Citrus Sinensis ID: 018541

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MGICASWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNSNQSLRRVAVEPSDHFFLPSSTELHSQESGSLQDERNSRSVYLPTPSISAHSVLGEFLFDVCVPKNVEGWDIRFSGSVNGQPYASARRHSPFNKFRCNLRSRL
cccHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHcccccccHHHHHHHccccEEEEEcccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHcccccEEEEcccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccEEccccc
ccHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEccccHHHHHHHHHHHcccccccccccHcHHHHHcEEEEEEccccccccccHHcHEEEcHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHcccccccccHHHcccccccccccccccccEcEEEEEEEcccccccccEcccccccccccccHcccccccccHEEEcccc
MGICASWLRMLVLLYMdlnpfpifgtqelriqtCPVVFVALSGGTKACMHKAFQIIQATCegqlnvdesRLIRSCVagqiydsspvdftsdfcarfglhptiqkipglSKLVSWVAKGVtsgldglcltrfepQRAEYWRALYnsvdlgtpfliicsdndelapQQVIYNFARHLLALggdvklvklngsphighyeyypIQYRAAITGLLEKAASVYSQRIRQLGeisgmegthDEISELICDLQNVavnsnqslrrvavepsdhfflpsstelhsqesgslqdernsrsvylptpsisahsVLGEFLFDvcvpknvegwdirfsgsvngqpyasarrhspfnkfrcnlrsrl
MGICASWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNSNQSLRRVAVEPSDHFFLPSSTELHSQESGSLQDERNSRSVYLPTPSISAHSVLGEFLFDVCVPKNVEGWDIRFSGSVNGQpyasarrhspfnkfrcnlrsrl
MGICASWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNSNQSLRRVAVEPSDHFFLPSSTELHSQESGSLQDERNSRSVYLPTPSISAHSVLGEFLFDVCVPKNVEGWDIRFSGSVNGQPYASARRHSPFNKFRCNLRSRL
**ICASWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNS********************************************PSISAHSVLGEFLFDVCVPKNVEGWDIRFSGSVN************************
*****SWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASV********************************************EPSDHFFL********************************HSVLGEFLFDVCVPKNVEGWDIR******************FNKFRCNLRSR*
MGICASWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNSNQSLRRVAVEPSDHFFLPSS*****************RSVYLPTPSISAHSVLGEFLFDVCVPKNVEGWDIRFSGSVNGQPYASARRHSPFNKFRCNLRSRL
*GICASWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEI*******DEISELICDLQNVAV*****L*RVAVEPSDHFFLPS******************RSVYLPTPSISAHSVLGEFLFDVCVPKNVEGWDIRFSGS*****YAS**RHSPFNK**CNL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGICASWLRMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNSNQSLRRVAVEPSDHFFLPSSTELHSQESGSLQDERNSRSVYLPTPSISAHSVLGEFLFDVCVPKNVEGWDIRFSGSVNGQPYASARRHSPFNKFRCNLRSRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
224123330408 predicted protein [Populus trichocarpa] 0.966 0.838 0.676 1e-134
224103577406 predicted protein [Populus trichocarpa] 0.966 0.842 0.656 1e-130
255555495401 conserved hypothetical protein [Ricinus 0.949 0.837 0.646 1e-124
225428776407 PREDICTED: uncharacterized protein LOC10 0.926 0.805 0.667 1e-124
147797958387 hypothetical protein VITISV_015639 [Viti 0.870 0.795 0.640 1e-114
363806692412 uncharacterized protein LOC100798622 [Gl 0.926 0.796 0.609 1e-112
297836186420 hypothetical protein ARALYDRAFT_899795 [ 0.920 0.776 0.602 1e-112
449445864409 PREDICTED: uncharacterized protein LOC10 0.918 0.794 0.612 1e-110
356521496417 PREDICTED: uncharacterized protein LOC10 0.926 0.786 0.596 1e-110
18397898420 uncharacterized protein [Arabidopsis tha 0.920 0.776 0.590 1e-109
>gi|224123330|ref|XP_002330289.1| predicted protein [Populus trichocarpa] gi|222871324|gb|EEF08455.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/349 (67%), Positives = 278/349 (79%), Gaps = 7/349 (2%)

Query: 9   RMLVLLYMDLNPFPIFGTQELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDE 68
           R L L Y+ LN       ++LR++ CP+VFVA SGG KACM+K FQIIQ TCEG LN+DE
Sbjct: 64  RALSLAYILLNEL----VEDLRVRPCPIVFVAFSGGPKACMYKVFQIIQGTCEGHLNMDE 119

Query: 69  SRLIRSCVAGQIYDSSPVDFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCL 128
           SRL+++C++G IYDS P+DFTSD  ARF LHP IQ++PG SK VSWVAKG+ SGLDGL L
Sbjct: 120 SRLVKNCISGHIYDSCPIDFTSDLGARFALHPAIQRMPGPSKFVSWVAKGLASGLDGLYL 179

Query: 129 TRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLN 188
           TRFE QRAEYW+ LY+S+D+G P+LI+CS+ND LAP  VI  FA+ L   GGDVKLVK N
Sbjct: 180 TRFESQRAEYWQTLYSSIDMGAPYLILCSENDNLAPYNVISKFAQRLQDQGGDVKLVKWN 239

Query: 189 GSPHIGHYEYYPIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNV 248
            SPHIGHY++ PIQYRAA+T LL+KA SVY +RI+QL E  G++  HDE+SELICDLQ  
Sbjct: 240 HSPHIGHYQHNPIQYRAAVTNLLDKAPSVYYRRIQQLREGIGLDSMHDEMSELICDLQKA 299

Query: 249 AVNSNQSLRRVAVEPSDHFFLPSSTELH-SQESGSLQDERNSRSVYLPT-PSISAHSVLG 306
           AVNSNQSLRRVAVEP DHFF+PSS E + S+ESG LQDER  RS+YLP  PSISAHSVLG
Sbjct: 300 AVNSNQSLRRVAVEPGDHFFVPSSAEYYNSRESGPLQDERKERSIYLPNPPSISAHSVLG 359

Query: 307 EFLFDVCVPKNVEGWDIRFSGSVNGQPYASA-RRHSPFNKFRCNLRSRL 354
           + LFD CVPKNVEGWDIRFSG +NGQP ASA RRHSPF+  +   RSRL
Sbjct: 360 QILFDACVPKNVEGWDIRFSGCLNGQPIASAQRRHSPFHGIKFTRRSRL 408

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224103577|ref|XP_002313109.1| predicted protein [Populus trichocarpa] gi|222849517|gb|EEE87064.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255555495|ref|XP_002518784.1| conserved hypothetical protein [Ricinus communis] gi|223542165|gb|EEF43709.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225428776|ref|XP_002282055.1| PREDICTED: uncharacterized protein LOC100245307 [Vitis vinifera] gi|297741300|emb|CBI32431.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147797958|emb|CAN74073.1| hypothetical protein VITISV_015639 [Vitis vinifera] Back     alignment and taxonomy information
>gi|363806692|ref|NP_001242521.1| uncharacterized protein LOC100798622 [Glycine max] gi|255634937|gb|ACU17827.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297836186|ref|XP_002885975.1| hypothetical protein ARALYDRAFT_899795 [Arabidopsis lyrata subsp. lyrata] gi|297331815|gb|EFH62234.1| hypothetical protein ARALYDRAFT_899795 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449445864|ref|XP_004140692.1| PREDICTED: uncharacterized protein LOC101216799 [Cucumis sativus] gi|449519170|ref|XP_004166608.1| PREDICTED: uncharacterized protein LOC101227919 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356521496|ref|XP_003529391.1| PREDICTED: uncharacterized protein LOC100817749 [Glycine max] Back     alignment and taxonomy information
>gi|18397898|ref|NP_565378.1| uncharacterized protein [Arabidopsis thaliana] gi|20197706|gb|AAM15216.1| unknown protein [Arabidopsis thaliana] gi|54606848|gb|AAV34772.1| At2g15695 [Arabidopsis thaliana] gi|56790196|gb|AAW30015.1| At2g15695 [Arabidopsis thaliana] gi|110741490|dbj|BAE98699.1| hypothetical protein [Arabidopsis thaliana] gi|330251337|gb|AEC06431.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
TAIR|locus:505006247420 AT2G15695 "AT2G15695" [Arabido 0.918 0.773 0.598 4.1e-104
TAIR|locus:2167613403 AT5G44250 "AT5G44250" [Arabido 0.844 0.741 0.480 1.7e-73
TAIR|locus:505006247 AT2G15695 "AT2G15695" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1031 (368.0 bits), Expect = 4.1e-104, P = 4.1e-104
 Identities = 201/336 (59%), Positives = 254/336 (75%)

Query:    27 QELRIQTCPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPV 86
             +EL+ + CPV+F+A SG  KACM+K  Q+I   CE Q++ D+S+L+R+C++G +YDS P+
Sbjct:    88 EELKSRPCPVIFLAFSGAPKACMYKVLQVIMDDCEAQIHPDDSQLVRTCLSGHVYDSGPL 147

Query:    87 DFTSDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYWRALYNSV 146
             DFTSD   +F LHPTI+++ G S+LVSWVAKG++SGLDGL LTRFE QR+EYW+ALY+SV
Sbjct:   148 DFTSDLNVKFALHPTIRRMSGPSRLVSWVAKGISSGLDGLYLTRFESQRSEYWQALYSSV 207

Query:   147 DLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAA 206
             ++G P+LI+CS+NDELAP QVI +F   L  LGG+VK+VK   SPH GHY + PIQYRA 
Sbjct:   208 EIGAPYLILCSENDELAPLQVISSFTHQLQELGGEVKVVKWKNSPHAGHYAHNPIQYRAV 267

Query:   207 ITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNSNQSLRRVAVEPSDH 266
             I+  LEKA SV+  +IRQLGE +    THDEISELICDLQ VAVNSNQSLRRVA  P DH
Sbjct:   268 ISNFLEKAISVHLHKIRQLGERAH---THDEISELICDLQKVAVNSNQSLRRVATGPCDH 324

Query:   267 FFLPSSTELHSQESGS----LQDERNSRSVYLPT-P-SISAHSVLGEFLFDVCVPKNVEG 320
             FFLPSS    S  + S     Q+E+  RS + P  P SI+AHSVLG+FLFD CVPKN+EG
Sbjct:   325 FFLPSSAPYQSNSNNSDPSSSQEEQRERSSFRPLQPTSINAHSVLGQFLFDSCVPKNIEG 384

Query:   321 WDIRFSGSVNGQPYA--SARRHSPFNKFRCNLRSRL 354
             WDIRF+G +NGQPYA  S+R++S     +   RSRL
Sbjct:   385 WDIRFAGCLNGQPYATSSSRKNSNLGFKKRFFRSRL 420
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2167613 AT5G44250 "AT5G44250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
pfam05705240 pfam05705, DUF829, Eukaryotic protein of unknown f 4e-27
pfam05705240 pfam05705, DUF829, Eukaryotic protein of unknown f 8e-05
COG0657312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 0.003
>gnl|CDD|218708 pfam05705, DUF829, Eukaryotic protein of unknown function (DUF829) Back     alignment and domain information 
 Score =  106 bits (267), Expect = 4e-27
 Identities = 73/248 (29%), Positives = 103/248 (41%), Gaps = 25/248 (10%)

Query: 82  DSSPVDFT--SDFCARFGLHPTIQKIPGLSKLVSWVAKGVTSGLDGLCLTRFEPQRAEYW 139
            + P      SD   R    P I  I    + + W  KG+ SGLD L     E QR+EYW
Sbjct: 10  GARPKHLAKYSDLYTR--PGPDILVITSPPRDLLWPTKGLASGLDKLLELLSESQRSEYW 67

Query: 140 RALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYY 199
             L++    G P L +C     LA  Q  Y F + L  + G V     + +P IGHY + 
Sbjct: 68  PILFHVFSNGGPILYLCL----LAALQDRYKFGKLLPRVKGQV----WDSAPGIGHY-HG 118

Query: 200 PIQYRAAITGLLEKAASVYSQRIRQLGEISGMEGTHDEISELICDLQNVAVNSNQSLRRV 259
           P+   AA    L K + V S + R L     +  T   ++ LI  L +VA +S +SL  +
Sbjct: 119 PVGAFAAA---LPKLSRVASHKTRALL-ALALRVTL--LALLILFLPSVASHSRRSLNDL 172

Query: 260 AVEPS--DHFFLPSSTE--LHSQESGSLQDERNSRSVYLPT--PSISAHSVLGEFLFDVC 313
           A  P      +L S  +  +  ++     DE   R V + +     S H        D  
Sbjct: 173 ANTPLPCPQLYLYSKADEVIPWRDVERHIDEARQRGVSVTSVCFEDSPHVGHMRKHPDRY 232

Query: 314 VPKNVEGW 321
            PK VE W
Sbjct: 233 WPKVVEFW 240

This family consists of several uncharacterized eukaryotic proteins. Length = 240
>gnl|CDD|218708 pfam05705, DUF829, Eukaryotic protein of unknown function (DUF829) Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 354
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 100.0
KOG2521350 consensus Uncharacterized conserved protein [Funct 100.0
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.07
PRK11460232 putative hydrolase; Provisional 97.56
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.5
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 96.83
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 96.81
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 96.63
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 96.5
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 96.39
TIGR03611257 RutD pyrimidine utilization protein D. This protei 96.31
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 96.31
PRK00175379 metX homoserine O-acetyltransferase; Provisional 96.22
PLN02652395 hydrolase; alpha/beta fold family protein 96.02
PHA02857276 monoglyceride lipase; Provisional 95.94
PRK10749330 lysophospholipase L2; Provisional 95.92
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 95.9
PLN02965255 Probable pheophorbidase 95.89
PRK06765389 homoserine O-acetyltransferase; Provisional 95.88
PRK10162318 acetyl esterase; Provisional 95.78
PRK10566249 esterase; Provisional 95.73
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 95.72
PRK05077414 frsA fermentation/respiration switch protein; Revi 95.68
COG1647243 Esterase/lipase [General function prediction only] 95.61
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 95.57
PLN02679360 hydrolase, alpha/beta fold family protein 95.57
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 95.55
COG0400207 Predicted esterase [General function prediction on 95.45
PLN02824294 hydrolase, alpha/beta fold family protein 95.43
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 95.42
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 95.29
PRK03592295 haloalkane dehalogenase; Provisional 95.26
PRK07581339 hypothetical protein; Validated 95.16
PRK08775343 homoserine O-acetyltransferase; Provisional 95.07
PLN02298330 hydrolase, alpha/beta fold family protein 94.97
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 94.89
PRK03204286 haloalkane dehalogenase; Provisional 94.57
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 94.56
PRK10349256 carboxylesterase BioH; Provisional 94.5
PRK06489360 hypothetical protein; Provisional 94.45
PLN02578354 hydrolase 93.99
PLN02511388 hydrolase 93.98
PLN02385349 hydrolase; alpha/beta fold family protein 93.97
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 93.93
PRK00870302 haloalkane dehalogenase; Provisional 93.9
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 93.72
PLN03084383 alpha/beta hydrolase fold protein; Provisional 93.67
KOG1552258 consensus Predicted alpha/beta hydrolase [General 93.67
PRK10673255 acyl-CoA esterase; Provisional 93.29
PLN02872395 triacylglycerol lipase 93.12
COG2267298 PldB Lysophospholipase [Lipid metabolism] 93.04
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 92.96
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 92.73
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 92.6
PLN02211273 methyl indole-3-acetate methyltransferase 92.35
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 92.34
PRK05855 582 short chain dehydrogenase; Validated 91.46
PLN02442283 S-formylglutathione hydrolase 91.11
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 91.09
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 90.96
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 90.53
PLN02894402 hydrolase, alpha/beta fold family protein 90.26
COG0657312 Aes Esterase/lipase [Lipid metabolism] 89.94
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 89.6
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 88.69
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 87.65
COG1073299 Hydrolases of the alpha/beta superfamily [General 87.09
COG0412236 Dienelactone hydrolase and related enzymes [Second 86.97
PRK11071190 esterase YqiA; Provisional 86.51
KOG2382315 consensus Predicted alpha/beta hydrolase [General 86.12
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 85.83
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 85.3
PRK13604307 luxD acyl transferase; Provisional 83.53
PRK10985324 putative hydrolase; Provisional 83.03
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 80.12
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 80.05
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information 
Probab=100.00  E-value=4.8e-36  Score=278.22  Aligned_cols=185  Identities=20%  Similarity=0.248  Sum_probs=123.4

Q ss_pred             HHHHHHHhhhcCCCcccchhhhccCC-CCeEEEEeCCChHHHHHHHHHHHHhcccCCCCccchhhhccCceEEEEeCCCC
Q 018541            8 LRMLVLLYMDLNPFPIFGTQELRIQT-CPVVFVALSGGTKACMHKAFQIIQATCEGQLNVDESRLIRSCVAGQIYDSSPV   86 (354)
Q Consensus         8 ~~~~~~a~~ll~~~~~~Ll~~l~~~~-~PIlfH~FSnGG~~~ly~v~qll~~~~~~~~~~~~yq~l~~rI~G~IfDSaPg   86 (354)
                      +++..++.++++     ++++..... .||+||+|||||...+..+.+.++..       .+++.+.++|+|+||||||+
T Consensus        45 ~~~~~~~~~l~~-----~l~~~~~~~~~~il~H~FSnGG~~~~~~l~~~~~~~-------~~~~~~~~~i~g~I~DS~P~  112 (240)
T PF05705_consen   45 KRLAPAADKLLE-----LLSDSQSASPPPILFHSFSNGGSFLYSQLLEAYQSR-------KKFGKLLPRIKGIIFDSCPG  112 (240)
T ss_pred             cchHHHHHHHHH-----HhhhhccCCCCCEEEEEEECchHHHHHHHHHHHHhc-------ccccccccccceeEEeCCCC
Confidence            358888889997     455555554 49999999999964444555555442       33556678899999999998


Q ss_pred             CCCc--chhhccccccccccccCch-h-HH-HH-HHH-HHHhhhhcccccccc---hhhHHHHHHhhccCCCCCCEEEEe
Q 018541           87 DFTS--DFCARFGLHPTIQKIPGLS-K-LV-SW-VAK-GVTSGLDGLCLTRFE---PQRAEYWRALYNSVDLGTPFLIIC  156 (354)
Q Consensus        87 d~t~--~lg~~~~l~pai~~~~~~~-r-l~-~w-~a~-~i~~~l~~l~l~~~~---~~r~~y~~tL~~~~~~~aPrLYLY  156 (354)
                      ..+.  ..++ ++.     .++... + +. .+ +.. .+...+...+.....   .....+++.+ ...+..+|+||||
T Consensus       113 ~~~~~~~~~~-~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~p~lylY  185 (240)
T PF05705_consen  113 IPTYSSSARA-FSA-----ALPKSSPRWFVPLWPLLQFLLRLSIISYFIFGYPDVQEYYRRALNDF-ANSPSRCPRLYLY  185 (240)
T ss_pred             ccccccHHHH-HHH-----HcCccchhhHHHHHHHHHHHHHHHHHHHHHhcCCcHHHHHHHHHhhh-hcCCCCCCeEEec
Confidence            7543  1221 110     112110 0 00 01 000 000000111111111   1122334433 2346668999999


Q ss_pred             cCCCCccChHHHHHHHHHHHHCCCceEEEEcCCCCCCcccccChHhHHHHHHHHH
Q 018541          157 SDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLL  211 (354)
Q Consensus       157 SkaD~LVp~~dVE~ha~ear~~G~~V~~v~Fe~SpHV~HmR~hPeeYw~aV~~Fw  211 (354)
                      |++|++|+|+|||+|++++|++|++|+.++|++|+||+|+|.||++||++|.+||
T Consensus       186 S~~D~l~~~~~ve~~~~~~~~~G~~V~~~~f~~S~HV~H~r~~p~~Y~~~v~~fw  240 (240)
T PF05705_consen  186 SKADPLIPWRDVEEHAEEARRKGWDVRAEKFEDSPHVAHLRKHPDRYWRAVDEFW  240 (240)
T ss_pred             CCCCcCcCHHHHHHHHHHHHHcCCeEEEecCCCCchhhhcccCHHHHHHHHHhhC
Confidence            9999999999999999999999999999999999999999999999999999998

>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
1vkh_A273 Putative serine hydrolase; structural genomics, jo 7e-04
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
 Score = 40.0 bits (93), Expect = 7e-04
 Identities = 8/43 (18%), Positives = 13/43 (30%)

Query: 150 TPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPH 192
               ++ S +DEL   +        L       KL   +   H
Sbjct: 213 IDMHLVHSYSDELLTLRQTNCLISCLQDYQLSFKLYLDDLGLH 255

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.2
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.11
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.1
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.07
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.06
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.05
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.05
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.04
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 98.0
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 97.99
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 97.99
3llc_A270 Putative hydrolase; structural genomics, joint cen 97.98
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 97.98
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.95
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.94
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.93
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 97.92
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.92
4f21_A246 Carboxylesterase/phospholipase family protein; str 97.85
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.85
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 97.85
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.81
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 97.78
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 97.78
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 97.77
3bjr_A283 Putative carboxylesterase; structural genomics, jo 97.77
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.75
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.74
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.72
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.71
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.71
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 97.71
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.68
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.67
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 97.67
4fle_A202 Esterase; structural genomics, PSI-biology, northe 97.65
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.58
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 97.57
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 97.56
3h04_A275 Uncharacterized protein; protein with unknown func 97.55
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 97.54
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.53
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 97.51
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.51
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 97.5
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 97.48
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.47
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.46
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.45
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.44
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.43
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.42
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.41
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 97.39
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.37
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 97.37
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.36
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.35
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.35
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.35
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 97.32
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 97.31
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 97.31
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 97.3
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.28
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.28
1vkh_A273 Putative serine hydrolase; structural genomics, jo 97.26
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.24
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.22
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.2
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.19
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.19
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.18
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.18
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.16
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.16
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 97.15
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 97.15
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 97.15
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 97.14
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.11
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 97.11
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 97.1
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.09
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.06
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.04
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.02
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.99
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 96.97
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 96.97
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 96.95
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 96.92
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 96.86
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 96.86
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 96.86
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 96.86
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 96.85
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.84
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.81
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 96.8
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 96.78
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.75
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.71
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 96.71
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 96.69
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 96.68
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 96.66
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 96.64
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 96.63
1iup_A282 META-cleavage product hydrolase; aromatic compound 96.62
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 96.62
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.58
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 96.57
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 96.54
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 96.53
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.51
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.41
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.41
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 96.39
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 96.37
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.34
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.33
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 96.33
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 96.32
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 96.3
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.25
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 96.24
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 96.22
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 96.12
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.1
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 96.07
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 96.06
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 96.06
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.05
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.01
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 96.0
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 95.99
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 95.95
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 95.94
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.89
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 95.87
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 95.87
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 95.81
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.8
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 95.8
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 95.77
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 95.76
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 95.74
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 95.65
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 95.6
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 95.55
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 95.51
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 95.5
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 95.41
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.4
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 95.14
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 95.1
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 95.1
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 95.02
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 95.02
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 94.83
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 94.82
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 94.77
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 94.73
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 94.73
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.6
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 94.38
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 94.25
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.15
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 92.86
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.59
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 93.46
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 93.16
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 92.83
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 92.69
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 92.03
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 91.08
3lp5_A250 Putative cell surface hydrolase; structural genom 90.84
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 90.73
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 90.41
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 90.08
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 89.54
1kez_A300 Erythronolide synthase; polyketide synthase, modul 88.74
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 88.63
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 87.79
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 87.75
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 87.33
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 86.33
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 83.72
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 80.77
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 80.63
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 80.32
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
Probab=98.20  E-value=8.7e-06  Score=69.74  Aligned_cols=66  Identities=14%  Similarity=0.231  Sum_probs=59.0

Q ss_pred             CCCCEEEEecCCCCccChHHHHHHHHHHHHCCCceEEEEcCCCCCCcccccChHhHHHHHHHHHHHH
Q 018541          148 LGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKA  214 (354)
Q Consensus       148 ~~aPrLYLYSkaD~LVp~~dVE~ha~ear~~G~~V~~v~Fe~SpHV~HmR~hPeeYw~aV~~Fw~~~  214 (354)
                      ..+|.|+++++.|.++|.+..+++.+...+. .+++.+.++++.|..++..+|+++++.|.+|+++.
T Consensus       183 ~~~P~l~i~g~~D~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~gH~~~~~~~~~~~~~~i~~fl~~~  248 (251)
T 3dkr_A          183 VKQPTFIGQAGQDELVDGRLAYQLRDALINA-ARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQE  248 (251)
T ss_dssp             CCSCEEEEEETTCSSBCTTHHHHHHHHCTTC-SCEEEEEETTCCSCTTTSTTHHHHHHHHHHHHHTT
T ss_pred             cCCCEEEEecCCCcccChHHHHHHHHHhcCC-CCceEEEeCCCCcccccccchhHHHHHHHHHHHhh
Confidence            4579999999999999999999988877654 57899999999999999988999999999999863
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 354
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 0.001
d1jkma_358 c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, 0.002
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase
domain: Carboxylesterase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

 Score = 38.2 bits (87), Expect = 0.001
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 5/83 (6%)

Query: 127 CLTRFEPQRAEYWRALYNSVDLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVK 186
             +R E +       ++  ++   P LII ++ D L  +  ++   + L   G +  +V+
Sbjct: 222 YFSREEDKFNPLASVIFADLENLPPALIITAEYDPLRDEGEVF--GQMLRRAGVEASIVR 279

Query: 187 LNGSPHIGHYEYYPI--QYRAAI 207
             G  H G   YYP+    R AI
Sbjct: 280 YRGVLH-GFINYYPVLKAARDAI 301
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Length = 358 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 98.19
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.98
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.94
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 97.68
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 97.67
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.63
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.63
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.42
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.34
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.29
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 97.25
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.13
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.11
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.1
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.08
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 97.02
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 96.98
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 96.97
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 96.88
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 96.87
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 96.78
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 96.75
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 96.67
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 96.59
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.56
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.45
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 96.37
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 96.25
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 96.23
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 96.23
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 96.12
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 95.95
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 95.94
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 95.92
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 95.89
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 95.88
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 95.85
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 95.72
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 95.72
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 95.48
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 95.31
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 95.04
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 94.97
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 94.54
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 94.36
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 94.22
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 93.73
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 93.48
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 93.37
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 91.55
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 91.08
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 89.69
d2d81a1318 Polyhydroxybutyrate depolymerase {Penicillium funi 89.68
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 88.71
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 85.75
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 84.55
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 83.95
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 81.07
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase/lipase
domain: Carboxylesterase Est
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=98.19  E-value=6.2e-06  Score=66.96  Aligned_cols=66  Identities=14%  Similarity=0.095  Sum_probs=57.8

Q ss_pred             CCCCCEEEEecCCCCccChHHHHHHHHHHHHCCCceEEEEcCCCCCCcccccChHhHHHHHHHHHHHH
Q 018541          147 DLGTPFLIICSDNDELAPQQVIYNFARHLLALGGDVKLVKLNGSPHIGHYEYYPIQYRAAITGLLEKA  214 (354)
Q Consensus       147 ~~~aPrLYLYSkaD~LVp~~dVE~ha~ear~~G~~V~~v~Fe~SpHV~HmR~hPeeYw~aV~~Fw~~~  214 (354)
                      ....|.|+++++.|.++|.+..+++++.++  +-+++.+.++++.|.-|+-..|+++.+.|.+|+++.
T Consensus       175 ~~~~p~lii~g~~D~~~~~~~~~~~~~~~~--~~~~~~~~~~~~gH~~~~~~~~~~~~~~i~~Fl~~l  240 (242)
T d1tqha_         175 LIYAPTFVVQARHDEMINPDSANIIYNEIE--SPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESL  240 (242)
T ss_dssp             GCCSCEEEEEETTCSSSCTTHHHHHHHHCC--CSSEEEEEETTCCSSGGGSTTHHHHHHHHHHHHHHS
T ss_pred             eeccccceeecccCCccCHHHHHHHHHHcC--CCCcEEEEECCCCCcCccccCHHHHHHHHHHHHHhC
Confidence            456699999999999999999998876553  457899999999999999889999999999999863
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure