Citrus Sinensis ID: 018521

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV
cHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccc
cHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccc
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDhmlsddvplVVSRQLLQTFAQELGRLEPETQKEIANYTLaqiqprvvsFEEQVLIIREKLADLYESEQQWSKAAQMLSgidldsgmrviddtfRLSKCVQIARLyledddavNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQiqkrqigdetIDEEALEQALSAAVTCTILAAAGPQRSRVLATLykdercsklkiyPILQKVYLERILRKPEIDAFAEELKphqkallpdnftVLDRAMIEHNLLSASKLYtnisfeelgtllgiapQKAEKIASRMIFEDrmrgsidqv
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYtlaqiqprvvSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLAtlykdercsklkiypilqKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASrmifedrmrgsidqv
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV
******************EQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKI*****************
***ALA*************QYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDS*****DDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV
************DQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV
*****ASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query354 2.2.26 [Sep-21-2011]
Q8L5U0397 COP9 signalosome complex yes no 0.997 0.889 0.861 1e-178
Q68FS2406 COP9 signalosome complex yes no 0.926 0.807 0.532 5e-93
O88544406 COP9 signalosome complex yes no 0.926 0.807 0.535 7e-93
Q3SZA0406 COP9 signalosome complex yes no 0.926 0.807 0.538 7e-93
A7Y521406 COP9 signalosome complex yes no 0.926 0.807 0.538 8e-93
Q4R5E6406 COP9 signalosome complex N/A no 0.926 0.807 0.538 8e-93
Q9BT78406 COP9 signalosome complex yes no 0.926 0.807 0.538 8e-93
Q5R648406 COP9 signalosome complex yes no 0.926 0.807 0.535 1e-92
Q6P0H6406 COP9 signalosome complex yes no 0.926 0.807 0.529 2e-92
Q54B82393 COP9 signalosome complex yes no 0.977 0.880 0.494 1e-91
>sp|Q8L5U0|CSN4_ARATH COP9 signalosome complex subunit 4 OS=Arabidopsis thaliana GN=CSN4 PE=1 SV=2 Back     alignment and function desciption
 Score =  625 bits (1613), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 304/353 (86%), Positives = 330/353 (93%)

Query: 1   MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQT 60
           M+ AL +ASAI DQRQKIEQYK ILSSV+SSND++QA++FIDH+LSDDVPLVVSRQLLQ+
Sbjct: 1   MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQS 60

Query: 61  FAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLS 120
           FAQELGRLEPETQKEIA +TL QIQPRVVSFEEQ L+IREKLA LYESEQ+WSKAAQMLS
Sbjct: 61  FAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLS 120

Query: 121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYK 180
           GIDLDSGMR +DD F+LSKC+QIARLYLEDDDAVNAEAFINKASFLVS+SQ EVLNLQYK
Sbjct: 121 GIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYK 180

Query: 181 VCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240
           VCYARILD+KRKFLEAALRYY ISQI++RQIGDE IDE ALEQALSAAVTCTILA AGPQ
Sbjct: 181 VCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQ 240

Query: 241 RSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLD 300
           RSRVLATLYKDERCSKLKIYPILQKVYLERILR+PEIDAF+EEL+PHQKA LPD  TVLD
Sbjct: 241 RSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLD 300

Query: 301 RAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQ 353
           RAMIEHNLLSASKLYTNI F+ELGTLL I P+KAEKIA+ MI +DRMRGSIDQ
Sbjct: 301 RAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQ 353
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q68FS2|CSN4_RAT COP9 signalosome complex subunit 4 OS=Rattus norvegicus GN=Cops4 PE=2 SV=1 Back     alignment and function description
>sp|O88544|CSN4_MOUSE COP9 signalosome complex subunit 4 OS=Mus musculus GN=Cops4 PE=1 SV=1 Back     alignment and function description
>sp|Q3SZA0|CSN4_BOVIN COP9 signalosome complex subunit 4 OS=Bos taurus GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|A7Y521|CSN4_PIG COP9 signalosome complex subunit 4 OS=Sus scrofa GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|Q4R5E6|CSN4_MACFA COP9 signalosome complex subunit 4 OS=Macaca fascicularis GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BT78|CSN4_HUMAN COP9 signalosome complex subunit 4 OS=Homo sapiens GN=COPS4 PE=1 SV=1 Back     alignment and function description
>sp|Q5R648|CSN4_PONAB COP9 signalosome complex subunit 4 OS=Pongo abelii GN=COPS4 PE=2 SV=1 Back     alignment and function description
>sp|Q6P0H6|CSN4_DANRE COP9 signalosome complex subunit 4 OS=Danio rerio GN=cops4 PE=2 SV=1 Back     alignment and function description
>sp|Q54B82|CSN4_DICDI COP9 signalosome complex subunit 4 OS=Dictyostelium discoideum GN=csn4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
255538588397 cop9 complex subunit, putative [Ricinus 1.0 0.891 0.957 0.0
224129434397 predicted protein [Populus trichocarpa] 1.0 0.891 0.951 0.0
118483400397 unknown [Populus trichocarpa] 1.0 0.891 0.937 0.0
356531693397 PREDICTED: COP9 signalosome complex subu 1.0 0.891 0.932 0.0
356541824397 PREDICTED: COP9 signalosome complex subu 1.0 0.891 0.932 0.0
217073438392 unknown [Medicago truncatula] 1.0 0.903 0.918 0.0
225458329397 PREDICTED: COP9 signalosome complex subu 0.966 0.861 0.941 0.0
147780809397 hypothetical protein VITISV_036371 [Viti 0.966 0.861 0.941 0.0
449460112397 PREDICTED: COP9 signalosome complex subu 1.0 0.891 0.923 0.0
33324486399 COP8-like protein [Lilium longiflorum] 1.0 0.887 0.873 1e-178
>gi|255538588|ref|XP_002510359.1| cop9 complex subunit, putative [Ricinus communis] gi|223551060|gb|EEF52546.1| cop9 complex subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/354 (95%), Positives = 348/354 (98%)

Query: 1   MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQT 60
           MESA ASASAITDQRQKIEQYKHIL+SVISSNDI QAKKFIDHMLSDDVPLVVSRQLLQ+
Sbjct: 1   MESAFASASAITDQRQKIEQYKHILASVISSNDIDQAKKFIDHMLSDDVPLVVSRQLLQS 60

Query: 61  FAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLS 120
           FAQELGRLEP+TQKEIA+YTLAQIQPRVVSFEEQVLIIREKLA+LYESEQQWSKAAQMLS
Sbjct: 61  FAQELGRLEPDTQKEIAHYTLAQIQPRVVSFEEQVLIIREKLAELYESEQQWSKAAQMLS 120

Query: 121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYK 180
           GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVS+SQ EVLNLQYK
Sbjct: 121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSNSQHEVLNLQYK 180

Query: 181 VCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240
           VCYARILDLKRKFLEAALRYYDISQI+KRQIGDETIDEEALEQALSAAVTCTILAAAGPQ
Sbjct: 181 VCYARILDLKRKFLEAALRYYDISQIEKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240

Query: 241 RSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLD 300
           RSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELK HQKALLPDNFTVLD
Sbjct: 241 RSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKAHQKALLPDNFTVLD 300

Query: 301 RAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV 354
           RAMIEHNLLSASKLYTNISF+ELGTLLGI P KAEKIASRMI+EDRMRGSIDQV
Sbjct: 301 RAMIEHNLLSASKLYTNISFDELGTLLGIPPHKAEKIASRMIYEDRMRGSIDQV 354

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224129434|ref|XP_002320585.1| predicted protein [Populus trichocarpa] gi|222861358|gb|EEE98900.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118483400|gb|ABK93600.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356531693|ref|XP_003534411.1| PREDICTED: COP9 signalosome complex subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356541824|ref|XP_003539372.1| PREDICTED: COP9 signalosome complex subunit 4-like [Glycine max] Back     alignment and taxonomy information
>gi|217073438|gb|ACJ85078.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225458329|ref|XP_002283011.1| PREDICTED: COP9 signalosome complex subunit 4 [Vitis vinifera] gi|302142470|emb|CBI19673.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147780809|emb|CAN77214.1| hypothetical protein VITISV_036371 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449460112|ref|XP_004147790.1| PREDICTED: COP9 signalosome complex subunit 4-like [Cucumis sativus] gi|449476780|ref|XP_004154832.1| PREDICTED: COP9 signalosome complex subunit 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|33324486|gb|AAQ07984.1| COP8-like protein [Lilium longiflorum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
TAIR|locus:2159961397 COP8 "AT5G42970" [Arabidopsis 0.997 0.889 0.861 8.9e-157
RGD|1302952406 Cops4 "COP9 signalosome subuni 0.926 0.807 0.535 3e-85
UNIPROTKB|Q3SZA0406 COPS4 "COP9 signalosome comple 0.926 0.807 0.541 4.9e-85
MGI|MGI:1349414406 Cops4 "COP9 (constitutive phot 0.926 0.807 0.538 4.9e-85
ZFIN|ZDB-GENE-030131-4317406 cops4 "COP9 constitutive photo 0.926 0.807 0.532 4.9e-85
UNIPROTKB|E2RT55406 COPS4 "Uncharacterized protein 0.926 0.807 0.541 6.2e-85
UNIPROTKB|D6RAX7420 COPS4 "COP9 signalosome comple 0.926 0.780 0.541 6.2e-85
UNIPROTKB|Q9BT78406 COPS4 "COP9 signalosome comple 0.926 0.807 0.541 6.2e-85
UNIPROTKB|A7Y521406 COPS4 "COP9 signalosome comple 0.926 0.807 0.541 6.2e-85
UNIPROTKB|Q5ZJV0411 COPS4 "Uncharacterized protein 0.926 0.798 0.538 1e-84
TAIR|locus:2159961 COP8 "AT5G42970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1528 (542.9 bits), Expect = 8.9e-157, P = 8.9e-157
 Identities = 304/353 (86%), Positives = 330/353 (93%)

Query:     1 MESALASASAITDQRQKIEQYKHILSSVISSNDIVQAKKFIDHMLSDDVPLVVSRQLLQT 60
             M+ AL +ASAI DQRQKIEQYK ILSSV+SSND++QA++FIDH+LSDDVPLVVSRQLLQ+
Sbjct:     1 MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQS 60

Query:    61 FAQELGRLEPETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLS 120
             FAQELGRLEPETQKEIA +TL QIQPRVVSFEEQ L+IREKLA LYESEQ+WSKAAQMLS
Sbjct:    61 FAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLS 120

Query:   121 GIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSSSQQEVLNLQYK 180
             GIDLDSGMR +DD F+LSKC+QIARLYLEDDDAVNAEAFINKASFLVS+SQ EVLNLQYK
Sbjct:   121 GIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYK 180

Query:   181 VCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGPQ 240
             VCYARILD+KRKFLEAALRYY ISQI++RQIGDE IDE ALEQALSAAVTCTILA AGPQ
Sbjct:   181 VCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQ 240

Query:   241 RSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLD 300
             RSRVLATLYKDERCSKLKIYPILQKVYLERILR+PEIDAF+EEL+PHQKA LPD  TVLD
Sbjct:   241 RSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLD 300

Query:   301 RAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQ 353
             RAMIEHNLLSASKLYTNI F+ELGTLL I P+KAEKIA+ MI +DRMRGSIDQ
Sbjct:   301 RAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQ 353
GO:0008180 "signalosome" evidence=IDA;TAS;IPI
GO:0009640 "photomorphogenesis" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010388 "cullin deneddylation" evidence=RCA;IMP
GO:0010971 "positive regulation of G2/M transition of mitotic cell cycle" evidence=IMP
GO:0043234 "protein complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
RGD|1302952 Cops4 "COP9 signalosome subunit 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZA0 COPS4 "COP9 signalosome complex subunit 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1349414 Cops4 "COP9 (constitutive photomorphogenic) homolog, subunit 4 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4317 cops4 "COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RT55 COPS4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6RAX7 COPS4 "COP9 signalosome complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BT78 COPS4 "COP9 signalosome complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7Y521 COPS4 "COP9 signalosome complex subunit 4" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJV0 COPS4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C467CSN4_EMENINo assigned EC number0.41040.97450.8455yesno
A7Y521CSN4_PIGNo assigned EC number0.53840.92650.8078yesno
Q9V345CSN4_DROMENo assigned EC number0.48540.94350.8206yesno
Q5R648CSN4_PONABNo assigned EC number0.53550.92650.8078yesno
Q9N359CSN4_CAEELNo assigned EC number0.34170.94630.8131yesno
Q54B82CSN4_DICDINo assigned EC number0.49430.97740.8804yesno
Q3SZA0CSN4_BOVINNo assigned EC number0.53840.92650.8078yesno
O88544CSN4_MOUSENo assigned EC number0.53550.92650.8078yesno
Q68FS2CSN4_RATNo assigned EC number0.53250.92650.8078yesno
Q8L5U0CSN4_ARATHNo assigned EC number0.86110.99710.8891yesno
Q9BT78CSN4_HUMANNo assigned EC number0.53840.92650.8078yesno
Q6P0H6CSN4_DANRENo assigned EC number0.52950.92650.8078yesno
Q4R5E6CSN4_MACFANo assigned EC number0.53840.92650.8078N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
pfam01399100 pfam01399, PCI, PCI domain 1e-15
smart0075388 smart00753, PAM, PCI/PINT associated module 1e-08
smart0008888 smart00088, PINT, motif in proteasome subunits, In 1e-08
COG5071439 COG5071, RPN5, 26S proteasome regulatory complex c 0.002
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information 
 Score = 71.5 bits (176), Expect = 1e-15
 Identities = 32/92 (34%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

Query: 267 YLERILRKPEIDAFAEELKPHQKAL----LPDNFTVLDRAMIEHNLLSASKLYTNISFEE 322
            L R     ++  F E L  ++  L    L +    L R + E NL   +K Y++IS  +
Sbjct: 3   DLLRAFYSGDLSDFEEILADNEDELLDDGLAELLEDLRRKIRELNLRRLAKPYSSISLSD 62

Query: 323 LGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV 354
           L  LLG++  + EKI S++I + R+RG IDQV
Sbjct: 63  LAKLLGLSVDEVEKILSKLIRDGRIRGKIDQV 94

This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15). Length = 100
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>gnl|CDD|227403 COG5071, RPN5, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 354
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 100.0
KOG1498439 consensus 26S proteasome regulatory complex, subun 100.0
COG5071439 RPN5 26S proteasome regulatory complex component [ 100.0
KOG0687393 consensus 26S proteasome regulatory complex, subun 99.96
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 99.9
COG5187412 RPN7 26S proteasome regulatory complex component, 99.89
KOG1463411 consensus 26S proteasome regulatory complex, subun 99.82
KOG2581493 consensus 26S proteasome regulatory complex, subun 99.67
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 99.57
COG5159421 RPN6 26S proteasome regulatory complex component [ 99.48
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 99.45
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 99.36
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 99.09
smart0075388 PAM PCI/PINT associated module. 99.09
KOG2908380 consensus 26S proteasome regulatory complex, subun 98.76
KOG2582422 consensus COP9 signalosome, subunit CSN3 [Posttran 98.46
KOG2753378 consensus Uncharacterized conserved protein, conta 97.61
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 97.06
KOG2688394 consensus Transcription-associated recombination p 96.85
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.85
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.84
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.52
KOG1076843 consensus Translation initiation factor 3, subunit 95.88
KOG2758432 consensus Translation initiation factor 3, subunit 95.62
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.6
COG5600413 Transcription-associated recombination protein [DN 95.59
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 95.18
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 95.06
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.98
KOG2072 988 consensus Translation initiation factor 3, subunit 94.83
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 94.82
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 94.48
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.26
PLN03218 1060 maturation of RBCL 1; Provisional 93.79
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 93.74
KOG2076 895 consensus RNA polymerase III transcription factor 93.45
PF04348 536 LppC: LppC putative lipoprotein; InterPro: IPR0074 93.05
PRK11788389 tetratricopeptide repeat protein; Provisional 92.72
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 92.52
PRK02603172 photosystem I assembly protein Ycf3; Provisional 92.47
TIGR02552135 LcrH_SycD type III secretion low calcium response 92.46
KOG1585308 consensus Protein required for fusion of vesicles 92.19
PRK11788389 tetratricopeptide repeat protein; Provisional 92.0
KOG2003840 consensus TPR repeat-containing protein [General f 91.67
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.6
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 91.36
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 91.11
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 91.08
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 90.76
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 90.73
CHL00033168 ycf3 photosystem I assembly protein Ycf3 90.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 90.38
COG3107 604 LppC Putative lipoprotein [General function predic 90.28
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 90.0
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 88.9
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 88.81
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 88.38
PRK14574 822 hmsH outer membrane protein; Provisional 88.19
PRK10370198 formate-dependent nitrite reductase complex subuni 87.82
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 87.59
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 87.33
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 87.31
PLN03218 1060 maturation of RBCL 1; Provisional 87.0
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 86.87
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 86.61
KOG2003840 consensus TPR repeat-containing protein [General f 86.56
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 86.51
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 86.38
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.35
cd05804355 StaR_like StaR_like; a well-conserved protein foun 86.26
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 86.08
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 85.68
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 84.96
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 84.61
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 84.5
PLN03077857 Protein ECB2; Provisional 84.21
KOG2076 895 consensus RNA polymerase III transcription factor 83.45
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 83.19
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 83.03
KOG1861540 consensus Leucine permease transcriptional regulat 82.43
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.3
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 82.3
PRK11189296 lipoprotein NlpI; Provisional 82.28
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 82.11
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 81.33
PRK10803263 tol-pal system protein YbgF; Provisional 81.08
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 81.03
PRK1543178 ferrous iron transport protein FeoC; Provisional 80.6
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 80.6
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 80.57
PF03399204 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I 80.44
PF1337173 TPR_9: Tetratricopeptide repeat 80.19
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=4.2e-81  Score=585.71  Aligned_cols=345  Identities=57%  Similarity=0.882  Sum_probs=335.0

Q ss_pred             HHHHhhhhccchhHhHHHHHHHHHHhhcCC--C-HHHHHHHHHHHhcCCCchhhhHHHHHHHHHHhcCCChHHHHHHHHH
Q 018521            3 SALASASAITDQRQKIEQYKHILSSVISSN--D-IVQAKKFIDHMLSDDVPLVVSRQLLQTFAQELGRLEPETQKEIANY   79 (354)
Q Consensus         3 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~--~-~~~l~~~~~~~~~~~~~~v~sr~~l~~~~~~l~~l~~~~~~~~~~~   79 (354)
                      ..+.-+-+.+|||++.++|+.+|+..++++  + .+.++.||+++++++|++|+|||+++.|...|+.+|++.+|++.++
T Consensus         7 eev~~~~~~g~hk~~~~qyr~~l~~~lt~~~~el~e~~k~~id~~~~~~vslvvsrqllsl~~~~l~~l~~e~~Kei~~~   86 (399)
T KOG1497|consen    7 EEVVLIFAEGDHKDQAEQYRQLLAKVLTNNGMELLEALKRFIDAIVNENVSLVVSRQLLSLFDVELSILEDELRKEISHF   86 (399)
T ss_pred             HHHHHHHhcCchhhHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHcCCchhhhHHHHHHHHHHHhccCCHHHHHHHHHH
Confidence            345556777899999999999999999877  4 4899999999999999999999999999999999999999999999


Q ss_pred             HHHhhccccchHHHHHHHHHHHHHHHHHHccCHHHHHHHhcccccccCCccCChhHHHHHHHHHHHHhhccCCHHHHHHH
Q 018521           80 TLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDDTFRLSKCVQIARLYLEDDDAVNAEAF  159 (354)
Q Consensus        80 ~l~~i~~~~i~~E~e~a~l~~~LA~i~E~~gd~~eAa~iL~~i~vEt~~~~~~~~eKle~~l~i~rL~L~~~D~~~a~~~  159 (354)
                      ||..|+||.||||+|++.+|.+||.+||++++|+.||.+|.+|+++||++..+.+.|+..|+++.|+||+++|.+.|+.|
T Consensus        87 ~l~~iq~rvisfeEqv~~irl~LAsiYE~Eq~~~~aaq~L~~I~~~tg~~~~d~~~kl~l~iriarlyLe~~d~veae~~  166 (399)
T KOG1497|consen   87 TLEKIQPRVISFEEQVASIRLHLASIYEKEQNWRDAAQVLVGIPLDTGQKAYDVEQKLLLCIRIARLYLEDDDKVEAEAY  166 (399)
T ss_pred             HHHhcccccccHHHHHHHHHHHHHHHHHHhhhHHHHHHHHhccCcccchhhhhhHHHHHHHHHHHHHHHhcCcHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhchhcCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCcCCCHHHHHHHHHHHHHHHHhcCCCc
Q 018521          160 INKASFLVSSSQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIGDETIDEEALEQALSAAVTCTILAAAGP  239 (354)
Q Consensus       160 ~~Ka~~~~~~~~~~~lkl~y~~~~~r~~~~~r~fleAa~~y~e~~~t~~~~~~~~~~d~~e~~~~L~~av~~~ILa~~~~  239 (354)
                      +||++.++.+..++++++.|+.|+||++|.+|+|+|||+|||+++.+.       .+|+.+++++|+.|+.|++||.+||
T Consensus       167 inRaSil~a~~~Ne~Lqie~kvc~ARvlD~krkFlEAAqrYyels~~k-------i~~e~~~~~aL~~a~~CtlLA~~gp  239 (399)
T KOG1497|consen  167 INRASILQAESSNEQLQIEYKVCYARVLDYKRKFLEAAQRYYELSQRK-------IVDESERLEALKKALQCTLLASAGP  239 (399)
T ss_pred             HHHHHHhhhcccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------hcchHHHHHHHHHhHhheeecCCCh
Confidence            999999998889999999999999999999999999999999999985       4799999999999999999999999


Q ss_pred             chHHHHHhhhhccccccccchHHHHHHHHHHhcChhhHHHHHHhhchhhhccCCCcHHHHHHHHHHHHHHHHhhcccccc
Q 018521          240 QRSRVLATLYKDERCSKLKIYPILQKVYLERILRKPEIDAFAEELKPHQKALLPDNFTVLDRAMIEHNLLSASKLYTNIS  319 (354)
Q Consensus       240 ~rs~lL~~l~kd~r~~~lp~~~~L~k~f~~~li~~~~i~~f~~~L~~h~~~~~~dg~~~L~~~viEHNi~~isk~Y~~It  319 (354)
                      +|||+|+.+++||||+++|.|..+.|||++++|+.+++++|+..|.|||++.++||.++|+|+|+||||+++|++|+|||
T Consensus       240 qrsr~Latlfkder~~~l~~y~ileKmyl~riI~k~el~ef~~~L~pHQka~~~dgssil~ra~~EhNlls~Skly~nis  319 (399)
T KOG1497|consen  240 QRSRMLATLFKDERCQKLPAYGILEKMYLERIIRKEELQEFEAFLQPHQKAHTMDGSSILDRAVIEHNLLSASKLYNNIS  319 (399)
T ss_pred             HHHHHHHHHhcCcccccccchHHHHHHHHHHHhcchhHHHHHHHhcchhhhcccCcchhhhhHHHHHhHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCChHHHHHHHHhhHhcCCeeEecCCC
Q 018521          320 FEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV  354 (354)
Q Consensus       320 l~~La~LL~ls~~eaE~~ls~MI~~grl~akIDqv  354 (354)
                      |+.||.+|++|++++|+++++||.+||++|.|||+
T Consensus       320 f~~Lg~ll~i~~ekaekiaa~MI~qeRmng~IDQ~  354 (399)
T KOG1497|consen  320 FEELGALLKIDAEKAEKIAAQMITQERMNGSIDQI  354 (399)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHhHHHhccchHhh
Confidence            99999999999999999999999999999999995

>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3107 LppC Putative lipoprotein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1861 consensus Leucine permease transcriptional regulator [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
1ufm_A84 Solution Structure Of The Pci Domain Length = 84 3e-17
>pdb|1UFM|A Chain A, Solution Structure Of The Pci Domain Length = 84 Back     alignment and structure 
Iteration: 1

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/57 (73%), Positives = 47/57 (82%)
Query: 298 VLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV 354
           +LDRA+IEHNLLSASKLY NI+FEELG LL I   KAEKIAS+MI E RM G IDQ+
Sbjct: 11  ILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQI 67

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 1e-20
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 3e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84 Back     alignment and structure
 Score = 84.1 bits (208), Expect = 1e-20
 Identities = 42/61 (68%), Positives = 48/61 (78%)

Query: 294 DNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQ 353
              ++LDRA+IEHNLLSASKLY NI+FEELG LL I   KAEKIAS+MI E RM G IDQ
Sbjct: 7   GGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQ 66

Query: 354 V 354
           +
Sbjct: 67  I 67
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 100.0
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 100.0
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 100.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.96
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 99.87
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 99.86
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 99.75
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 99.43
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 99.25
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 98.22
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.33
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 97.29
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.17
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.97
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.93
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.86
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.8
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.73
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.64
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.63
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.57
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.46
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.41
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.41
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.39
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.32
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.32
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.27
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.26
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.17
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.15
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.1
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 95.91
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 95.84
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 95.79
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.75
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 95.74
3q15_A378 PSP28, response regulator aspartate phosphatase H; 95.73
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 95.72
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 95.7
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 95.66
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.61
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.52
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.49
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.46
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 95.42
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 95.41
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.36
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 95.21
3q15_A378 PSP28, response regulator aspartate phosphatase H; 95.2
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.19
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 95.12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 95.08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.08
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.03
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 94.99
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 94.96
3q49_B137 STIP1 homology and U box-containing protein 1; E3 94.72
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 94.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 94.51
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 94.47
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 94.42
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 94.37
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.33
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.28
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 94.26
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 94.04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 94.03
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 94.01
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 93.85
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 93.75
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 93.75
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 93.73
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 93.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 93.5
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 93.37
3k9i_A117 BH0479 protein; putative protein binding protein, 93.35
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 93.22
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.18
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 93.16
4i17_A228 Hypothetical protein; TPR repeats protein, structu 93.07
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 92.9
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 92.89
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 92.88
3u4t_A272 TPR repeat-containing protein; structural genomics 92.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 92.79
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 92.76
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 92.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 92.37
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 92.33
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 92.18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 92.02
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 91.83
2gw1_A 514 Mitochondrial precursor proteins import receptor; 91.81
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 91.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 91.71
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 91.66
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 91.66
4eqf_A365 PEX5-related protein; accessory protein, tetratric 91.58
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 91.53
2gw1_A514 Mitochondrial precursor proteins import receptor; 91.37
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 91.34
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 91.34
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 91.24
3u4t_A272 TPR repeat-containing protein; structural genomics 91.16
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 91.1
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.01
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 90.81
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 90.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 90.61
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 90.58
3qww_A433 SET and MYND domain-containing protein 2; methyltr 90.4
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 90.26
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 90.24
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 89.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 89.9
2kat_A115 Uncharacterized protein; NESG, structure, structur 89.88
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 89.84
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 89.82
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 89.78
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 89.75
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 89.51
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 89.47
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 88.96
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 88.84
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 88.83
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 88.56
1rz4_A226 Eukaryotic translation initiation factor 3 subuni; 88.55
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 88.48
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 88.4
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 88.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 88.34
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 88.11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 87.96
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 87.9
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 87.51
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 87.4
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 87.37
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 87.21
3qww_A433 SET and MYND domain-containing protein 2; methyltr 87.1
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 87.01
4b4t_T274 26S proteasome regulatory subunit RPN12; hydrolase 86.79
4g1t_A 472 Interferon-induced protein with tetratricopeptide 86.47
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 85.85
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 85.78
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 85.69
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 85.53
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 85.28
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 85.24
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 85.12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 84.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 84.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 84.81
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 84.59
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 84.56
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 84.1
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 83.91
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 83.88
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 83.47
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 83.43
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 83.21
3k9i_A117 BH0479 protein; putative protein binding protein, 83.19
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 83.05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 82.93
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 82.87
4g1t_A472 Interferon-induced protein with tetratricopeptide 82.8
1qbj_A81 Protein (double-stranded RNA specific adenosine D 81.41
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 81.36
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 81.02
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 80.91
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 80.36
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=5.1e-58  Score=462.10  Aligned_cols=293  Identities=19%  Similarity=0.247  Sum_probs=271.0

Q ss_pred             HHHHHHHHHhcCCC--hHHHHHHHHHHHHhhccccchHHHHHHHHHHHHHHHHHHccCHHHHHHHhcccccccCCccCCh
Q 018521           56 QLLQTFAQELGRLE--PETQKEIANYTLAQIQPRVVSFEEQVLIIREKLADLYESEQQWSKAAQMLSGIDLDSGMRVIDD  133 (354)
Q Consensus        56 ~~l~~~~~~l~~l~--~~~~~~~~~~~l~~i~~~~i~~E~e~a~l~~~LA~i~E~~gd~~eAa~iL~~i~vEt~~~~~~~  133 (354)
                      .++..++..+++.|  +...+..++.+++.+++|+||||.||++++..||++||++|+|.+|+++|+++++||+| +|++
T Consensus        95 ~~V~~~~~~l~~~~~~d~~~~~~~i~~l~~vte~kiflE~erarl~~~La~i~e~~g~~~eA~~iL~~l~~Et~~-~~~~  173 (445)
T 4b4t_P           95 YMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYG-SMEM  173 (445)
T ss_dssp             HHHHHHHHHHHHHCTTHHHHHHHHHHCCSSSSSCCCCCCHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHCS-SSCH
T ss_pred             HHHHHHHHHHhcCCchhHHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHh-cccH
Confidence            44455556666555  34567888999999999999999999999999999999999999999999999999998 8999


Q ss_pred             hHHHHHHHHHHHHhhccCCHHHHHHHHHHhhchhcC-CchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcC
Q 018521          134 TFRLSKCVQIARLYLEDDDAVNAEAFINKASFLVSS-SQQEVLNLQYKVCYARILDLKRKFLEAALRYYDISQIQKRQIG  212 (354)
Q Consensus       134 ~eKle~~l~i~rL~L~~~D~~~a~~~~~Ka~~~~~~-~~~~~lkl~y~~~~~r~~~~~r~fleAa~~y~e~~~t~~~~~~  212 (354)
                      .+|+++|++|+|+|++.+||++|+++++||+...+. .++|+++++|+.|+|++++++++|++||++|+++|.++.+   
T Consensus       174 ~~kve~~l~q~rl~l~~~d~~~a~~~~~ki~~~~~~~~~~~~lk~~~~~~~~~~~~~e~~y~~a~~~y~e~~~~~~~---  250 (445)
T 4b4t_P          174 SEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAI---  250 (445)
T ss_dssp             HHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH---
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhhcccCCcHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHhcccc---
Confidence            999999999999999999999999999999987765 4689999999999999999999999999999999999864   


Q ss_pred             CcCCCHHHHHHHHHHHHHHHHhcCCCcchHHHHHhhhhccccccccchHHHHHHHHH-HhcChhhH-HHHHHhhchhhhc
Q 018521          213 DETIDEEALEQALSAAVTCTILAAAGPQRSRVLATLYKDERCSKLKIYPILQKVYLE-RILRKPEI-DAFAEELKPHQKA  290 (354)
Q Consensus       213 ~~~~d~~e~~~~L~~av~~~ILa~~~~~rs~lL~~l~kd~r~~~lp~~~~L~k~f~~-~li~~~~i-~~f~~~L~~h~~~  290 (354)
                        ..|+..+..+|+++++|+||+|++|+|+++++++++|++++++|.|+.|.++|.+ +|++|+.+ ..|...|.+|+.+
T Consensus       251 --~~d~~~~~~~L~~~v~~~iLa~~~~~~~~ll~~~~~~~~~~~l~~~~~L~k~f~~~~L~~~~~~~~~~~~~L~~~~~~  328 (445)
T 4b4t_P          251 --KSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLA  328 (445)
T ss_dssp             --HSCHHHHHHHHHHHHHHHHHSSCSSTTHHHHHSHHHHSSCHHHHHHHHHHHHHHHCCSSSHHHHHHHTCSSTTTCCSS
T ss_pred             --cCCHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHhhcccccccHHHHHHHHHHHhchHhhhHHHHHHHHHHhcccchh
Confidence              5688889999999999999999999999999999999999999999999999997 68899875 5689999999988


Q ss_pred             cCCCc----HHHHHHHHHHHHHHHHhhccccccHHHHHHHhCCChHHHHHHHHhhHhcCCeeEecCCC
Q 018521          291 LLPDN----FTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV  354 (354)
Q Consensus       291 ~~~dg----~~~L~~~viEHNi~~isk~Y~~Itl~~La~LL~ls~~eaE~~ls~MI~~grl~akIDqv  354 (354)
                      ..+++    |+.|+++|+||||+++++||++|+|++||++||+|++++|..+++||.+|+|+|+|||+
T Consensus       329 ~~~~~~~~~~~~L~~~v~ehnl~~i~k~Ys~I~l~~la~lL~l~~~evE~~ls~mI~~g~i~akIDq~  396 (445)
T 4b4t_P          329 FGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRP  396 (445)
T ss_dssp             CCCSCSSHHHHHHHHHHHHHHHHHHHHHEEEEEHHHHHHHHTSCHHHHHHHHHHHHHHTSSCCEEETT
T ss_pred             hhcchhhHHHHHHHHHHHHHHHHHHHHHhceeeHHHHHHHhCcCHHHHHHHHHHHHHCCCEEEEEcCC
Confidence            66554    89999999999999999999999999999999999999999999999999999999996
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 354
d1ufma_84 a.4.5.47 (A:) COP9 signalosome complex subunit 4, 1e-16
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.1 bits (177), Expect = 1e-16
 Identities = 42/58 (72%), Positives = 48/58 (82%)

Query: 297 TVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV 354
           ++LDRA+IEHNLLSASKLY NI+FEELG LL I   KAEKIAS+MI E RM G IDQ+
Sbjct: 10  SILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQI 67

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 99.73
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 95.75
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.19
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.98
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 94.62
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.92
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 93.78
d1hz4a_366 Transcription factor MalT domain III {Escherichia 93.75
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.72
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 93.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.46
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 92.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 92.05
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 91.88
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 91.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 91.21
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 90.83
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 90.74
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 90.65
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 90.27
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 89.88
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 89.77
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 89.42
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 89.38
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 88.95
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 88.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 87.55
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 87.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 86.8
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 86.37
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 86.29
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 86.23
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 86.12
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 85.74
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 84.74
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 83.35
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 81.4
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.73  E-value=5.5e-19  Score=136.42  Aligned_cols=63  Identities=67%  Similarity=0.909  Sum_probs=61.1

Q ss_pred             CCCcHHHHHHHHHHHHHHHHhhccccccHHHHHHHhCCChHHHHHHHHhhHhcCCeeEecCCC
Q 018521          292 LPDNFTVLDRAMIEHNLLSASKLYTNISFEELGTLLGIAPQKAEKIASRMIFEDRMRGSIDQV  354 (354)
Q Consensus       292 ~~dg~~~L~~~viEHNi~~isk~Y~~Itl~~La~LL~ls~~eaE~~ls~MI~~grl~akIDqv  354 (354)
                      +.+|++.|+++|+||||+.++++|++|+|++||++|++|++++|..+++||.+|+|+|+|||+
T Consensus         5 ~~~~~t~L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~   67 (84)
T d1ufma_           5 SSGGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQI   67 (84)
T ss_dssp             CCCSSCCCCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETT
T ss_pred             ccchhHHHHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCC
Confidence            467899999999999999999999999999999999999999999999999999999999995
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure