Citrus Sinensis ID: 018571
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 354 | ||||||
| 225460963 | 347 | PREDICTED: uncharacterized protein LOC10 | 0.949 | 0.968 | 0.661 | 1e-129 | |
| 449444052 | 367 | PREDICTED: uncharacterized protein LOC10 | 0.870 | 0.839 | 0.683 | 1e-120 | |
| 356553046 | 351 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.980 | 0.625 | 1e-118 | |
| 363806726 | 351 | uncharacterized protein LOC100797026 [Gl | 0.971 | 0.980 | 0.620 | 1e-117 | |
| 357494547 | 355 | hypothetical protein MTR_5g092970 [Medic | 0.892 | 0.890 | 0.640 | 1e-113 | |
| 224116614 | 355 | predicted protein [Populus trichocarpa] | 0.968 | 0.966 | 0.596 | 1e-110 | |
| 30687441 | 343 | uncharacterized protein [Arabidopsis tha | 0.920 | 0.950 | 0.613 | 1e-107 | |
| 297799294 | 342 | hypothetical protein ARALYDRAFT_492098 [ | 0.918 | 0.950 | 0.613 | 1e-105 | |
| 255583615 | 266 | conserved hypothetical protein [Ricinus | 0.734 | 0.977 | 0.715 | 1e-102 | |
| 4455221 | 403 | putative protein [Arabidopsis thaliana] | 0.836 | 0.734 | 0.603 | 1e-102 |
| >gi|225460963|ref|XP_002279971.1| PREDICTED: uncharacterized protein LOC100248711 [Vitis vinifera] gi|297737440|emb|CBI26641.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 466 bits (1199), Expect = e-129, Method: Compositional matrix adjust.
Identities = 231/349 (66%), Positives = 274/349 (78%), Gaps = 13/349 (3%)
Query: 9 KNKTTSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVG 68
K+ TTS +KL L P+ +K+ + + +SR P EK+KPPSL SLCLG+VG
Sbjct: 7 KSLTTSFQKLHLSPI---------SKSKPSVIPPTFQSSRSPIEKTKPPSLESLCLGVVG 57
Query: 69 KHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSD 128
KH EDIIGDL EIA+NFP D K+A+A+IARRR+LL DDVI+SLA+SSWEILDISGSDVSD
Sbjct: 58 KHFEDIIGDLGEIAVNFPADTKMAMAAIARRRQLLNDDVIISLAESSWEILDISGSDVSD 117
Query: 129 FGLVKVAQMCKSLKAVDI----RITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGI 184
FGL KVA+ CK L+AVDI ++TAAGVSE + HCHSLETLRCGG PRS+H AR+CLGI
Sbjct: 118 FGLAKVAERCKVLRAVDISRCSKVTAAGVSELVWHCHSLETLRCGGCPRSDHTARQCLGI 177
Query: 185 LKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPF 244
KPKLND+EG+SWEEL T+I HGA+SLRW VWP ID +S+E + ECPRIIVNPKPSPF
Sbjct: 178 FKPKLNDIEGESWEELDPTEIAHGAESLRWLVWPKIDNNSLESFAAECPRIIVNPKPSPF 237
Query: 245 GFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAF 304
GFRG +VP EA P++ LD+P V DIDP WAV F + + S S EL +AEKFRLAF
Sbjct: 238 GFRGVKVPVEALPNVALDEPIVKDIDPRTWAVSGFTARPTAPSSPSSTELPIAEKFRLAF 297
Query: 305 VERDTRLAPKRAKNARQHQRRAEREWMETSTSAKAIALASKATKSLSSR 353
VERD+RLAPKRAKNARQH RRAEREW+ TST AKA+ALAS+A+KSL R
Sbjct: 298 VERDSRLAPKRAKNARQHLRRAEREWVMTSTRAKALALASQASKSLHGR 346
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449444052|ref|XP_004139789.1| PREDICTED: uncharacterized protein LOC101203553 [Cucumis sativus] gi|449518907|ref|XP_004166477.1| PREDICTED: uncharacterized LOC101203553 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356553046|ref|XP_003544869.1| PREDICTED: uncharacterized protein LOC100784617 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|363806726|ref|NP_001242271.1| uncharacterized protein LOC100797026 [Glycine max] gi|255639475|gb|ACU20032.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357494547|ref|XP_003617562.1| hypothetical protein MTR_5g092970 [Medicago truncatula] gi|355518897|gb|AET00521.1| hypothetical protein MTR_5g092970 [Medicago truncatula] gi|388520841|gb|AFK48482.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224116614|ref|XP_002317347.1| predicted protein [Populus trichocarpa] gi|222860412|gb|EEE97959.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|30687441|ref|NP_194428.2| uncharacterized protein [Arabidopsis thaliana] gi|63003790|gb|AAY25424.1| At4g26980 [Arabidopsis thaliana] gi|90093278|gb|ABD85152.1| At4g26980 [Arabidopsis thaliana] gi|110737995|dbj|BAF00933.1| hypothetical protein [Arabidopsis thaliana] gi|332659880|gb|AEE85280.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297799294|ref|XP_002867531.1| hypothetical protein ARALYDRAFT_492098 [Arabidopsis lyrata subsp. lyrata] gi|297313367|gb|EFH43790.1| hypothetical protein ARALYDRAFT_492098 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255583615|ref|XP_002532563.1| conserved hypothetical protein [Ricinus communis] gi|223527718|gb|EEF29824.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|4455221|emb|CAB36544.1| putative protein [Arabidopsis thaliana] gi|7269551|emb|CAB79553.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 354 | ||||||
| TAIR|locus:2116307 | 343 | AT4G26980 "AT4G26980" [Arabido | 0.867 | 0.895 | 0.584 | 1.3e-93 |
| TAIR|locus:2116307 AT4G26980 "AT4G26980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 932 (333.1 bits), Expect = 1.3e-93, P = 1.3e-93
Identities = 190/325 (58%), Positives = 229/325 (70%)
Query: 14 SLKKLDLYPVQNLTERNEATKN---VTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKH 70
SLK LDL N T R +N V+A++ + SR+ KSKPPSLVS CLG++GKH
Sbjct: 8 SLKNLDL----N-TNRGRGPENKILVSAYVSS----SRMSPLKSKPPSLVSSCLGVIGKH 58
Query: 71 LEDIIGDLDEIAINFPVDXXXXXXXXXXXXXXXXDDVIMSLADSSWEILDISGSDVSDFG 130
LED+I L EI++ FP D DDVI+ LADSSWEILD+SGSDV++FG
Sbjct: 59 LEDMIRCLAEISVIFPADIKMSIAAIARRKKLLDDDVIICLADSSWEILDVSGSDVTNFG 118
Query: 131 LVKVAQMCKSLKAVDI----RITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILK 186
L KVA++CKSL+AVDI +I++ GV E + HC SLETLRCGG P S ARR L I K
Sbjct: 119 LAKVAEICKSLRAVDISRCNKISSMGVLELVQHCRSLETLRCGGCPSSESTARRSLSIFK 178
Query: 187 PKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGF 246
P L++VEG++WEE+ ++IGHG QSLRW VWP IDKDS+EM+S+ECPRI+VNPKPS +
Sbjct: 179 PNLSNVEGETWEEIDTSEIGHGGQSLRWLVWPRIDKDSLEMLSSECPRIVVNPKPSLVAY 238
Query: 247 RGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAFVE 306
R EVPREA PD+ LD+PFV DIDP W V TS NELS+AEKFRLAF E
Sbjct: 239 RADEVPREALPDVALDEPFVKDIDPKTWVVTGVVQK--PTSFPLSNELSIAEKFRLAFAE 296
Query: 307 RDTRLAPKRAKNARQHQRRAEREWM 331
RD R+APKRAKNARQ QRRAER+WM
Sbjct: 297 RDARMAPKRAKNARQRQRRAERDWM 321
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.318 0.134 0.403 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 354 318 0.00083 116 3 11 22 0.40 34
33 0.45 37
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 621 (66 KB)
Total size of DFA: 232 KB (2125 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 23.88u 0.09s 23.97t Elapsed: 00:00:02
Total cpu time: 23.88u 0.09s 23.97t Elapsed: 00:00:02
Start: Mon May 20 19:55:52 2013 End: Mon May 20 19:55:54 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 354 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.7 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.58 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.46 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.37 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.09 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.06 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.92 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.87 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.09 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.9 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.8 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.72 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.63 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.63 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.37 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.16 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.05 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.94 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.76 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.64 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.53 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.43 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.34 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.92 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.59 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.57 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.47 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.39 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.33 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 94.6 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 94.28 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.07 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 93.59 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 93.12 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 92.47 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 92.1 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 91.18 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 91.04 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 90.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 89.41 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 89.03 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 88.75 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 88.52 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 86.62 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 86.04 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 85.81 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 85.63 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 83.38 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 83.12 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 82.97 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 80.94 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 80.73 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 80.71 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.70 E-value=4.3e-18 Score=168.30 Aligned_cols=166 Identities=17% Similarity=0.311 Sum_probs=145.5
Q ss_pred CCCHHHHHHhhc--CCccEEEeecC-CCCHHHHHHHHHhCCCCcEEEE----eecHHHHHHHHhcCCCCCEEEecCCCCC
Q 018571 102 LLADDVIMSLAD--SSWEILDISGS-DVSDFGLVKVAQMCKSLKAVDI----RITAAGVSEFLLHCHSLETLRCGGSPRS 174 (354)
Q Consensus 102 ~ltD~~L~~la~--~~L~~LdLs~C-~ITD~gL~~la~~C~~L~~LdL----~ITd~gl~~La~~Cp~Le~L~L~gC~~I 174 (354)
-+.|..+..++. |++++|+++|| +|||..+..++..|++|++|+| .|||..++.++++|++|++||++||++|
T Consensus 150 ~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi 229 (483)
T KOG4341|consen 150 AVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQI 229 (483)
T ss_pred cCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchh
Confidence 378888988887 99999999999 9999999999999999999999 8999999999999999999999999999
Q ss_pred cHHHHHHHHhcCCCCcEeeCCC--------------------------c-cccchhh--hhccCccccccc---cCCCCH
Q 018571 175 NHAARRCLGILKPKLNDVEGDS--------------------------W-EELVNTD--IGHGAQSLRWFV---WPNIDK 222 (354)
Q Consensus 175 tD~sL~~La~~cp~L~~L~ls~--------------------------~-~~td~~~--i~~~~~~L~~L~---C~~ITD 222 (354)
++.+++++.++|..|+.+...| | .++|.++ +..+|..|+.|. |.++||
T Consensus 230 ~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~d 309 (483)
T KOG4341|consen 230 SGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDITD 309 (483)
T ss_pred hcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCCch
Confidence 9988888888777765543333 2 2445443 367788888887 999999
Q ss_pred HHHHHHHhcCCcceecCCCCceeecCCC-CCccccccccCCCCccccccccc
Q 018571 223 DSIEMMSTECPRIIVNPKPSPFGFRGFE-VPREAFPDITLDDPFVNDIDPSA 273 (354)
Q Consensus 223 ~~l~~L~~~Cp~L~~~p~~~~L~l~gC~-~s~~al~~v~~~~~~v~~~~~~~ 273 (354)
..+.++.++|++|++ +-+.+|. +++.++..+.-.++.+.+++.+.
T Consensus 310 ~~l~aLg~~~~~L~~------l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~ 355 (483)
T KOG4341|consen 310 EVLWALGQHCHNLQV------LELSGCQQFSDRGFTMLGRNCPHLERLDLEE 355 (483)
T ss_pred HHHHHHhcCCCceEE------EeccccchhhhhhhhhhhcCChhhhhhcccc
Confidence 999999999999999 9999998 89999999999999999988865
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 354 | |||
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-04 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-06 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 |
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
Score = 53.0 bits (127), Expect = 8e-08
Identities = 43/265 (16%), Positives = 85/265 (32%), Gaps = 64/265 (24%)
Query: 13 TSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKHLE 72
L+ + +Y V ++T NE+ +++ +LKNL + RL L+ I L+
Sbjct: 378 QELEYMAVY-VSDIT--NESLESIGTYLKNLC-DFRL--------VLLDREERITDLPLD 425
Query: 73 DIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSW--EILDISGSDVSDFG 130
+ + + I K+ + R+ L D + + S + + SD G
Sbjct: 426 NGVR---SLLIGCK---KLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEG 479
Query: 131 LVKVAQMCKSLKAVDIR---ITAAGVSEFLLHCHSLETLRCGGSPRSN------HAARRC 181
L++ ++ C +L+ +++R + ++ + SL L G S AR
Sbjct: 480 LMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPY 539
Query: 182 LGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKP 241
I V P +++ I+
Sbjct: 540 WNIELIPSRRV-------------------------PEVNQQGEIREMEHPAHILA---- 570
Query: 242 SPFGFRGFEVPREAFPD--ITLDDP 264
+ R P L +P
Sbjct: 571 ----YYSLAGQRTDCPTTVRVLKEP 591
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 354 | |||
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.64 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.6 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.6 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.6 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.57 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.54 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.5 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.41 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.34 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.25 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.23 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.23 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.14 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.1 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.98 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.86 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.86 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.77 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.75 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.62 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.52 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.44 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.35 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.31 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.15 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.12 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.1 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.03 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.03 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.03 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.98 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.97 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.97 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.93 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.93 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.91 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.89 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.88 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.87 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.86 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.82 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.82 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.8 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.8 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.8 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.79 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.78 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.77 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.74 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.73 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.72 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.72 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.68 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.66 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.66 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.65 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.65 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.64 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.63 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.63 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.61 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.59 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.59 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.57 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.56 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.53 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.52 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.52 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.51 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.45 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.44 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.42 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.42 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.42 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.41 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.4 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.38 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.38 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.37 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.37 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.34 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.34 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.34 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.33 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.33 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.32 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.31 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.3 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.28 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.27 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.27 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.27 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.26 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.26 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.26 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.26 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.22 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.21 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.2 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.16 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.13 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.13 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.1 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.08 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.03 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.03 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.99 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 96.97 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.93 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.88 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 96.78 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.76 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.73 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.71 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.65 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.63 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.63 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.61 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.53 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.51 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 96.37 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.34 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.29 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.13 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.02 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 95.94 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 95.77 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 95.48 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 95.36 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 95.29 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 95.22 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 95.14 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 95.09 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 95.04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 95.01 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 94.99 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 94.88 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 94.85 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 94.78 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 94.22 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 94.05 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 93.94 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 93.37 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 92.87 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 92.4 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 91.62 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 89.55 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 85.8 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 81.77 |
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
Probab=99.64 E-value=9.3e-17 Score=143.40 Aligned_cols=102 Identities=10% Similarity=0.110 Sum_probs=91.6
Q ss_pred CCccEEEeecCCCCHHHHHHHHHhCCCCcEEEE----eecHHHHHHHHhc---CCCCCEEEecCCCCCcHHHHHHHHhcC
Q 018571 114 SSWEILDISGSDVSDFGLVKVAQMCKSLKAVDI----RITAAGVSEFLLH---CHSLETLRCGGSPRSNHAARRCLGILK 186 (354)
Q Consensus 114 ~~L~~LdLs~C~ITD~gL~~la~~C~~L~~LdL----~ITd~gl~~La~~---Cp~Le~L~L~gC~~ItD~sL~~La~~c 186 (354)
..|++|||++|.|||.|+..+. .|++|++|+| .|||.|+..|+.. |++|++|+|++|..|||.|+.+|+. |
T Consensus 61 ~~L~~LDLs~~~Itd~GL~~L~-~~~~L~~L~L~~C~~ItD~gL~~L~~~~~~~~~L~~L~Ls~C~~ITD~Gl~~L~~-~ 138 (176)
T 3e4g_A 61 YKIQAIDATDSCIMSIGFDHME-GLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHH-F 138 (176)
T ss_dssp CCEEEEEEESCCCCGGGGGGGT-TCSCCCEEEEESCTTCCHHHHHHHHTCHHHHHHCCEEEEESCTTCCHHHHHHGGG-C
T ss_pred ceEeEEeCcCCCccHHHHHHhc-CCCCCCEEEeCCCCccCHHHHHHHHhcccccCCCCEEEcCCCCcCCHHHHHHHhc-C
Confidence 5799999999999999999996 5999999999 7999999999973 8899999999999999999999985 9
Q ss_pred CCCcEeeCCCccccchhhhhccCccccccccCCCCHHH--HHHHHhcCCccee
Q 018571 187 PKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDS--IEMMSTECPRIIV 237 (354)
Q Consensus 187 p~L~~L~ls~~~~td~~~i~~~~~~L~~L~C~~ITD~~--l~~L~~~Cp~L~~ 237 (354)
|+|++|++++ |++|||.+ +..+...-|++++
T Consensus 139 ~~L~~L~L~~--------------------c~~Itd~gl~~~~L~~~lP~l~V 171 (176)
T 3e4g_A 139 RNLKYLFLSD--------------------LPGVKEKEKIVQAFKTSLPSLEL 171 (176)
T ss_dssp TTCCEEEEES--------------------CTTCCCHHHHHHHHHHHCTTCEE
T ss_pred CCCCEEECCC--------------------CCCCCchHHHHHHHHHHCCCcEE
Confidence 9999999975 78888876 5667778888776
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 354 | ||||
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 |
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: 28-residue LRR domain: Ribonuclease inhibitor species: Human (Homo sapiens) [TaxId: 9606]
Score = 37.3 bits (84), Expect = 0.003
Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 6/56 (10%)
Query: 117 EILDISGSDVSDFGLVKVAQMCKSLKAVDIR---ITAAGV---SEFLLHCHSLETL 166
+ LDI ++SD ++ + + + V + +T A S L +L L
Sbjct: 5 QSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAEL 60
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 354 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.79 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.78 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.07 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.99 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.93 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.89 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.83 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.83 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.55 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.42 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.1 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.81 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.77 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.7 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.67 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.62 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.59 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.52 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.35 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.26 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.04 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.94 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.91 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.58 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.56 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.51 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.42 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 95.49 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 94.9 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 94.18 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 94.07 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 92.99 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 92.77 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 88.78 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 88.5 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 88.04 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 83.74 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 83.35 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 82.21 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 81.25 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79 E-value=9.9e-20 Score=169.58 Aligned_cols=158 Identities=18% Similarity=0.209 Sum_probs=136.3
Q ss_pred CCCHHHHHHhhc-CCccEEEeecC-CCCHHHHHHHHHhCCCCcEEEE----eecHHHHHH-HHhcCCCCCEEEecCCC-C
Q 018571 102 LLADDVIMSLAD-SSWEILDISGS-DVSDFGLVKVAQMCKSLKAVDI----RITAAGVSE-FLLHCHSLETLRCGGSP-R 173 (354)
Q Consensus 102 ~ltD~~L~~la~-~~L~~LdLs~C-~ITD~gL~~la~~C~~L~~LdL----~ITd~gl~~-La~~Cp~Le~L~L~gC~-~ 173 (354)
.++|..+..++. ++|++|+|++| +|||.|+..++..|++|++|+| .++|.|+.. ++..|++|++|+++||. .
T Consensus 82 ~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~ 161 (284)
T d2astb2 82 RLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKN 161 (284)
T ss_dssp BCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGG
T ss_pred CCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhcccccccchhhhcccccc
Confidence 378999999988 99999999999 9999999999999999999999 789999865 56678999999999984 7
Q ss_pred CcHHHHHHHHhcCCCCcEeeCCCc-cccchhhh-hccCccccccc---cCCCCHHHHHHHHhcCCcceecCCCCceeecC
Q 018571 174 SNHAARRCLGILKPKLNDVEGDSW-EELVNTDI-GHGAQSLRWFV---WPNIDKDSIEMMSTECPRIIVNPKPSPFGFRG 248 (354)
Q Consensus 174 ItD~sL~~La~~cp~L~~L~ls~~-~~td~~~i-~~~~~~L~~L~---C~~ITD~~l~~L~~~Cp~L~~~p~~~~L~l~g 248 (354)
++|.++..++.+||+|++|+++++ .++|.++. -..+++|++|+ |.+|||.++..+. .||+|+. +++.|
T Consensus 162 i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~~~~l~~L~-~~~~L~~------L~l~~ 234 (284)
T d2astb2 162 LQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELG-EIPTLKT------LQVFG 234 (284)
T ss_dssp SCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCE------EECTT
T ss_pred cccccccccccccccccccccccccCCCchhhhhhcccCcCCEEECCCCCCCChHHHHHHh-cCCCCCE------EeeeC
Confidence 999999999999999999999886 46776653 24578999987 9999999998875 6999999 99999
Q ss_pred CCCCccccccccCCCCccc
Q 018571 249 FEVPREAFPDITLDDPFVN 267 (354)
Q Consensus 249 C~~s~~al~~v~~~~~~v~ 267 (354)
| +++++++.+.-.+|.++
T Consensus 235 ~-~~d~~l~~l~~~lp~L~ 252 (284)
T d2astb2 235 I-VPDGTLQLLKEALPHLQ 252 (284)
T ss_dssp S-SCTTCHHHHHHHSTTSE
T ss_pred C-CCHHHHHHHHHhCcccc
Confidence 9 78877776665555543
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|