97.08
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 97.06
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 97.05
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 97.04
3txv_A 450 Probable tagatose 6-phosphate kinase; structural g 97.04
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 97.03
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 97.02
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 97.01
3oa3_A288 Aldolase; structural genomics, seattle structural 96.97
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 96.93
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 96.9
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 96.88
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 96.81
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 96.78
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 96.78
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 96.76
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 96.76
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 96.73
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 96.72
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 96.71
2wqp_A 349 Polysialic acid capsule biosynthesis protein SIAC; 96.7
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 96.6
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 96.57
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 96.55
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 96.52
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 96.49
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 96.45
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 96.35
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.32
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 96.2
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.14
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 96.14
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 96.12
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 96.09
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 96.09
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 95.97
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 95.93
2qgq_A304 Protein TM_1862; alpha-beta protein, structural ge 95.82
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 95.77
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 95.77
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 95.77
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 95.75
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 95.69
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 95.68
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 95.68
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 95.58
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 95.54
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 95.54
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 95.5
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 95.45
1dos_A358 Aldolase class II; lyase, classii fructose 1,6-bis 95.42
3g8r_A 350 Probable spore coat polysaccharide biosynthesis P; 95.38
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 95.35
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 95.28
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 95.25
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 95.24
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 95.22
1olt_A 457 Oxygen-independent coproporphyrinogen III oxidase; 95.21
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 95.18
3elf_A349 Fructose-bisphosphate aldolase; zinc enzyme, dihyd 95.16
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 95.12
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.03
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 95.02
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 95.01
3qm3_A357 Fructose-bisphosphate aldolase; structural genomic 94.99
2q02_A272 Putative cytoplasmic protein; structural genomics, 94.98
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 94.95
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 94.93
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 94.93
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 94.91
3ih1_A 305 Methylisocitrate lyase; alpha-beta structure, TIM- 94.82
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 94.79
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 94.61
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 94.6
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 94.51
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 94.51
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 94.5
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 94.5
3aam_A270 Endonuclease IV, endoiv; DNA repair, base excision 94.5
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 94.41
1ep3_A 311 Dihydroorotate dehydrogenase B (PYRD subunit); het 94.3
3aal_A303 Probable endonuclease 4; endoiv, DNA repair, base 94.25
3rys_A 343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 94.18
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 94.18
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 94.13
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 94.02
3ngf_A269 AP endonuclease, family 2; structural genomics, se 93.91
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 93.8
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 93.8
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 93.8
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 93.54
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 93.47
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 93.45
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 93.31
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 93.25
1ujp_A271 Tryptophan synthase alpha chain; riken structural 93.06
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 93.01
1k77_A260 EC1530, hypothetical protein YGBM; TIM barrel, str 92.93
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 92.9
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 92.73
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 92.7
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 92.68
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 92.63
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 92.57
3qxb_A316 Putative xylose isomerase; structural genomics, jo 92.53
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 92.5
2pgf_A 371 Adenosine deaminase; metallo-dependent hydrolase, 92.49
3fa4_A 302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 92.48
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 92.47
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 92.47
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 92.43
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 92.43
3pao_A326 Adenosine deaminase; structural genomics, PSI-2, p 92.38
3eoo_A 298 Methylisocitrate lyase; seattle structural genomic 92.33
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 92.3
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 92.24
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 92.21
3lgd_A 508 Adenosine deaminase CECR1; TIM barrel, dimerizatio 92.21
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 92.16
3kws_A287 Putative sugar isomerase; structural genomics, joi 92.1
3iar_A 367 Adenosine deaminase; purine metabolism structural 92.08
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 92.07
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 91.99
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 91.95
3m5v_A 301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 91.94
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 91.88
2x7v_A287 Probable endonuclease 4; DNA repair protein, metal 91.86
2vp8_A 318 Dihydropteroate synthase 2; RV1207 transferase, fo 91.85
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 91.81
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 91.68
1m5w_A243 Pyridoxal phosphate biosynthetic protein PDXJ; TIM 91.59
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 91.49
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 91.47
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 91.47
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 91.37
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 91.37
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 91.35
3nav_A 271 Tryptophan synthase alpha chain; alpha subunit, st 91.3
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 91.29
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 91.26
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 91.21
3gg8_A 511 Pyruvate kinase; malaria, genomics, proteomics, gl 91.19
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 91.1
3lye_A 307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 91.07
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 91.05
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 90.99
1aj0_A 282 DHPS, dihydropteroate synthase; antibiotic, resist 90.98
1zlp_A 318 PSR132, petal death protein; TIM-barrel, helix swa 90.97
1rd5_A 262 Tryptophan synthase alpha chain, chloroplast; hydr 90.96
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 90.83
1xg4_A 295 Probable methylisocitrate lyase; 2-methylisocitrat 90.83
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 90.8
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 90.78
4gxw_A 380 Adenosine deaminase; amidohydrolase, COG1816, EFI, 90.77
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 90.77
3qtg_A461 Pyruvate kinase, PK; TIM barrel, glycolysis, trans 90.66
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 90.66
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 90.62
3hqn_D 499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 90.6
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 90.57
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 90.54
3khd_A 520 Pyruvate kinase; malaria, structural genomics, str 90.49
1ypf_A 336 GMP reductase; GUAC, purines, pyrimidines, nucleos 90.46
1eye_A 280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 90.44
3oa3_A288 Aldolase; structural genomics, seattle structural 90.41
3o6c_A260 PNP synthase, pyridoxine 5'-phosphate synthase; st 90.38
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 90.38
2ehh_A 294 DHDPS, dihydrodipicolinate synthase; structural ge 90.36
3m5v_A 301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 90.36
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 90.31
2fiq_A 420 Putative tagatose 6-phosphate kinase 1; structural 90.28
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 90.24
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 90.24
1tx2_A 297 DHPS, dihydropteroate synthase; folate biosynthesi 90.14
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 90.1
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 90.04
3s5o_A 307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 89.87
3qc0_A275 Sugar isomerase; TIM barrel, structural genomics, 89.86
2yxg_A 289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 89.84
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysi 89.81
2r91_A 286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 89.76
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 89.58
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 89.53
3mcm_A442 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine 89.46
4dpp_A 360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 89.41
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 89.39
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 89.37
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 89.36
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 89.22
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 89.22
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 89.13
2nuw_A 288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 89.09
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 89.04
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 89.03
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 88.99
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 88.97
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 88.94
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 88.91
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 88.89
3vnd_A 267 TSA, tryptophan synthase alpha chain; psychrophili 88.88
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 88.87
2r91_A 286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 88.84
3dx5_A286 Uncharacterized protein ASBF; beta-alpha barrel, p 88.84
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 88.83
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 88.82
3daq_A 292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 88.8
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 88.77
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 88.76
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 88.71
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 88.7
1w3i_A 293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 88.61
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 88.56
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 88.46
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 88.44
2xsa_A 447 Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, 88.42
1viz_A240 PCRB protein homolog; structural genomics, unknown 88.39
2vc6_A 292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 88.35
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 88.27
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 88.27
3dx5_A 286 Uncharacterized protein ASBF; beta-alpha barrel, p 88.27
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 88.26
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 88.21
3ayv_A254 Putative uncharacterized protein TTHB071; structur 88.19
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 88.17
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 88.14
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 88.1
3gr4_A 550 Pyruvate kinase isozymes M1/M2; activator, acetyla 88.03
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 88.02
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 87.98
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 87.98
3l23_A 303 Sugar phosphate isomerase/epimerase; structural ge 87.96
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 87.91
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 87.9
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 87.87
1jub_A 311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 87.83
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 87.81
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 87.77
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 87.74
3a5f_A 291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 87.69
2hsa_B 402 12-oxophytodienoate reductase 3; alpha beta 8 barr 87.67
3daq_A 292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 87.64
3h5d_A 311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 87.61
1u83_A276 Phosphosulfolactate synthase; structural genomics, 87.6
2qul_A290 D-tagatose 3-epimerase; beta/alpha barrel, isomera 87.59
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 87.59
2ehh_A 294 DHDPS, dihydrodipicolinate synthase; structural ge 87.57
2nuw_A 288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 87.52
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 87.47
3s5o_A 307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 87.44
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 87.41
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 87.35
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 87.34
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 87.34
2qul_A290 D-tagatose 3-epimerase; beta/alpha barrel, isomera 87.31
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 87.3
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 87.26
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 87.26
3n2b_A 441 Diaminopimelate decarboxylase; LYSA, lyase, struct 87.21
1w3i_A 293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 87.18
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 87.17
3a5f_A 291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 87.14
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 87.02
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 86.98
3eb2_A 300 Putative dihydrodipicolinate synthetase; lysine bi 86.95
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 86.88
2yxg_A 289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 86.81
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 86.8
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 86.8
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 86.78
2c6q_A 351 GMP reductase 2; TIM barrel, metal-binding, NADP, 86.78
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40 86.75
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 86.74
4ay7_A348 Methylcobalamin\: coenzyme M methyltransferase; TI 86.72
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 86.69
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 86.6
4e38_A 232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 86.54
1qop_A 268 Tryptophan synthase alpha chain; lyase, carbon-oxy 86.53
2eja_A338 URO-D, UPD, uroporphyrinogen decarboxylase; dimer, 86.47
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 86.45
1mxs_A 225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 86.42
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 86.4
3u0h_A281 Xylose isomerase domain protein; structural genomi 86.38
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 86.35
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 86.28
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 86.26
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 86.2
3gnh_A 403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 86.16
3vni_A 294 Xylose isomerase domain protein TIM barrel; D-psic 86.05
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 86.03
1yx1_A264 Hypothetical protein PA2260; structural genomics, 86.01
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 85.78
2h9a_A 445 Carbon monoxide dehydrogenase corrinoid/iron- sulf 85.72
1i60_A278 IOLI protein; beta barrel, structural genomics, PS 85.65
1wa3_A 205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 85.63
2qgh_A 425 Diaminopimelate decarboxylase; lyase; HET: PLP LYS 85.47
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 85.45
2yx0_A342 Radical SAM enzyme; predicted tRNA modification en 85.42
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 85.35
3lmz_A257 Putative sugar isomerase; structural genomics, joi 85.35
3kws_A287 Putative sugar isomerase; structural genomics, joi 85.32
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 85.29
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 85.29
3eb2_A 300 Putative dihydrodipicolinate synthetase; lysine bi 85.25
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 85.2
3t05_A 606 Pyruvate kinase, PK; tetramer, glycolysis, transfe 85.19
3h5d_A 311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 85.06
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 85.03
2vc6_A 292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 85.01
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 84.97
3lab_A 217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 84.88
3mz2_A292 Glycerophosphoryl diester phosphodiesterase; struc 84.75
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 84.71
1r3s_A367 URO-D, uroporphyrinogen decarboxylase, UPD; uropor 84.62
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 84.61
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 84.59
4drs_A526 Pyruvate kinase; glycolysis, allosteric EN transfe 84.51
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 84.45
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 84.27
3eol_A433 Isocitrate lyase; seattle structural center for in 84.27
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 84.11
4ay7_A348 Methylcobalamin\: coenzyme M methyltransferase; TI 83.91
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 83.89
2q02_A272 Putative cytoplasmic protein; structural genomics, 83.89
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 83.85
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 83.79
3iix_A 348 Biotin synthetase, putative; adoMet radical, SAM r 83.59
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 83.39
1thf_D 253 HISF protein; thermophIle, TIM-barrel, histidine b 83.24
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 83.18
1bxb_A 387 Xylose isomerase; xylose metabolism; 2.20A {Thermu 83.18
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 83.03
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 83.02
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 82.93
4eiv_A 297 Deoxyribose-phosphate aldolase; chemotherapy, brai 82.89
3l23_A303 Sugar phosphate isomerase/epimerase; structural ge 82.87
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 82.77
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 82.69
2qw5_A 335 Xylose isomerase-like TIM barrel; putative sugar p 82.67
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 82.61
3oix_A 345 Putative dihydroorotate dehydrogenase; dihydrooro 82.43
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 82.26
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 82.26
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 82.25
2vef_A 314 Dihydropteroate synthase; antibiotic resistance, t 82.25
1hjs_A 332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 82.21
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 82.17
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 82.07
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 82.07
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 82.01
3n9r_A 307 Fructose-bisphosphate aldolase; FBP aldolase, clas 81.99
2r8c_A 426 Putative amidohydrolase; unknown source, sargasso 81.97
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 81.78
3m0z_A249 Putative aldolase; MCSG, PSI-2, structural genomic 81.76
1ydn_A 295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 81.74
1vhc_A 224 Putative KHG/KDPG aldolase; structural genomics, u 81.72
3aty_A 379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 81.7
3zwt_A 367 Dihydroorotate dehydrogenase (quinone), mitochond; 81.66
2y88_A 244 Phosphoribosyl isomerase A; aromatic amino acid bi 81.47
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 81.38
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 81.37
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 81.16
4dpp_A 360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 81.04
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 81.0
2g0w_A296 LMO2234 protein; putative sugar isomerase, structu 80.92
1h5y_A 253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 80.91
2zds_A340 Putative DNA-binding protein; TIM-barrel fold, str 80.8
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 80.8
3m6y_A275 4-hydroxy-2-oxoglutarate aldolase; structural geno 80.79
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 80.74
1j93_A353 UROD, uroporphyrinogen decarboxylase; beta barrel, 80.46
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 80.38
2inf_A359 URO-D, UPD, uroporphyrinogen decarboxylase; (alpha 80.38
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
Probab=100.00  E-value=1.9e-57  Score=440.67  Aligned_cols=234  Identities=40%  Similarity=0.642  Sum_probs=228.4

Q ss_pred             CCCCccEEEeCCCcccCCCCCCCCCHHHHHHHHHHHHhCCCCEEEEeccCCCCCcCCCCCHHHHHHHhhhcCCCeEEEEe
Q 018252          122 GIPRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADARDVMEAVRDLEGARLPVLT  201 (359)
Q Consensus       122 ~~p~~V~I~D~TLRDG~Q~~~~~~~~~~k~~ia~~L~~aGv~~IEvG~fvspk~vPq~~D~~ev~~~l~~~~~~~l~~l~  201 (359)
                      ++|++|+|+|||||||+|+++..|++++|++|+++|+++||+.||+|+|++|+++|+++|.+++++.+++.+++++.+|+
T Consensus         2 ~~~~~v~i~DtTlRDG~Q~~~~~~~~e~k~~i~~~L~~~Gv~~IE~g~~~~~~~~p~~~d~~~~~~~~~~~~~~~~~~l~   81 (307)
T 1ydo_A            2 PYPKKVTIKEVGPRDGLQNEPVWIATEDKITWINQLSRTGLSYIEITSFVHPKWIPALRDAIDVAKGIDREKGVTYAALV   81 (307)
T ss_dssp             CCCSBCEEEECHHHHTGGGSSSCCCHHHHHHHHHHHHTTTCSEEEEEECSCTTTCGGGTTHHHHHHHSCCCTTCEEEEEC
T ss_pred             CCCCceEEEECCCCCCcCCCCCCCCHHHHHHHHHHHHHcCCCEEEECCCcCcccccccCCHHHHHHHhhhcCCCeEEEEe
Confidence            47899999999999999999999999999999999999999999999999999999999999988888777899999999


Q ss_pred             CChHhHHHHHHcCCCEEEEecCCchHHHHhhhcCCHHHHHHHHHHHHHHHHhCCCcEEEEEeeeecCCCCCCCCHHHHHH
Q 018252          202 PNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAIPPSKVAY  281 (359)
Q Consensus       202 ~n~~gie~a~~aGv~~V~i~~s~S~~~~~~n~~~t~~e~l~~i~~~i~~Ak~~G~~V~~~is~~fg~~~~~r~~~e~l~~  281 (359)
                      +|.+|+++++++|++.|++|.++|+.|.+.|+|+|++++++++.+++++||++|++|+++|+++|+||++++++++++.+
T Consensus        82 ~~~~~i~~a~~~g~~~v~i~~~~sd~~~~~~l~~s~~e~l~~~~~~v~~ak~~G~~v~~~i~~~~~~~~~~~~~~~~~~~  161 (307)
T 1ydo_A           82 PNQRGLENALEGGINEACVFMSASETHNRKNINKSTSESLHILKQVNNDAQKANLTTRAYLSTVFGCPYEKDVPIEQVIR  161 (307)
T ss_dssp             CSHHHHHHHHHHTCSEEEEEEESSHHHHHTTTCSCHHHHHHHHHHHHHHHHHTTCEEEEEEECTTCBTTTBCCCHHHHHH
T ss_pred             CCHHhHHHHHhCCcCEEEEEeecCHHHHHHHhCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEecCCcCCCCCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHCCcCEEEEcCCCCCCcHHHHHHHHHHHHHhCCCceEEEEeCCCCCcHHHHHHHHHHcCCCEEeceee
Q 018252          282 VAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVVPVEKLAVHLHDTYGQSLPNILISLQVSPMHAKPCFT  355 (359)
Q Consensus       282 ~a~~l~~~Gad~I~L~DT~G~~~P~~v~~lv~~l~~~~p~~~L~~H~HNd~GLAlANalaAv~AGa~~ID~tl~  355 (359)
                      +++++.++|+++|+|+||+|+++|.+++++++.+++.+|+++|++|+|||+|||+||+++|+++||++||+|+.
T Consensus       162 ~~~~~~~~Ga~~i~l~DT~G~~~P~~v~~lv~~l~~~~~~~~l~~H~Hnd~Gla~AN~laAv~aGa~~vd~tv~  235 (307)
T 1ydo_A          162 LSEALFEFGISELSLGDTIGAANPAQVETVLEALLARFPANQIALHFHDTRGTALANMVTALQMGITVFDGSAG  235 (307)
T ss_dssp             HHHHHHHHTCSCEEEECSSCCCCHHHHHHHHHHHHTTSCGGGEEEECBGGGSCHHHHHHHHHHHTCCEEEEBGG
T ss_pred             HHHHHHhcCCCEEEEcCCCCCcCHHHHHHHHHHHHHhCCCCeEEEEECCCCchHHHHHHHHHHhCCCEEEEccc
Confidence            99999999999999999999999999999999999999989999999999999999999999999999999986
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis inhibition, bromopyruvate, amino-acid biosynthesis; HET: FLC; 1.70A {Mycobacterium tuberculosis} PDB: 1sr9_A 3hpz_A 3hps_A* 3fig_A 3u6w_A 3hpx_A Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1dos_A Aldolase class II; lyase, classii fructose 1,6-bisphosphate aldolase, glycolysis; 1.67A {Escherichia coli} SCOP: c.1.10.2 PDB: 1b57_A* 1gyn_A 1zen_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>3elf_A Fructose-bisphosphate aldolase; zinc enzyme, dihydroxyacetone, glyceraldehyd phosphate, aldol condensation, glycolysis, lyase; HET: 2FP; 1.31A {Mycobacterium tuberculosis} PDB: 3ekz_A* 3ekl_A* 4a22_A* 4a21_A* Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>3qm3_A Fructose-bisphosphate aldolase; structural genomics, center for structural genomics of infec diseases, csgid, TIM beta/alpha-barrel, lyase; 1.85A {Campylobacter jejuni} SCOP: c.1.10.2 Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A Back     alignment and structure
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1k77_A EC1530, hypothetical protein YGBM; TIM barrel, structural genomics, PSI, structure initiative; 1.63A {Escherichia coli} SCOP: c.1.15.5 Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3qxb_A Putative xylose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 1.90A {Rhodospirillum rubrum} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lgd_A Adenosine deaminase CECR1; TIM barrel, dimerization and receptor binding domains, glyco hydrolase, growth factor, secreted; HET: NAG; 2.00A {Homo sapiens} PDB: 3lgg_A* Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} SCOP: c.1.9.1 PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A* Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, STRU genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>4gxw_A Adenosine deaminase; amidohydrolase, COG1816, EFI, structural genomics, hydrolase; 1.30A {Burkholderia ambifaria} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3qtg_A Pyruvate kinase, PK; TIM barrel, glycolysis, transferase; 2.20A {Pyrobaculum aerophilum} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3srk_A* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3khd_A Pyruvate kinase; malaria, structural genomics, structural GE consortium, SGC, transferase; 2.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3o6c_A PNP synthase, pyridoxine 5'-phosphate synthase; structural genomics, IDP90671, center for structural genomic infectious diseases; HET: MSE; 1.87A {Campylobacter jejuni subsp} SCOP: c.1.24.0 PDB: 3o6d_A* Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3mcm_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/dihydropteroate...; folate, TIM barrel, synthase, HPPK, DHPS; 2.20A {Francisella tularensis subsp} PDB: 3mcn_A* 3mco_A* Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2xsa_A Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, O-GLCNACASE, glycosyl hydrolase, hydrolase; 2.00A {Oceanicola granulosus} PDB: 2xsb_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3ayv_A Putative uncharacterized protein TTHB071; structural genomics, riken structural genomics/proteomics in RSGI, TIM barrel, unknown function; 1.85A {Thermus thermophilus} PDB: 3ayt_A Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 3srh_A 3srd_A 1zjh_A 4b2d_A* 4b2d_D* 3u2z_A* 3g2g_A 1t5a_A* 3bjt_A 4g1n_A* 3bjf_A* 3srf_C 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* ... Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Back     alignment and structure
>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center for structural genomics of infectious diseases, CSGI; 1.80A {Vibrio cholerae} Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2eja_A URO-D, UPD, uroporphyrinogen decarboxylase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3u0h_A Xylose isomerase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7 Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2h9a_A Carbon monoxide dehydrogenase corrinoid/iron- sulfur protein, gamma subunit; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_A* Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2qgh_A Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.30A {Helicobacter pylori} PDB: 3c5q_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>3t05_A Pyruvate kinase, PK; tetramer, glycolysis, transferase; 3.05A {Staphylococcus aureus subsp} PDB: 3t07_A* 3t0t_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3mz2_A Glycerophosphoryl diester phosphodiesterase; structural genomics, joint center for structural genomics; HET: MSE PE4; 1.55A {Parabacteroides distasonis} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1r3s_A URO-D, uroporphyrinogen decarboxylase, UPD; uroporphyrinogen decarboxylase coproporphyrinogen, X-RAY crystallography, lyase; HET: 1CP; 1.65A {Homo sapiens} SCOP: c.1.22.1 PDB: 1r3t_A* 1r3r_A 1r3q_A* 1r3y_A* 1uro_A 3gvq_A 3gvr_A 1r3v_A* 3gvv_A 3gvw_A 1jph_A 1r3w_A* 3gw3_A 1jpi_A 1jpk_A 3gw0_A 2q71_A* 2q6z_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>4drs_A Pyruvate kinase; glycolysis, allosteric EN transferase; 2.50A {Cryptosporidium parvum} PDB: 3ma8_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>4ay7_A Methylcobalamin\: coenzyme M methyltransferase; TIM barrel; 1.80A {Methanosarcina mazei} PDB: 4ay8_A Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1bxb_A Xylose isomerase; xylose metabolism; 2.20A {Thermus thermophilus} SCOP: c.1.15.3 PDB: 1bxc_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3m0z_A Putative aldolase; MCSG, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, lyase; HET: MSE; 1.20A {Klebsiella pneumoniae subsp} PDB: 3nzr_A 3lm7_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>2g0w_A LMO2234 protein; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE PG4; 1.70A {Listeria monocytogenes} SCOP: c.1.15.4 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3m6y_A 4-hydroxy-2-oxoglutarate aldolase; structural genomics, MCSG, lyase, PSI-2, protein structure initiative; HET: MSE; 1.45A {Bacillus cereus} PDB: 3n73_A 3mux_A Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>1j93_A UROD, uroporphyrinogen decarboxylase; beta barrel, plastidial enzyme, crystallographic dimer, lyase; 2.30A {Nicotiana tabacum} SCOP: c.1.22.1 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2inf_A URO-D, UPD, uroporphyrinogen decarboxylase; (alpha-beta)8 barrel, eight parallel beta strands surrounded by eight alpha helices, lyase; 2.30A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 359
d1rqba2303 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N- 9e-25
d1sr9a2310 c.1.10.5 (A:61-370) 2-isopropylmalate synthase Leu 2e-22
d1nvma2289 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolas 1e-10
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Length = 303 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: HMGL-like
domain: Transcarboxylase 5S subunit, N-terminal domain
species: Propionibacterium freudenreichii shermanii [TaxId: 1752]

 Score =  100 bits (249), Expect = 9e-25
 Identities = 35/231 (15%), Positives = 77/231 (33%), Gaps = 19/231 (8%)

Query: 124 PRFVKIVEVGPRDGLQNEKNT-VPTGVKVELIRRLVSSGLPVVEATSFVSPKWVPQLADA 182
           PR V I E+  RD  Q+   T +     V     + ++G   VE     +     +  + 
Sbjct: 8   PREVGITELVLRDAHQSLMATRMAMEDMVGACADIDAAGYWSVECWGGATYDSCIRFLNE 67

Query: 183 RDVMEAVRDLEGARLPVLTPNLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLV 242
                        RL      +      +    + +  +   ++      ++ S E+ + 
Sbjct: 68  DPWE---------RLRTFRKLMPNSRLQMLLRGQNLLGYRHYNDEVVDRFVDKSAENGMD 118

Query: 243 RYRAVAHAAKVLSIPVRGYVSCVVGCPVEGAI--------PPSKVAYVAKELHDMGCFEI 294
            +R         ++          G   +G I               +A +L DMG   I
Sbjct: 119 VFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTISPVHTVEGYVKLAGQLLDMGADSI 178

Query: 295 SLGDTIGVGTPGTVVPMLEAVM-AVVPVEKLAVHLHDTYGQSLPNILISLQ 344
           +L D   +  P     +++A+        ++ +H H T G +  +++ +++
Sbjct: 179 ALKDMAALLKPQPAYDIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAIE 229
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 310 Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Length = 289 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 100.0
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 100.0
d1sr9a2310 2-isopropylmalate synthase LeuA, catalytic domain 100.0
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 97.68
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 97.25
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 97.07
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 97.05
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 97.0
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 96.88
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 96.8
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 96.77
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 96.73
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 96.52
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 96.48
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 96.39
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 96.33
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 96.12
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 96.05
d1xp3a1297 Endonuclease IV {Bacillus anthracis [TaxId: 1392]} 94.77
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 94.71
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 94.68
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 94.64
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 94.59
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 94.47
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 94.41
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 94.28
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 94.25
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {S 94.03
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 94.01
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 93.9
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 93.88
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 93.43
d1olta_ 441 Oxygen-independent coproporphyrinogen III oxidase 93.3
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 93.2
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 93.12
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 92.92
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 92.84
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 92.83
d1vlia2295 Spore coat polysaccharide biosynthesis protein Sps 92.74
d1f74a_ 293 N-acetylneuraminate lyase {Haemophilus influenzae 92.25
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 92.24
d1hl2a_ 295 N-acetylneuraminate lyase {Escherichia coli [TaxId 92.01
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 91.7
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 91.61
d2a6na1 292 Dihydrodipicolinate synthase {Escherichia coli [Ta 91.44
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 91.04
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 90.51
d2cbia2 317 Hyaluronidase catalytic domain {Clostridium perfri 90.1
d1i60a_278 Hypothetical protein IolI {Bacillus subtilis [TaxI 89.96
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 89.52
d2g0wa1275 Hypothetical protein Lmo2234 {Listeria monocytogen 89.41
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 89.26
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 89.04
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 88.8
d1qtwa_285 Endonuclease IV {Escherichia coli [TaxId: 562]} 88.64
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 88.41
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 88.12
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 88.04
d1w3ia_ 293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 87.71
d1gvfa_ 284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 87.55
d1hl2a_ 295 N-acetylneuraminate lyase {Escherichia coli [TaxId 87.47
d1j93a_343 Uroporphyrinogen decarboxylase, UROD {Tobacco (Nic 86.09
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 86.06
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 85.91
d1f6ya_262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 85.84
d1mxsa_ 216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 85.73
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 85.4
d1f74a_ 293 N-acetylneuraminate lyase {Haemophilus influenzae 84.76
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 84.59
d1vhca_ 212 Hypothetical protein HI0047 {Haemophilus influenza 84.54
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 84.06
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 84.02
d1foba_ 334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 83.97
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 83.88
d2a6na1 292 Dihydrodipicolinate synthase {Escherichia coli [Ta 83.61
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 83.52
d1eyea_270 Dihydropteroate synthetase {Mycobacterium tubercul 83.51
d1gtea2 312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 83.35
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 82.78
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 82.75
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 81.97
d1jpdx1 208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 81.94
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 81.45
d2choa2 310 Glucosaminidase GH84, catalytic domain {Bacteroide 81.26
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 81.0
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 80.9
d1f6ya_ 262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 80.44
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 80.35
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 80.17
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 80.06
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: HMGL-like
domain: 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain
species: Pseudomonas sp. [TaxId: 306]

Probab=100.00  E-value=3.9e-40  Score=310.64  Aligned_cols=212  Identities=17%  Similarity=0.217  Sum_probs=179.0

Q ss_pred             CCccEEEeCCCcccCCCCCCCCCHHHHHHHHHHHHhCCCCEEEEeccCCCC--CcCC----CCCHHHHHHHhhhcCCCeE
Q 018252          124 PRFVKIVEVGPRDGLQNEKNTVPTGVKVELIRRLVSSGLPVVEATSFVSPK--WVPQ----LADARDVMEAVRDLEGARL  197 (359)
Q Consensus       124 p~~V~I~D~TLRDG~Q~~~~~~~~~~k~~ia~~L~~aGv~~IEvG~fvspk--~vPq----~~D~~ev~~~l~~~~~~~l  197 (359)
                      .++|+|+|||||||+|+.++.|++++|+++++.|+++||+.||+|+++.++  .+++    ..+.+.+.......++..+
T Consensus         5 ~kkI~I~D~TlRDG~Q~~~~~~s~e~k~~i~~~L~~~Gv~~IEvG~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~i   84 (289)
T d1nvma2           5 SKKLYISDVTLRDGSHAIRHQYTLDDVRAIARALDKAKVDSIEVAHGDGLQGSSFNYGFGRHTDLEYIEAVAGEISHAQI   84 (289)
T ss_dssp             CCBCEEEECTTTHHHHHTTTCCCHHHHHHHHHHHHHHTCSEEECSCTTSTTCCBTTTBCCSSCHHHHHHHHHTTCSSSEE
T ss_pred             CCCeEEEECCcccccCCCCCCCCHHHHHHHHHHHHHcCCCEEEeCCCcCcccccchhhhccchHHHHHHHHHHhcchhHH
Confidence            357999999999999999999999999999999999999999999875443  1122    1233434444445677888


Q ss_pred             EEEeC----ChHhHHHHHHcCCCEEEEecCCchHHHHhhhcCCHHHHHHHHHHHHHHHHhCCCcEEEEEeeeecCCCCCC
Q 018252          198 PVLTP----NLKGFEAAIAAGAKEVAIFASASEAFSKSNINCSIEDSLVRYRAVAHAAKVLSIPVRGYVSCVVGCPVEGA  273 (359)
Q Consensus       198 ~~l~~----n~~gie~a~~aGv~~V~i~~s~S~~~~~~n~~~t~~e~l~~i~~~i~~Ak~~G~~V~~~is~~fg~~~~~r  273 (359)
                      .+++.    ..+++..+.+.+++.++++...++...              +.+.+++++++|+++.++      +++.++
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~--------------~~~~~~~a~~~g~~~~~~------~~~~~~  144 (289)
T d1nvma2          85 ATLLLPGIGSVHDLKNAYQAGARVVRVATHCTEADV--------------SKQHIEYARNLGMDTVGF------LMMSHM  144 (289)
T ss_dssp             EEEECBTTBCHHHHHHHHHHTCCEEEEEEETTCGGG--------------GHHHHHHHHHHTCEEEEE------EESTTS
T ss_pred             HHHHhhhhhhHHHHHHHHHhcccceEEEeehhhhhh--------------HhHHHHHHHHhCCceeeE------eeeccc
Confidence            88775    336788999999999999887665432              346678899999988644      446678


Q ss_pred             CCHHHHHHHHHHHHHCCcCEEEEcCCCCCCcHHHHHHHHHHHHHhC-CCceEEEEeCCCCCcHHHHHHHHHHcCCCEEec
Q 018252          274 IPPSKVAYVAKELHDMGCFEISLGDTIGVGTPGTVVPMLEAVMAVV-PVEKLAVHLHDTYGQSLPNILISLQVSPMHAKP  352 (359)
Q Consensus       274 ~~~e~l~~~a~~l~~~Gad~I~L~DT~G~~~P~~v~~lv~~l~~~~-p~~~L~~H~HNd~GLAlANalaAv~AGa~~ID~  352 (359)
                      ++++++.++++.+.++|+++|+|+||+|.++|.+++++++.+++.+ |+++|++|+|||+|||+||+++|+++||++||+
T Consensus       145 ~~~~~~~~~~~~~~~~g~~~I~l~DT~G~~~P~~v~~~v~~l~~~~~~~~~i~~H~Hn~~g~a~an~l~A~~~G~~~id~  224 (289)
T d1nvma2         145 IPAEKLAEQGKLMESYGATCIYMADSGGAMSMNDIRDRMRAFKAVLKPETQVGMHAHHNLSLGVANSIVAVEEGCDRVDA  224 (289)
T ss_dssp             SCHHHHHHHHHHHHHHTCSEEEEECTTCCCCHHHHHHHHHHHHHHSCTTSEEEEECBCTTSCHHHHHHHHHHTTCCEEEE
T ss_pred             cCchhhhHHHHhhccccceeeeecchhhcccchhHHHHHHHHHHHhcccccceeeechHHHHHHHHHHHHHHhCCcEeec
Confidence            9999999999999999999999999999999999999999999998 678999999999999999999999999999999


Q ss_pred             eee
Q 018252          353 CFT  355 (359)
Q Consensus       353 tl~  355 (359)
                      |+.
T Consensus       225 si~  227 (289)
T d1nvma2         225 SLA  227 (289)
T ss_dssp             BGG
T ss_pred             ccc
Confidence            985
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1sr9a2 c.1.10.5 (A:61-370) 2-isopropylmalate synthase LeuA, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xp3a1 c.1.15.1 (A:2-298) Endonuclease IV {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cbia2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j93a_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Tobacco (Nicotiana tabacum), UROD-III [TaxId: 4097]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2choa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure