Citrus Sinensis ID: 018401

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFVSNQNNSENIEEDKGRPCVR
cccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccEEEcccccccccccccccccccccEEEEEccEEEccccccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHcccEEEEHHHHHHHHHHccccccccccccEEccccccccccccccEEEEEcccHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccc
ccccccHHHcccHcccccHHHHHHccHHHccHHHHHHHHHHHHHHHHcEEcccccccccHHHHHHHccHHHHccccEEccEEcccccHHHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHcccccEEEEEcccccccHHHccHHHcccccHHHHHcEEEEEcEccccccEcHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHccEEEEEccccHHHHHccccccccccccEEEEEccccccccccEEEEEccccHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
msslpneavyekekngvtwpkqlnaplevvdpeIADIIEHEKARQWkglelipsenftSVSVMQAVGSVmtnkysegypgaryyggneyIDMAESLCQKRALEAFrldpekwggslsgspsnFQVYTALLKphdrimaldlphgghlshgyqtdtkkISAVSIFFEtmpyrlnestgyidydqleksatlfrPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVaagvipspfeyadvvtttthkslrgprgamIFFRKGVKEINKQGKEVFYDYEEKINQavfpglqggphnhTITGLAVALKQVCTLITFSHIHVFSLHvypafvsnqnnsenieedkgrpcvr
msslpneavyekekngvtwpkqlnapLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMtnkysegyPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKwggslsgspsNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTtthkslrgprgamIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFvsnqnnsenieedkgrpcvr
MSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFVSNQNNSENIEEDKGRPCVR
****************VTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFV*******************
**********************LNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFVSNQNNSENIEEDKGRPC**
************EKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFVSNQNNS*************
*****************TWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFVSNQNNSENIEEDKGRPC**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGSLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTLITFSHIHVFSLHVYPAFVSNQNNSENIEEDKGRPCVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
P50433 518 Serine hydroxymethyltrans N/A no 0.893 0.613 0.934 0.0
P49357 517 Serine hydroxymethyltrans N/A no 0.893 0.615 0.928 1e-179
Q9SZJ5 517 Serine hydroxymethyltrans yes no 0.893 0.615 0.919 1e-177
P34899 518 Serine hydroxymethyltrans N/A no 0.890 0.611 0.915 1e-177
P49358 517 Serine hydroxymethyltrans N/A no 0.893 0.615 0.915 1e-175
Q60V73 511 Serine hydroxymethyltrans N/A no 0.820 0.571 0.674 1e-120
Q10104 488 Serine hydroxymethyltrans yes no 0.837 0.610 0.681 1e-120
O13972 467 Probable serine hydroxyme no no 0.814 0.620 0.682 1e-119
P50432 507 Serine hydroxymethyltrans yes no 0.820 0.575 0.667 1e-118
O13426 470 Serine hydroxymethyltrans N/A no 0.820 0.621 0.665 1e-117
>sp|P50433|GLYM_SOLTU Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function desciption
 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/321 (93%), Positives = 313/321 (97%), Gaps = 3/321 (0%)

Query: 1   MSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSV 60
           MSSLPNEAVY+KEK+GV WPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSV
Sbjct: 30  MSSLPNEAVYDKEKSGVAWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSV 89

Query: 61  SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGS---LS 117
           SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDP KWG +   LS
Sbjct: 90  SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLS 149

Query: 118 GSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTG 177
           GSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG
Sbjct: 150 GSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTG 209

Query: 178 YIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAG 237
           YIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKVCNKQKAI+LADMAHISGLVAAG
Sbjct: 210 YIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCNKQKAILLADMAHISGLVAAG 269

Query: 238 VIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGL 297
           VIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVFYDYE+KINQAVFPGL
Sbjct: 270 VIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVFYDYEDKINQAVFPGL 329

Query: 298 QGGPHNHTITGLAVALKQVCT 318
           QGGPHNHTITGLAVALKQ  T
Sbjct: 330 QGGPHNHTITGLAVALKQATT 350
Interconversion of serine and glycine.
Solanum tuberosum (taxid: 4113)
EC: 2EC: .EC: 1EC: .EC: 2EC: .EC: 1
>sp|P49357|GLYM_FLAPR Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1 Back     alignment and function description
>sp|Q9SZJ5|GLYM_ARATH Serine hydroxymethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1 Back     alignment and function description
>sp|P34899|GLYM_PEA Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1 Back     alignment and function description
>sp|P49358|GLYN_FLAPR Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1 Back     alignment and function description
>sp|Q60V73|GLYC_CAEBR Serine hydroxymethyltransferase OS=Caenorhabditis briggsae GN=mel-32 PE=3 SV=3 Back     alignment and function description
>sp|Q10104|GLYM_SCHPO Serine hydroxymethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shm2 PE=3 SV=2 Back     alignment and function description
>sp|O13972|GLYD_SCHPO Probable serine hydroxymethyltransferase, cytosolic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.12c PE=3 SV=1 Back     alignment and function description
>sp|P50432|GLYC_CAEEL Serine hydroxymethyltransferase OS=Caenorhabditis elegans GN=mel-32 PE=1 SV=2 Back     alignment and function description
>sp|O13426|GLYC_CANAL Serine hydroxymethyltransferase, cytosolic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHM2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
1707998 518 RecName: Full=Serine hydroxymethyltransf 0.893 0.613 0.934 1e-179
134142067 520 mitochondrial serine hydroxymethyltransf 0.896 0.613 0.937 1e-179
118489111 520 unknown [Populus trichocarpa x Populus d 0.896 0.613 0.937 1e-179
224097398 518 precursor of transferase serine hydroxym 0.896 0.615 0.937 1e-179
255572585 515 serine hydroxymethyltransferase, putativ 0.893 0.617 0.937 1e-179
224109940 520 precursor of transferase serine hydroxym 0.896 0.613 0.922 1e-177
1346155 517 RecName: Full=Serine hydroxymethyltransf 0.893 0.615 0.928 1e-177
134142077 520 mitochondrial serine hydroxymethyltransf 0.896 0.613 0.919 1e-177
118488863 520 unknown [Populus trichocarpa x Populus d 0.896 0.613 0.919 1e-177
312281845 518 unnamed protein product [Thellungiella h 0.893 0.613 0.922 1e-176
>gi|1707998|sp|P50433.1|GLYM_SOLTU RecName: Full=Serine hydroxymethyltransferase, mitochondrial; Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; AltName: Full=Serine methylase; Flags: Precursor gi|438247|emb|CAA81082.1| glycine hydroxymethyltransferase [Solanum tuberosum] Back     alignment and taxonomy information
 Score =  634 bits (1636), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 300/321 (93%), Positives = 313/321 (97%), Gaps = 3/321 (0%)

Query: 1   MSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSV 60
           MSSLPNEAVY+KEK+GV WPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSV
Sbjct: 30  MSSLPNEAVYDKEKSGVAWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSV 89

Query: 61  SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGS---LS 117
           SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDP KWG +   LS
Sbjct: 90  SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPAKWGVNVQPLS 149

Query: 118 GSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTG 177
           GSP+NFQVYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG
Sbjct: 150 GSPANFQVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTG 209

Query: 178 YIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAG 237
           YIDYDQLEKSATLFRPKLIVAGASAYARLYDY+RIRKVCNKQKAI+LADMAHISGLVAAG
Sbjct: 210 YIDYDQLEKSATLFRPKLIVAGASAYARLYDYDRIRKVCNKQKAILLADMAHISGLVAAG 269

Query: 238 VIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGL 297
           VIPSPF+YADVVTTTTHKSLRGPRGAMIF+RKGVKE+NKQGKEVFYDYE+KINQAVFPGL
Sbjct: 270 VIPSPFDYADVVTTTTHKSLRGPRGAMIFYRKGVKEVNKQGKEVFYDYEDKINQAVFPGL 329

Query: 298 QGGPHNHTITGLAVALKQVCT 318
           QGGPHNHTITGLAVALKQ  T
Sbjct: 330 QGGPHNHTITGLAVALKQATT 350

Source: Solanum tuberosum

Species: Solanum tuberosum

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|134142067|gb|ABO61377.1| mitochondrial serine hydroxymethyltransferase [Populus tremuloides] Back     alignment and taxonomy information
>gi|118489111|gb|ABK96362.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224097398|ref|XP_002310916.1| precursor of transferase serine hydroxymethyltransferase 2 [Populus trichocarpa] gi|222850736|gb|EEE88283.1| precursor of transferase serine hydroxymethyltransferase 2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255572585|ref|XP_002527226.1| serine hydroxymethyltransferase, putative [Ricinus communis] gi|223533402|gb|EEF35152.1| serine hydroxymethyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224109940|ref|XP_002315363.1| precursor of transferase serine hydroxymethyltransferase 7 [Populus trichocarpa] gi|222864403|gb|EEF01534.1| precursor of transferase serine hydroxymethyltransferase 7 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|1346155|sp|P49357.1|GLYM_FLAPR RecName: Full=Serine hydroxymethyltransferase 1, mitochondrial; Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; AltName: Full=Serine methylase; Flags: Precursor gi|437995|emb|CAA81078.1| glycine hydroxymethyltransferase [Flaveria pringlei] Back     alignment and taxonomy information
>gi|134142077|gb|ABO61382.1| mitochondrial serine hydroxymethyltransferase [Populus tremuloides] Back     alignment and taxonomy information
>gi|118488863|gb|ABK96241.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|312281845|dbj|BAJ33788.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
TAIR|locus:2005518 517 SHM1 "serine transhydroxymethy 0.893 0.615 0.919 9.9e-158
TAIR|locus:2148463 533 SHM2 "serine hydroxymethyltran 0.893 0.596 0.878 3.3e-150
POMBASE|SPAC18G6.04c 488 shm2 "serine hydroxymethyltran 0.837 0.610 0.681 2.4e-108
POMBASE|SPAC24C9.12c 467 SPAC24C9.12c "glycine hydroxym 0.814 0.620 0.682 6.3e-108
UNIPROTKB|Q60V73 511 mel-32 "Serine hydroxymethyltr 0.811 0.565 0.681 1.3e-107
CGD|CAL0003822 493 SHM1 [Candida albicans (taxid: 0.828 0.598 0.672 2.1e-107
UNIPROTKB|Q59PP7 493 SHM1 "Putative uncharacterized 0.828 0.598 0.672 2.1e-107
ASPGD|ASPL0000008876 600 AN10745 [Emericella nidulans ( 0.823 0.488 0.675 3.5e-107
UNIPROTKB|G4MRB4 516 MGG_13781 "Serine hydroxymethy 0.823 0.567 0.680 3.5e-107
WB|WBGene00003214 507 mel-32 [Caenorhabditis elegans 0.811 0.570 0.674 3.1e-106
TAIR|locus:2005518 SHM1 "serine transhydroxymethyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1537 (546.1 bits), Expect = 9.9e-158, P = 9.9e-158
 Identities = 295/321 (91%), Positives = 308/321 (95%)

Query:     1 MSSLPNEAVYEKEKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSV 60
             MSSLP+EAV EKE++ VTWPKQLNAPLE VDPEIADIIEHEKARQWKGLELIPSENFTSV
Sbjct:    29 MSSLPSEAVDEKERSRVTWPKQLNAPLEEVDPEIADIIEHEKARQWKGLELIPSENFTSV 88

Query:    61 SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGGS---LS 117
             SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAE+LCQKRALEAFRLDPEKWG +   LS
Sbjct:    89 SVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAETLCQKRALEAFRLDPEKWGVNVQPLS 148

Query:   118 GSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTG 177
             GSP+NF VYTALLKPH+RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRL+ESTG
Sbjct:   149 GSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLDESTG 208

Query:   178 YIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAG 237
             YIDYDQ+EKSATLFRPKLIVAGASAYARLYDY RIRKVCNKQKA+MLADMAHISGLVAA 
Sbjct:   209 YIDYDQMEKSATLFRPKLIVAGASAYARLYDYARIRKVCNKQKAVMLADMAHISGLVAAN 268

Query:   238 VIPSPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGL 297
             VIPSPF+YADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEV YD+E+KINQAVFPGL
Sbjct:   269 VIPSPFDYADVVTTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVLYDFEDKINQAVFPGL 328

Query:   298 QGGPHNHTITGLAVALKQVCT 318
             QGGPHNHTITGLAVALKQ  T
Sbjct:   329 QGGPHNHTITGLAVALKQATT 349
GO:0003824 "catalytic activity" evidence=IEA
GO:0004372 "glycine hydroxymethyltransferase activity" evidence=IEA;ISS;TAS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006544 "glycine metabolic process" evidence=IEA;ISS
GO:0006563 "L-serine metabolic process" evidence=IEA;ISS
GO:0019464 "glycine decarboxylation via glycine cleavage system" evidence=IMP
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0005634 "nucleus" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009626 "plant-type hypersensitive response" evidence=TAS
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0010319 "stromule" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009853 "photorespiration" evidence=IMP
GO:0016020 "membrane" evidence=IDA
GO:0008266 "poly(U) RNA binding" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
TAIR|locus:2148463 SHM2 "serine hydroxymethyltransferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC18G6.04c shm2 "serine hydroxymethyltransferase Shm2 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
POMBASE|SPAC24C9.12c SPAC24C9.12c "glycine hydroxymethyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q60V73 mel-32 "Serine hydroxymethyltransferase" [Caenorhabditis briggsae (taxid:6238)] Back     alignment and assigned GO terms
CGD|CAL0003822 SHM1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59PP7 SHM1 "Putative uncharacterized protein SHM1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008876 AN10745 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MRB4 MGG_13781 "Serine hydroxymethyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
WB|WBGene00003214 mel-32 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34899GLYM_PEA2, ., 1, ., 2, ., 10.91560.89040.6119N/Ano
Q9SZJ5GLYM_ARATH2, ., 1, ., 2, ., 10.91900.89320.6150yesno
Q75BQ6GLYC_ASHGO2, ., 1, ., 2, ., 10.64560.83700.6353yesno
B8FJ72GLYA_DESAA2, ., 1, ., 2, ., 10.50860.75560.6513yesno
P37291GLYC_YEAST2, ., 1, ., 2, ., 10.64900.83700.6353yesno
O62585GLYC_ENCCU2, ., 1, ., 2, ., 10.53690.81170.6282yesno
P50433GLYM_SOLTU2, ., 1, ., 2, ., 10.93450.89320.6138N/Ano
Q6FUP6GLYC_CANGA2, ., 1, ., 2, ., 10.64230.83700.6353yesno
P49357GLYM_FLAPR2, ., 1, ., 2, ., 10.92830.89320.6150N/Ano
P49358GLYN_FLAPR2, ., 1, ., 2, ., 10.91580.89320.6150N/Ano
Q54Z26GLYC1_DICDI2, ., 1, ., 2, ., 10.63850.81460.6345yesno
Q10104GLYM_SCHPO2, ., 1, ., 2, ., 10.68100.83700.6106yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.20.963
4th Layer2.1.2.10.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
SHMT2
precursor of transferase serine hydroxymethyltransferase 2 (EC-2.1.2.1); Interconversion of serine and glycine (By similarity) (518 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gdcP1
precursor of carboxylase p-protein 1, glycine decarboxylase complex (EC-1.4.4.2) (1061 aa)
•  • •• 0.945
eugene3.00002342
methionyl-trna formyltransferase (EC-2.1.2.9) (356 aa)
     •• 0.930
FTHFS1
10-formyltetrahydrofolate synthetase (EC-6.3.4.3) (636 aa)
    ••• 0.926
gdcT1
precursor of carboxylase t-protein 1, glycine decarboxylase complex (EC-2.1.2.10); The glycine [...] (409 aa)
•    •• 0.920
gdcT2
RecName- Full=Aminomethyltransferase; EC=2.1.2.10;; The glycine cleavage system catalyzes the d [...] (409 aa)
•    •• 0.920
estExt_fgenesh4_pm.C_LG_X0439
aminoimidazolecarboximide ribonucleotide transformylase/inosine monophosphate cyclohydrolase (E [...] (545 aa)
   • •• 0.916
estExt_Genewise1_v1.C_LG_XIII1664
threonine aldolase (EC-4.1.2.5) (344 aa)
    ••• 0.915
estExt_fgenesh4_pg.C_LG_I1607
serine--glyoxylate transaminase (EC-2.6.1.45) (401 aa)
     •• 0.914
estExt_fgenesh4_pg.C_LG_XIX0195
threonine aldolase (EC-4.1.2.5) (359 aa)
     •• 0.913
estExt_Genewise1_v1.C_LG_IX3694
serine--glyoxylate transaminase (EC-2.6.1.45) (401 aa)
     •• 0.913

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
PLN03226 475 PLN03226, PLN03226, serine hydroxymethyltransferas 0.0
PTZ00094 452 PTZ00094, PTZ00094, serine hydroxymethyltransferas 0.0
pfam00464380 pfam00464, SHMT, Serine hydroxymethyltransferase 1e-176
cd00378402 cd00378, SHMT, Serine-glycine hydroxymethyltransfe 1e-157
PLN02271 586 PLN02271, PLN02271, serine hydroxymethyltransferas 1e-146
COG0112413 COG0112, GlyA, Glycine/serine hydroxymethyltransfe 1e-137
PRK00011416 PRK00011, glyA, serine hydroxymethyltransferase; R 1e-134
PRK13034416 PRK13034, PRK13034, serine hydroxymethyltransferas 1e-113
PRK13580 493 PRK13580, PRK13580, serine hydroxymethyltransferas 8e-63
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 7e-27
COG0520405 COG0520, csdA, Selenocysteine lyase/Cysteine desul 0.001
>gnl|CDD|215639 PLN03226, PLN03226, serine hydroxymethyltransferase; Provisional Back     alignment and domain information 
 Score =  670 bits (1732), Expect = 0.0
 Identities = 235/309 (76%), Positives = 258/309 (83%), Gaps = 3/309 (0%)

Query: 13  EKNGVTWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTN 72
           EK+ V+ PK  NAPLE VDPEIADIIE EK RQWKGLELI SENFTS +VM+A+GS +TN
Sbjct: 1   EKSMVSVPKWGNAPLEEVDPEIADIIEKEKRRQWKGLELIASENFTSRAVMEALGSCLTN 60

Query: 73  KYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGG---SLSGSPSNFQVYTAL 129
           KYSEG PGARYYGGNEYID  E+LCQKRALEAFRLDPEKWG     LSGSP+NF VYTAL
Sbjct: 61  KYSEGLPGARYYGGNEYIDQIETLCQKRALEAFRLDPEKWGVNVQPLSGSPANFAVYTAL 120

Query: 130 LKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSAT 189
           L+PHDRIM LDLPHGGHLSHGYQTD KKISA SI+FE+MPYRL+ESTG IDYD+LEK A 
Sbjct: 121 LQPHDRIMGLDLPHGGHLSHGYQTDGKKISATSIYFESMPYRLDESTGLIDYDKLEKKAM 180

Query: 190 LFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVV 249
           LFRPKLI+AGASAY R +DY R+RK+ +K  A+++ DMAHISGLVAA    SPFEY DVV
Sbjct: 181 LFRPKLIIAGASAYPRDWDYARMRKIADKVGALLMCDMAHISGLVAAQEAASPFEYCDVV 240

Query: 250 TTTTHKSLRGPRGAMIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGL 309
           TTTTHKSLRGPRG MIFFRKG K    QG+   YDYE+KIN AVFPGLQGGPHNHTI  L
Sbjct: 241 TTTTHKSLRGPRGGMIFFRKGPKPPKGQGEGAVYDYEDKINFAVFPGLQGGPHNHTIAAL 300

Query: 310 AVALKQVCT 318
           AVALKQ  T
Sbjct: 301 AVALKQAMT 309

Length = 475
>gnl|CDD|240264 PTZ00094, PTZ00094, serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|189558 pfam00464, SHMT, Serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|99733 cd00378, SHMT, Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>gnl|CDD|215153 PLN02271, PLN02271, serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|223190 COG0112, GlyA, Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234571 PRK00011, glyA, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237280 PRK13034, PRK13034, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184161 PRK13580, PRK13580, serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|223594 COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 100.0
KOG2467 477 consensus Glycine/serine hydroxymethyltransferase 100.0
PLN02271 586 serine hydroxymethyltransferase 100.0
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 100.0
PLN03226 475 serine hydroxymethyltransferase; Provisional 100.0
PTZ00094 452 serine hydroxymethyltransferase; Provisional 100.0
PRK13580 493 serine hydroxymethyltransferase; Provisional 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
PRK13034416 serine hydroxymethyltransferase; Reviewed 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 100.0
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 100.0
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.96
PLN02651364 cysteine desulfurase 99.96
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.96
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.96
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.96
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.96
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.95
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.95
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 99.95
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.95
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.95
PLN02409401 serine--glyoxylate aminotransaminase 99.95
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.94
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.94
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.94
PRK02948381 cysteine desulfurase; Provisional 99.94
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.94
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.94
PRK14012 404 cysteine desulfurase; Provisional 99.94
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.94
TIGR01814406 kynureninase kynureninase. This model describes ky 99.94
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.93
PRK02769380 histidine decarboxylase; Provisional 99.92
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.92
PLN02724 805 Molybdenum cofactor sulfurase 99.92
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.91
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.91
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.91
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.9
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 99.9
PLN03032374 serine decarboxylase; Provisional 99.9
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.9
PRK13520371 L-tyrosine decarboxylase; Provisional 99.89
PRK03080378 phosphoserine aminotransferase; Provisional 99.89
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.89
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.89
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.88
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.88
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.88
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.88
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.88
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.87
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.87
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.87
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.86
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.86
PRK07179407 hypothetical protein; Provisional 99.86
PRK06108382 aspartate aminotransferase; Provisional 99.86
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.85
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.85
PRK08361391 aspartate aminotransferase; Provisional 99.84
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.84
PLN00175413 aminotransferase family protein; Provisional 99.84
PRK08912387 hypothetical protein; Provisional 99.84
PRK08960387 hypothetical protein; Provisional 99.84
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.84
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.83
PRK06225380 aspartate aminotransferase; Provisional 99.83
PRK08068389 transaminase; Reviewed 99.83
PRK05957389 aspartate aminotransferase; Provisional 99.83
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.83
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.83
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.83
PRK12414384 putative aminotransferase; Provisional 99.83
PRK06348384 aspartate aminotransferase; Provisional 99.83
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.82
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.82
PRK07681399 aspartate aminotransferase; Provisional 99.82
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.82
PRK05942394 aspartate aminotransferase; Provisional 99.82
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.82
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.82
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.82
PRK07309391 aromatic amino acid aminotransferase; Validated 99.82
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.82
PLN02368407 alanine transaminase 99.82
PRK06207405 aspartate aminotransferase; Provisional 99.82
PRK07682378 hypothetical protein; Validated 99.81
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.81
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.81
PRK07777387 aminotransferase; Validated 99.81
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.81
PRK07337388 aminotransferase; Validated 99.81
PRK07550386 hypothetical protein; Provisional 99.81
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.81
PTZ00377481 alanine aminotransferase; Provisional 99.81
PLN02452365 phosphoserine transaminase 99.81
PRK05764393 aspartate aminotransferase; Provisional 99.81
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.81
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.8
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.8
PRK06290410 aspartate aminotransferase; Provisional 99.8
PRK04366 481 glycine dehydrogenase subunit 2; Validated 99.8
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.8
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.8
PLN02483489 serine palmitoyltransferase 99.8
PLN02187462 rooty/superroot1 99.8
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.8
PRK09082386 methionine aminotransferase; Validated 99.8
PRK07683387 aminotransferase A; Validated 99.8
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.79
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.79
PTZ00433412 tyrosine aminotransferase; Provisional 99.79
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.79
PLN02656409 tyrosine transaminase 99.79
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 99.79
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.79
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.79
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.79
PLN02822481 serine palmitoyltransferase 99.79
PRK04311464 selenocysteine synthase; Provisional 99.78
PRK08574385 cystathionine gamma-synthase; Provisional 99.78
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.78
PRK07324373 transaminase; Validated 99.78
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.78
PRK08363398 alanine aminotransferase; Validated 99.78
PLN02721353 threonine aldolase 99.78
PRK08776405 cystathionine gamma-synthase; Provisional 99.78
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.78
PRK08861388 cystathionine gamma-synthase; Provisional 99.77
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.77
PRK06107402 aspartate aminotransferase; Provisional 99.77
PLN02231534 alanine transaminase 99.77
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.77
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.77
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.77
PRK07503403 methionine gamma-lyase; Provisional 99.77
PRK08636403 aspartate aminotransferase; Provisional 99.77
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.77
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.77
PLN02955476 8-amino-7-oxononanoate synthase 99.77
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.77
PRK09148405 aminotransferase; Validated 99.76
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.76
PRK06234400 methionine gamma-lyase; Provisional 99.76
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.76
PRK07811388 cystathionine gamma-synthase; Provisional 99.76
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 99.76
PRK09265404 aminotransferase AlaT; Validated 99.76
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 99.76
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.76
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.76
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.76
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.76
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.76
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.76
PRK09105370 putative aminotransferase; Provisional 99.75
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.75
PLN02263470 serine decarboxylase 99.75
PRK09064407 5-aminolevulinate synthase; Validated 99.75
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.75
PRK06767386 methionine gamma-lyase; Provisional 99.75
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.75
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.75
PRK13392410 5-aminolevulinate synthase; Provisional 99.75
PRK09028394 cystathionine beta-lyase; Provisional 99.75
PRK08249398 cystathionine gamma-synthase; Provisional 99.75
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.75
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.74
PRK05968389 hypothetical protein; Provisional 99.74
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.74
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.74
PRK08064390 cystathionine beta-lyase; Provisional 99.74
PRK08045386 cystathionine gamma-synthase; Provisional 99.74
PRK07568397 aspartate aminotransferase; Provisional 99.74
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 99.74
PLN02509464 cystathionine beta-lyase 99.74
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.74
PRK08114395 cystathionine beta-lyase; Provisional 99.73
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.73
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.73
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.73
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.73
PRK06460376 hypothetical protein; Provisional 99.73
PRK05939 397 hypothetical protein; Provisional 99.73
PRK07050394 cystathionine beta-lyase; Provisional 99.73
PRK08175395 aminotransferase; Validated 99.73
PRK15029 755 arginine decarboxylase; Provisional 99.73
PRK13393406 5-aminolevulinate synthase; Provisional 99.73
PRK06855433 aminotransferase; Validated 99.72
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.72
PRK12462364 phosphoserine aminotransferase; Provisional 99.72
PRK03321352 putative aminotransferase; Provisional 99.72
PLN02880490 tyrosine decarboxylase 99.72
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.72
PRK10534333 L-threonine aldolase; Provisional 99.72
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 99.72
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.71
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 99.71
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.71
PRK07269364 cystathionine gamma-synthase; Reviewed 99.71
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 99.71
PRK06836394 aspartate aminotransferase; Provisional 99.71
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.71
PLN02242418 methionine gamma-lyase 99.71
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 99.7
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.7
PRK05839374 hypothetical protein; Provisional 99.7
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.69
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 99.69
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.69
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.69
PRK01688351 histidinol-phosphate aminotransferase; Provisional 99.69
PRK07671377 cystathionine beta-lyase; Provisional 99.69
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.69
PRK05967395 cystathionine beta-lyase; Provisional 99.68
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 99.68
PLN02590539 probable tyrosine decarboxylase 99.68
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.68
PRK08247366 cystathionine gamma-synthase; Reviewed 99.67
PRK13237 460 tyrosine phenol-lyase; Provisional 99.67
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 99.67
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.67
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.67
PRK05367 954 glycine dehydrogenase; Provisional 99.67
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.67
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.67
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 99.67
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.67
PRK13578 720 ornithine decarboxylase; Provisional 99.66
PLN026721082 methionine S-methyltransferase 99.66
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.66
PRK07908349 hypothetical protein; Provisional 99.66
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.65
PRK09275 527 aspartate aminotransferase; Provisional 99.65
PTZ00376404 aspartate aminotransferase; Provisional 99.65
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.65
KOG1360 570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.65
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.65
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.65
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.64
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.64
PRK07582366 cystathionine gamma-lyase; Validated 99.64
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.64
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.63
PRK07392360 threonine-phosphate decarboxylase; Validated 99.62
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.62
PRK07505402 hypothetical protein; Provisional 99.62
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.61
PRK12566 954 glycine dehydrogenase; Provisional 99.6
PRK06434384 cystathionine gamma-lyase; Validated 99.59
PRK07049427 methionine gamma-lyase; Validated 99.59
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.59
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.59
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.58
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.58
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.58
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.58
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 99.57
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.57
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.57
PRK15400 714 lysine decarboxylase CadA; Provisional 99.57
PRK08354311 putative aminotransferase; Provisional 99.56
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.55
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.55
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.54
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.54
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.53
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.53
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.53
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.53
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.52
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.52
PRK05367 954 glycine dehydrogenase; Provisional 99.52
TIGR03811 608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.52
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.51
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.5
PLN02397423 aspartate transaminase 99.5
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.49
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.48
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.47
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.46
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.46
PRK12403460 putative aminotransferase; Provisional 99.45
PRK08637388 hypothetical protein; Provisional 99.45
PRK02627396 acetylornithine aminotransferase; Provisional 99.45
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.44
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.43
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 99.43
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.43
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.42
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.42
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.41
COG1003 496 GcvP Glycine cleavage system protein P (pyridoxal- 99.4
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 99.4
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.39
TIGR02617 467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.39
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.37
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.37
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.37
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.37
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.37
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.37
PLN02624474 ornithine-delta-aminotransferase 99.36
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.35
PRK06062451 hypothetical protein; Provisional 99.35
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.35
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.35
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.35
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.34
PRK07046453 aminotransferase; Validated 99.34
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.34
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.33
PRK06105460 aminotransferase; Provisional 99.31
PRK07482461 hypothetical protein; Provisional 99.3
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.3
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.3
PRK04260375 acetylornithine aminotransferase; Provisional 99.29
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.28
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.27
PRK05965459 hypothetical protein; Provisional 99.27
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.27
PRK09792421 4-aminobutyrate transaminase; Provisional 99.27
PRK06541460 hypothetical protein; Provisional 99.27
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.26
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.25
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.24
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.24
PLN00144382 acetylornithine transaminase 99.24
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.23
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.22
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.22
PRK06149972 hypothetical protein; Provisional 99.22
PRK07678451 aminotransferase; Validated 99.21
PRK07481449 hypothetical protein; Provisional 99.2
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.2
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 99.19
PRK07483443 hypothetical protein; Provisional 99.19
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 99.19
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.18
PRK07480456 putative aminotransferase; Validated 99.17
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.17
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.16
PRK06917447 hypothetical protein; Provisional 99.16
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.16
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.16
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.15
PRK061481013 hypothetical protein; Provisional 99.15
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 99.14
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.14
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.14
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.13
PRK07036466 hypothetical protein; Provisional 99.13
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.13
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.11
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.11
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.11
KOG0633375 consensus Histidinol phosphate aminotransferase [A 99.09
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.05
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.05
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.05
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 98.99
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 98.98
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 98.97
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.95
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 98.93
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 98.93
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 98.91
COG4100416 Cystathionine beta-lyase family protein involved i 98.91
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 98.88
KOG0629510 consensus Glutamate decarboxylase and related prot 98.86
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 98.82
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 98.81
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 98.8
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 98.8
PRK08297443 L-lysine aminotransferase; Provisional 98.8
KOG0634472 consensus Aromatic amino acid aminotransferase and 98.72
KOG1401433 consensus Acetylornithine aminotransferase [Amino 98.72
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 98.61
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 98.54
PRK12566 954 glycine dehydrogenase; Provisional 98.48
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 98.45
KOG0628 511 consensus Aromatic-L-amino-acid/L-histidine decarb 98.39
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.36
COG3033 471 TnaA Tryptophanase [Amino acid transport and metab 98.31
KOG2790370 consensus Phosphoserine aminotransferase [Coenzyme 98.25
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 98.04
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 97.39
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 96.94
KOG3843 432 consensus Predicted serine hydroxymethyltransferas 95.59
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 94.67
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 93.57
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 89.07
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-45  Score=331.21  Aligned_cols=275  Identities=51%  Similarity=0.820  Sum_probs=260.6

Q ss_pred             ccccccChHHHHHHHHHHHHHHcCCeeecCCCCCcHHHHHHHHhhhhccCCCCCCCCccCCCchhHHHHHHHHHHHHHHH
Q 018401           25 APLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEA  104 (356)
Q Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~i~L~~~~~~~~~~V~~a~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~la~~  104 (356)
                      ..+...++++++.+.++..+|++.|+|+++||++++.|++++...+.++|++|||+.|||+|++..+++|+.+.++.+++
T Consensus         5 ~~l~~~d~~i~~~i~~e~~rq~~~ieLIASEN~~S~aV~~A~gS~ltnKYAEGyPgkRyYgGce~VD~vE~laierak~L   84 (413)
T COG0112           5 ASLADYDPEIFEAIQQELERQREHIELIASENFTSPAVMEAQGSDLTNKYAEGYPGKRYYGGCEYVDEVEELAIERAKKL   84 (413)
T ss_pred             hhHHhcCHHHHHHHHHHHHHHhhceeeeeccccCCHHHHHHHhhhhhhccccCCCCccccCCCeeHHHHHHHHHHHHHHH
Confidence            45567899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCcccc-CCCchHHHHHHHHhhcCCCCeeeecCCCCCcccCcccccccccccccceeeEEEecccCCCCCCCCHHH
Q 018401          105 FRLDPEKWGG-SLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQ  183 (356)
Q Consensus       105 ~g~~~~~v~v-~~sgs~a~~~~l~al~~~gd~Vl~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~~~~~~~d~~~  183 (356)
                      ||++..+  + +.||+.||.+++.++++|||+|+-.+..|++|++++.     .+.+.|..++.++++++.+++.+|+|+
T Consensus        85 Fga~~an--VQPhSGs~AN~av~~All~pGDtimgm~l~~GGHltHg~-----~v~~sG~~~~~v~Y~vd~et~~IDyD~  157 (413)
T COG0112          85 FGAEYAN--VQPHSGSQANQAVYLALLQPGDTIMGLDLSHGGHLTHGS-----PVNFSGKLFNVVSYGVDPETGLIDYDE  157 (413)
T ss_pred             hCCCccc--cCCCCchHHHHHHHHHHcCCCCeEecccCCCCCcccCCC-----CCCccceeEEeEecccccccCccCHHH
Confidence            9998764  5 8899999999999999999999999999999999886     566778889999999998889999999


Q ss_pred             HHHHhhhcCCcEEEEcCCCCCCcccHHHHHHHHHHcCCEEEEeccchhhhcccCCCCCCCCCccEEEeCCCCcCCCCCce
Q 018401          184 LEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGA  263 (356)
Q Consensus       184 l~~~i~~~~~k~v~l~~~n~g~~~~l~~I~~la~~~g~~vivD~a~~~g~~~~~~~~~~l~~~D~~~~s~~K~l~gp~gG  263 (356)
                      +++.+.+++||+|++..|.++...|++++.++|++.|+++++|.||.+|++..++.++|+..+|++++|+||+|.||+||
T Consensus       158 ~~k~a~e~kPK~ii~G~SaY~r~id~~~~reIad~VGA~L~~DmAHiaGLVA~G~~p~P~~~AdvVTtTTHKTlrGPrGG  237 (413)
T COG0112         158 VEKLAKEVKPKLIIAGGSAYSRPIDFKRFREIADEVGAYLMVDMAHVAGLIAGGVHPNPLPHADVVTTTTHKTLRGPRGG  237 (413)
T ss_pred             HHHHHHHhCCCEEEECccccccccCHHHHHHHHHHhCceEEehHHHHHHHHhcccCCCCCCccceEeCCcccCCCCCCce
Confidence            99999988999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecCcchhccCCcchhhhHHHhhccccCCCCCCCCcHHHHHHHHHHHHHHhcc
Q 018401          264 MIFFRKGVKEINKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTL  319 (356)
Q Consensus       264 ~l~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~gt~~~~~~~al~~Al~~~~~~  319 (356)
                      +|+++++             ++.++++...+|+.+|.|..+.++|.+.|+.+..+.
T Consensus       238 ~Il~~~e-------------el~kkin~aVFPg~qggpl~HviAakaVa~~Eal~p  280 (413)
T COG0112         238 IILTNDE-------------ELAKKINSAVFPGLQGGPLMHVIAAKAVAFKEALEP  280 (413)
T ss_pred             EEEeccH-------------HHHHHhhhhcCCccCCChHHHHHHHHHHHHHHHcCh
Confidence            9999985             799999999999999999999999999999999875

>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2790 consensus Phosphoserine aminotransferase [Coenzyme transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
3ou5_A 490 Human Mitochondrial Serine Hydroxymethyltransferase 1e-115
1bj4_A 470 Recombinant Serine Hydroxymethyltransferase (human) 1e-108
1ls3_B 483 Crystal Structure Of The Complex Between Rabbit Cyt 1e-107
1rvu_A 483 E75q Mutant Of Rabbit Cytosolic Serine Hydroxymethy 1e-106
1cj0_A 470 Crystal Structure Of Rabbit Cytosolic Serine Hydrox 1e-106
1rv3_A 483 E75l Mutant Of Rabbit Cytosolic Serine Hydroxymethy 1e-106
1eji_A 478 Recombinant Serine Hydroxymethyltransferase (Mouse) 1e-104
2vmv_A405 Crystal Structure Of F351gbsshmt Internal Aldimine 6e-65
1kkj_A 419 Crystal Structure Of Serine Hydroxymethyltransferas 6e-65
2vmn_A405 Crystal Structure Of N341absshmt Internal Aldimine 7e-65
3pgy_A415 Serine Hydroxymethyltransferase From Staphylococcus 1e-64
2vi8_A405 Crystal Structure Of S172absshmt Internal Aldimine 1e-64
2w7d_A405 Crystal Structure Of Y51fbsshmt Internal Aldimine L 1e-64
1yjs_A 419 K226q Mutant Of Serine Hydroxymethyltransferase Fro 2e-64
2vgs_A407 Crystal Structure Of E53qbsshmt Internal Aldimine L 2e-64
1yjy_A 419 K226m Mutant Of Serine Hydroxymethyltransferase Fro 3e-64
2w7i_A405 Crystal Structure Of Y61absshmt Internal Aldimine L 6e-64
2vmr_A405 Crystal Structure Of Y60absshmt Internal Aldimine L 6e-64
3n0l_A 417 Crystal Structure Of Serine Hydroxymethyltransferas 1e-63
1dfo_A417 Crystal Structure At 2.4 Angstrom Resolution Of E. 3e-63
2dkj_A407 Crystal Structure Of T.Th.Hb8 Serine Hydroxymethylt 5e-63
3h7f_A 447 Crystal Structure Of Serine Hydroxymethyltransferas 5e-63
1eqb_A417 X-Ray Crystal Structure At 2.7 Angstroms Resolution 7e-63
3g8m_A417 Serine Hydroxymethyltransferase Y55f Mutant Length 7e-63
3gbx_A420 Serine Hydroxymethyltransferase From Salmonella Typ 2e-58
3ecd_A 425 Crystal Structure Of Serine Hydroxymethyltransferas 5e-57
>pdb|3OU5|A Chain A, Human Mitochondrial Serine Hydroxymethyltransferase 2 Length = 490 Back     alignment and structure 
Iteration: 1

 Score =  412 bits (1060), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 237/292 (81%), Gaps = 4/292 (1%)
Query: 31  DPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYI 90
           DPE+ ++++ EK RQ +GLELI SENF S + ++A+GS + NKYSEGYPG RYYGG E +
Sbjct: 39  DPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVV 98
Query: 91  DMAESLCQKRALEAFRLDPEKWGGSL---SGSPSNFQVYTALLKPHDRIMALDLPHGGHL 147
           D  E LCQ+RALEAF LDP +WG ++   SGSP+N  VYTALL+PHDRIM LDLP GGHL
Sbjct: 99  DEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHL 158
Query: 148 SHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPKLIVAGASAYARLY 207
           +HGY +D K+ISA SIFFE+MPY+LN  TG IDY+QL  +A LFRP+LI+AG SAYARL 
Sbjct: 159 THGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLI 218
Query: 208 DYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGPRGAMIFF 267
           DY R+R+VC++ KA +LADMAHISGLVAA VIPSPF++AD+VTTTTHK+LRG R  +IF+
Sbjct: 219 DYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFY 278
Query: 268 RKGVKEIN-KQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCT 318
           RKGVK ++ K G+E+ Y +E++IN AVFP LQGGPHNH I  +AVALKQ CT
Sbjct: 279 RKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACT 330
>pdb|1BJ4|A Chain A, Recombinant Serine Hydroxymethyltransferase (human) Length = 470 Back     alignment and structure
>pdb|1LS3|B Chain B, Crystal Structure Of The Complex Between Rabbit Cytosolic Serine Hydroxymethyltransferase And Triglu-5-Formyl-Tetrahydrofolate Length = 483 Back     alignment and structure
>pdb|1RVU|A Chain A, E75q Mutant Of Rabbit Cytosolic Serine Hydroxymethyltransferase Length = 483 Back     alignment and structure
>pdb|1CJ0|A Chain A, Crystal Structure Of Rabbit Cytosolic Serine Hydroxymethyltransferase At 2.8 Angstrom Resolution Length = 470 Back     alignment and structure
>pdb|1RV3|A Chain A, E75l Mutant Of Rabbit Cytosolic Serine Hydroxymethyltransferase, Complex With Glycine Length = 483 Back     alignment and structure
>pdb|1EJI|A Chain A, Recombinant Serine Hydroxymethyltransferase (Mouse) Length = 478 Back     alignment and structure
>pdb|2VMV|A Chain A, Crystal Structure Of F351gbsshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|1KKJ|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From B.Stearothermophilus Length = 419 Back     alignment and structure
>pdb|2VMN|A Chain A, Crystal Structure Of N341absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|3PGY|A Chain A, Serine Hydroxymethyltransferase From Staphylococcus Aureus, S95p Mutant. Length = 415 Back     alignment and structure
>pdb|2VI8|A Chain A, Crystal Structure Of S172absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2W7D|A Chain A, Crystal Structure Of Y51fbsshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|1YJS|A Chain A, K226q Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Glycine Length = 419 Back     alignment and structure
>pdb|2VGS|A Chain A, Crystal Structure Of E53qbsshmt Internal Aldimine Length = 407 Back     alignment and structure
>pdb|1YJY|A Chain A, K226m Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Serine Length = 419 Back     alignment and structure
>pdb|2W7I|A Chain A, Crystal Structure Of Y61absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2VMR|A Chain A, Crystal Structure Of Y60absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|3N0L|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Campylobacter Jejuni Length = 417 Back     alignment and structure
>pdb|1DFO|A Chain A, Crystal Structure At 2.4 Angstrom Resolution Of E. Coli Serine Hydroxymethyltransferase In Complex With Glycine And 5-Formyl Tetrahydrofolate Length = 417 Back     alignment and structure
>pdb|2DKJ|A Chain A, Crystal Structure Of T.Th.Hb8 Serine Hydroxymethyltransferase Length = 407 Back     alignment and structure
>pdb|3H7F|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Mycobacterium Tuberculosis Length = 447 Back     alignment and structure
>pdb|1EQB|A Chain A, X-Ray Crystal Structure At 2.7 Angstroms Resolution Of Ternary Complex Between The Y65f Mutant Of E-Coli Serine Hydroxymethyltransferase, Glycine And 5-Formyl Tetrahydrofolate Length = 417 Back     alignment and structure
>pdb|3G8M|A Chain A, Serine Hydroxymethyltransferase Y55f Mutant Length = 417 Back     alignment and structure
>pdb|3GBX|A Chain A, Serine Hydroxymethyltransferase From Salmonella Typhimurium Length = 420 Back     alignment and structure
>pdb|3ECD|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Burkholderia Pseudomallei Length = 425 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 0.0
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 0.0
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 1e-128
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 1e-128
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 1e-127
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 1e-126
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 1e-126
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 1e-125
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 3e-04
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Length = 483 Back     alignment and structure
 Score =  586 bits (1514), Expect = 0.0
 Identities = 192/319 (60%), Positives = 238/319 (74%), Gaps = 7/319 (2%)

Query: 7   EAVYEKEKNGVTWP---KQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVM 63
            AV    ++   W    + L  PL+  D E+ DII+ E  RQ  GLELI SENF S +V+
Sbjct: 2   TAVNGAPRDAALWSSHEQMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVL 61

Query: 64  QAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWGG---SLSGSP 120
           +A+GS + NKYS GYPG RYYGG E+ID  E+LCQKRAL+A+ LDP+ WG      SGSP
Sbjct: 62  EALGSCLNNKYSLGYPGQRYYGGTEHIDELETLCQKRALQAYGLDPQCWGVNVQPYSGSP 121

Query: 121 SNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYID 180
           +NF VYTAL++PH RIM LDLP GGHL+HG+ TD KKISA SIFFE+M Y++N  TGYID
Sbjct: 122 ANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMAYKVNPDTGYID 181

Query: 181 YDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIP 240
           YD+LE++A LF PKLI+AG S Y+R  DY R+RK+ ++  A ++ADMAHISGLV AGV+P
Sbjct: 182 YDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVP 241

Query: 241 SPFEYADVVTTTTHKSLRGPRGAMIFFRKGVKEIN-KQGKEVFYDYEEKINQAVFPGLQG 299
           SPFE+  VVTTTTHK+LRG R  MIF+R+GV+ ++ K GKE+ Y+ E  IN AVFPGLQG
Sbjct: 242 SPFEHCHVVTTTTHKTLRGCRAGMIFYRRGVRSVDPKTGKEILYNLESLINSAVFPGLQG 301

Query: 300 GPHNHTITGLAVALKQVCT 318
           GPHNH I G+AVALKQ  T
Sbjct: 302 GPHNHAIAGVAVALKQAMT 320
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} SCOP: c.67.1.4 PDB: 3ou5_A Length = 490 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Length = 405 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} PDB: 1dfo_A* 3g8m_A* 1eqb_A* Length = 420 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Length = 447 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Length = 407 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Length = 425 Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} Length = 417 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
3ou5_A 490 Serine hydroxymethyltransferase, mitochondrial; st 100.0
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 100.0
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 100.0
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 100.0
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 100.0
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.98
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.97
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.97
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.97
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.94
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.94
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 99.93
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.93
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.93
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.93
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.93
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.93
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.93
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.93
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.93
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.93
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.93
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.92
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.92
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.92
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.92
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.92
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.92
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.92
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.92
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.92
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.92
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.91
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.91
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.91
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.91
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.91
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.91
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.91
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.9
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.9
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.89
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.89
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.89
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.88
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.88
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.88
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.88
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.88
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.88
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.88
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.88
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.88
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.88
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.88
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.88
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.88
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.88
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.88
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.88
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.87
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.87
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.87
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.87
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.87
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.87
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.87
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.87
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.87
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.87
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.87
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.87
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.87
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.87
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.86
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.86
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.86
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.86
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.86
3ele_A398 Amino transferase; RER070207001803, structural gen 99.86
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.86
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.86
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.86
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.86
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.86
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.86
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.86
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.86
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.86
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.86
1svv_A359 Threonine aldolase; structural genomics, structura 99.85
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.85
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.85
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.85
1o69_A 394 Aminotransferase; structural genomics, unknown fun 99.85
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.85
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.85
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.85
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.85
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.85
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.84
2fnu_A375 Aminotransferase; protein-product complex, structu 99.84
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.84
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.84
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.84
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.84
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.84
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.83
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.83
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.83
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.83
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.83
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.83
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.83
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.83
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.83
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.82
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.82
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.82
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.82
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.82
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.82
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.82
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.82
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.82
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.82
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.82
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.82
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.82
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.82
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.81
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.81
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.81
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 99.81
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.81
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.81
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.81
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.81
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.8
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.79
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.79
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.79
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.79
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.79
3rq1_A418 Aminotransferase class I and II; structural genomi 99.79
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.79
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.79
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.79
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.79
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.78
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 99.78
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.78
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.78
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.78
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 99.65
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.78
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.78
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.78
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.78
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.78
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.78
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.78
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.77
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.77
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.77
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.76
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.76
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.76
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.76
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.76
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.76
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.76
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.76
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.75
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.75
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.75
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.75
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.74
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.74
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.74
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.74
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.74
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.74
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.74
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.73
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.73
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.73
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.73
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.73
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.73
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.73
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.73
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.73
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.72
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.72
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.72
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.72
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.71
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.71
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.71
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.71
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.71
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.7
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.7
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.7
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.7
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.7
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.69
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.69
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.69
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.69
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.69
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.69
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.69
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.69
3hmu_A472 Aminotransferase, class III; structural genomics, 99.69
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.69
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.67
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.67
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.66
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.66
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.65
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.65
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.65
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.64
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.63
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.62
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.55
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.31
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.51
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.48
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.45
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.37
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.37
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.14
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.0
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.5e-45  Score=344.60  Aligned_cols=296  Identities=65%  Similarity=1.087  Sum_probs=236.7

Q ss_pred             cccccccChHHHHHHHHHHHHHHcCCeeecCCCCCcHHHHHHHHhhhhccCCCCCCCCccCCCchhHHHHHHHHHHHHHH
Q 018401           24 NAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQKRALE  103 (356)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~i~L~~~~~~~~~~V~~a~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~la~  103 (356)
                      ++.|+..||+++..+.++..+|+..|+|+++||++++.|++++...+.++|++|||+.|||+|++..+++|..++++.++
T Consensus        32 ~~~l~~~Dpei~~~i~~E~~RQ~~~ieLIASEN~~S~aV~~a~gS~ltnKYaEGyPg~RyYgGce~vD~iE~la~~rak~  111 (490)
T 3ou5_A           32 QESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALE  111 (490)
T ss_dssp             CCCHHHHCHHHHHHHHHHHHHHHHSEECCTTCCCCCHHHHHHHTSGGGTCCCCC----------CHHHHHHHHHHHHHHH
T ss_pred             ccchhhhCHHHHHHHHHHHHHHHcCceEecCCCcCCHHHHHHhcCcccccccCCCCCccccCCChHHHHHHHHHHHHHHH
Confidence            67889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCCCCcc--cc-CCCchHHHHHHHHhhcCCCCeeeecCCCCCcccCcccccccccccccceeeEEEecccCCCCCCCC
Q 018401          104 AFRLDPEKW--GG-SLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYID  180 (356)
Q Consensus       104 ~~g~~~~~v--~v-~~sgs~a~~~~l~al~~~gd~Vl~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~~~~~~~d  180 (356)
                      +||+++.+|  -| +-||+.||.+++.++++|||+|+..+..|++|+++++......+.+.|..+..++|+++++++.+|
T Consensus       112 lF~a~~A~w~VNVQP~SGs~AN~avy~All~PGD~ilg~~l~~GGHltHg~~~~~~~v~~sg~~~~~~~Y~vd~~t~~ID  191 (490)
T 3ou5_A          112 AFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLID  191 (490)
T ss_dssp             HTTCCTTTEEEECCCSSHHHHHHHHHHHHCC-CCCEECBC----------------------------CBCEETTTTEEC
T ss_pred             HhCCCccccCCCCCcCCHHHHHHHHHHHHcCCCCEEEecccCCCCcccccccCCCcccccccccccccccccCCCCCccc
Confidence            999998765  35 899999999999999999999999999999999988755444566778888889999998888999


Q ss_pred             HHHHHHHhhhcCCcEEEEcCCCCCCcccHHHHHHHHHHcCCEEEEeccchhhhcccCCCCCCCCCccEEEeCCCCcCCCC
Q 018401          181 YDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHKSLRGP  260 (356)
Q Consensus       181 ~~~l~~~i~~~~~k~v~l~~~n~g~~~~l~~I~~la~~~g~~vivD~a~~~g~~~~~~~~~~l~~~D~~~~s~~K~l~gp  260 (356)
                      +|++++...+++||+|+++.|.++...|++++++||++.|+++++|.||.+|++..++.++|+.++|++++++||+|.||
T Consensus       192 yd~~~~~A~~~kPklIi~G~SaY~r~id~~~~reIAd~vGA~Lm~DmAHiaGLVA~g~~psP~~~ADvVTtTTHKTLrGP  271 (490)
T 3ou5_A          192 YNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGA  271 (490)
T ss_dssp             HHHHHHHHHHHCCSEEEECCSSCCSCCCHHHHHHHHHHHTCEEEEECGGGHHHHHTTSSCCGGGTCSEEEEESSSTTCSC
T ss_pred             HHHHHHHHhhcCCCeEEECCccCccccCHHHHHHHHhhcccEEEechhhhhhhhcccccCCccccceEEeccccccccCC
Confidence            99999999888999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceEEEEecCcchh-ccCCcchhhhHHHhhccccCCCCCCCCcHHHHHHHHHHHHHHhcc
Q 018401          261 RGAMIFFRKGVKEI-NKQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTL  319 (356)
Q Consensus       261 ~gG~l~~~~~~~~~-~~~g~~~~~~~~~~~~~~~~~~~~gt~~~~~~~al~~Al~~~~~~  319 (356)
                      +||+|+++++.... ...|....+++.++++...||+.+|.|..+.++|++.|+.+...+
T Consensus       272 rGG~Il~~~~~~~~~~k~~~~~~~~~~kkin~aVFPg~qggp~~h~IAAkAVaf~Ea~~p  331 (490)
T 3ou5_A          272 RSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTP  331 (490)
T ss_dssp             SCEEEEEECSEEEECC--CCEEECCCHHHHHHHHTTTTCSSCCHHHHHHHHHHHHHHHSH
T ss_pred             CceEEEeccccccccccccchhHHHHHHHHHhhcCccccccchHHHHHHHHHHHHHHHhH
Confidence            99999999865332 223333344678899999999999999999999999999998765
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 356
d1rv3a_ 470 c.67.1.4 (A:) Serine hydroxymethyltransferase {Rab 1e-120
d2a7va1 463 c.67.1.4 (A:26-488) Serine hydroxymethyltransferas 1e-109
d1kl1a_405 c.67.1.4 (A:) Serine hydroxymethyltransferase {Bac 1e-104
d1dfoa_416 c.67.1.4 (A:) Serine hydroxymethyltransferase {Esc 1e-102
d1c4ka2 462 c.67.1.5 (A:108-569) Ornithine decarboxylase major 3e-26
d2v1pa1 467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 2e-25
d1ax4a_ 465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 9e-18
d1c7ga_ 456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 1e-15
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 2e-04
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 470 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Serine hydroxymethyltransferase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  352 bits (905), Expect = e-120
 Identities = 189/305 (61%), Positives = 234/305 (76%), Gaps = 4/305 (1%)

Query: 18  TWPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEG 77
           +  + L  PL+  D E+ DII+ E  RQ  GLELI SENF S +V++A+GS + NKYS G
Sbjct: 3   SHEQMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSLG 62

Query: 78  YPGARYYGGNEYIDMAESLCQKRALEAFRLDPEKWG---GSLSGSPSNFQVYTALLKPHD 134
           YPG RYYGG E+ID  E+LCQKRAL+A+ LDP+ WG      SGSP+NF VYTAL++PH 
Sbjct: 63  YPGQRYYGGTEHIDELETLCQKRALQAYGLDPQCWGVNVQPYSGSPANFAVYTALVEPHG 122

Query: 135 RIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNESTGYIDYDQLEKSATLFRPK 194
           RIM LDLP GGHL+HG+ TD KKISA SIFFE+M Y++N  TGYIDYD+LE++A LF PK
Sbjct: 123 RIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPK 182

Query: 195 LIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTH 254
           LI+AG S Y+R  DY R+RK+ ++  A ++ADMAHISGLV AGV+PSPFE+  VVTTTTH
Sbjct: 183 LIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTH 242

Query: 255 KSLRGPRGAMIFFRKGVKEIN-KQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVAL 313
           K+LRG R  MIF+R+GV+ ++ K GKE+ Y+ E  IN AVFPGLQGGPHNH I G+AVAL
Sbjct: 243 KTLRGCRAGMIFYRRGVRSVDPKTGKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVAL 302

Query: 314 KQVCT 318
           KQ  T
Sbjct: 303 KQAMT 307
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 405 Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d1rv3a_ 470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 100.0
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 100.0
d2a7va1 463 Serine hydroxymethyltransferase {Human (Homo sapie 100.0
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.96
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.95
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.95
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.94
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.94
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.93
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.92
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.92
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.91
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.9
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.89
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.89
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.88
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.88
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.87
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.86
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.85
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.84
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.83
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.83
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.81
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.8
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.8
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.8
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.8
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.79
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.79
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.77
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.76
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.76
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.76
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 99.76
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.76
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.75
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.74
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.73
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.72
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.71
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.71
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.69
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.68
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.67
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.66
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.66
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.66
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.66
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.65
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.64
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.64
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.62
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.61
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.6
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.59
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.58
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.55
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.55
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.55
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.53
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.53
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.52
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.52
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.51
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.51
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.49
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.47
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.46
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.45
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.45
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.43
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.37
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.35
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.32
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.28
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.28
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.26
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.24
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.15
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.11
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.11
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 98.89
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.71
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.19
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Serine hydroxymethyltransferase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

Probab=100.00  E-value=2.6e-43  Score=331.60  Aligned_cols=301  Identities=62%  Similarity=1.022  Sum_probs=270.5

Q ss_pred             chhhhcccccccChHHHHHHHHHHHHHHcCCeeecCCCCCcHHHHHHHHhhhhccCCCCCCCCccCCCchhHHHHHHHHH
Q 018401           19 WPKQLNAPLEVVDPEIADIIEHEKARQWKGLELIPSENFTSVSVMQAVGSVMTNKYSEGYPGARYYGGNEYIDMAESLCQ   98 (356)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~L~~~~~~~~~~V~~a~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~   98 (356)
                      ..+|+++.++..|+++++.+.++.++|+..|+|+++||++|+.|++++...+.++|++|||+.|||+|++..+++|..+.
T Consensus         4 ~~~~~~~~l~~~D~ei~~~i~~e~~rq~~~l~LIaSEN~~S~~v~~algS~l~nkYaeG~pg~Ryy~G~~~iD~iE~la~   83 (470)
T d1rv3a_           4 HEQMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSLGYPGQRYYGGTEHIDELETLCQ   83 (470)
T ss_dssp             HHHHTTSCHHHHCHHHHHHHHHHHHHHHSSEECCTTCCCCCHHHHHHHTSGGGTCCCCEETTEESSSCCHHHHHHHHHHH
T ss_pred             hHHHHhhhHhhhCHHHHHHHHHHHHHHHcCceEecCCCcCCHHHHHHhcchhcccccCCCCCccccCCchhHHHHHHHHH
Confidence            45678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCCCCc--ccc-CCCchHHHHHHHHhhcCCCCeeeecCCCCCcccCcccccccccccccceeeEEEecccCCC
Q 018401           99 KRALEAFRLDPEK--WGG-SLSGSPSNFQVYTALLKPHDRIMALDLPHGGHLSHGYQTDTKKISAVSIFFETMPYRLNES  175 (356)
Q Consensus        99 ~~la~~~g~~~~~--v~v-~~sgs~a~~~~l~al~~~gd~Vl~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~~~  175 (356)
                      ++..++||++++.  +-| +.||+.||.+++.++++|||+|+..++.+++|++.++......+...+..++.++++++++
T Consensus        84 ~ra~~lF~~~~~~~~anVqp~SGs~An~av~~all~pgD~im~~~l~~GGHlshg~~~~~~~~~~~~~~~~~~~y~v~~~  163 (470)
T d1rv3a_          84 KRALQAYGLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMAYKVNPD  163 (470)
T ss_dssp             HHHHHHTTCCTTTEEEECCCSSHHHHHHHHHHHHTCTTCEEEEECGGGTCCGGGCCBCSSCBCSHHHHHSEEEEECBCTT
T ss_pred             HHHHHHhCCChhhccccccccCCccHHHHHHHHhcCCCCeEeeeccccCCcccccccccCCCcccccceeEeeEEEEecc
Confidence            9999999997543  335 8899999999999999999999999999999999987665556666777788888899978


Q ss_pred             CCCCCHHHHHHHhhhcCCcEEEEcCCCCCCcccHHHHHHHHHHcCCEEEEeccchhhhcccCCCCCCCCCccEEEeCCCC
Q 018401          176 TGYIDYDQLEKSATLFRPKLIVAGASAYARLYDYERIRKVCNKQKAIMLADMAHISGLVAAGVIPSPFEYADVVTTTTHK  255 (356)
Q Consensus       176 ~~~~d~~~l~~~i~~~~~k~v~l~~~n~g~~~~l~~I~~la~~~g~~vivD~a~~~g~~~~~~~~~~l~~~D~~~~s~~K  255 (356)
                      ++.+|++++++...+.+||+|+++.|.++...|++++.++|++.|+++++|.+|.+|.+..++.++|+.++|++++|+||
T Consensus       164 ~~~IDyd~l~~~a~~~kPklIi~G~S~y~r~~d~~~~reIad~vga~l~~D~aH~aGLIA~g~~~sPl~~aDvvt~tTHK  243 (470)
T d1rv3a_         164 TGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHK  243 (470)
T ss_dssp             TCSBCHHHHHHHHHHHCCSEEEECCSSCCSCCCHHHHHHHHHHTTCEEEEECTTTHHHHHHTSSCCGGGTCSEEEEESSG
T ss_pred             cCcccHHHHHHHHHhhCcceEeechhhccccCCHHHHHHHHhccCCeEEecchhhhhhccccccCChhheeeeeeeehhh
Confidence            88999999999998889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCceEEEEecCcchhc-cCCcchhhhHHHhhccccCCCCCCCCcHHHHHHHHHHHHHHhcc
Q 018401          256 SLRGPRGAMIFFRKGVKEIN-KQGKEVFYDYEEKINQAVFPGLQGGPHNHTITGLAVALKQVCTL  319 (356)
Q Consensus       256 ~l~gp~gG~l~~~~~~~~~~-~~g~~~~~~~~~~~~~~~~~~~~gt~~~~~~~al~~Al~~~~~~  319 (356)
                      +|.||+||+|+++++..... ..|....+++.++++...+|+.+|.|..+.++|++.|+.++..+
T Consensus       244 tlrGPrgGiI~~~~~~~~~~~~~~~~~~~~~~~~i~~avFPg~qggph~~~IAa~Ava~~ea~~~  308 (470)
T d1rv3a_         244 TLRGCRAGMIFYRRGVRSVDPKTGKEILYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTP  308 (470)
T ss_dssp             GGCCCSCEEEEEECSBCC-------CCBCCHHHHHHHHHTTTTCCSCCHHHHHHHHHHHHHHTSH
T ss_pred             hccCCcceEEEEccccccccccccchhHHHHHHHHhhhcCccccccchhhHHHHHHHHHHHhcCh
Confidence            99999999999998653331 22333334688899999999999999999999999999998764
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure