Citrus Sinensis ID: 018671

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MKVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
cEEEEEEEcccccEEEcccEEEEccEEEEcccccccccccccHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEcccEEEEEccEEEEccccEEccccEEEccccccccccccccccccccccEEEcccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcccccEEEEccccEEEEcccccccccEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccc
cEEEEEEEcccccEEEccccEEcccEEEEEEcccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEcEEEEEccccEEEccccEEcccEEEEEccccccHHHHHcccccccccEEEEcccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEccccEEEEccccEEEEccccccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
mkvhcetvTDELRTLEPWKFKISYDKLVIALGaeastfgihgvKENATFLREVHHAQEIRRKLLLNLMlsdvpgiseeeKSRLLHCVVvgggptgvefsgELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGivkdvdsqklilndgtevpyGLLVWstgvgpstlvksldlpkspggrigidewlrvpsvqdvfavgdcsgylestgktvLPALAQVAERQGKYLFSLLNRIgkagggransakdmelgdpfvyrhlgsmatIGRYKALVDLRQnkeskglslaGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVfgrdisri
mkvhcetvtdelrtlepwkfKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYAttqlsksgvrlvRGIVkdvdsqklilndgtevpYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAgggransakdmELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWattfvfgrdisri
MKVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
****CETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGG*******MELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRD****
MKVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVP***EEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAG***********LGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
MKVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
MKVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGG*******MELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRD****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query352 2.2.26 [Sep-21-2011]
Q8GWA1510 Alternative NAD(P)H dehyd yes no 0.997 0.688 0.837 1e-169
O80874508 Alternative NAD(P)H dehyd no no 0.997 0.690 0.834 1e-169
Q55CD9451 Probable NADH dehydrogena yes no 0.886 0.691 0.395 7e-62
O43090551 Probable NADH-ubiquinone yes no 0.897 0.573 0.361 6e-54
O14121551 Probable NADH-ubiquinone no no 0.965 0.617 0.342 2e-52
F2Z699582 External alternative NADH yes no 0.917 0.554 0.376 3e-44
Q1JPL4571 NAD(P)H dehydrogenase B1, no no 0.636 0.392 0.394 2e-43
Q07500545 External NADH-ubiquinone yes no 0.957 0.618 0.354 3e-41
P40215560 External NADH-ubiquinone no no 0.914 0.575 0.359 1e-40
F4JJJ3580 NAD(P)H dehydrogenase B3, no no 0.590 0.358 0.416 5e-36
>sp|Q8GWA1|NDA1_ARATH Alternative NAD(P)H dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 Back     alignment and function desciption
 Score =  595 bits (1533), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/351 (83%), Positives = 325/351 (92%)

Query: 2   KVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRR 61
           +VHCETVT+   TL+PWKFKI+YDKLV+A GAEASTFGI+GV ENA FLREVHHAQEIRR
Sbjct: 160 EVHCETVTEGSSTLKPWKFKIAYDKLVLACGAEASTFGINGVLENAIFLREVHHAQEIRR 219

Query: 62  KLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYI 121
           KLLLNLMLS+VPGI E+EK RLLHCVVVGGGPTGVEFSGELSDFIM+DVRQRYSHVKD I
Sbjct: 220 KLLLNLMLSEVPGIGEDEKKRLLHCVVVGGGPTGVEFSGELSDFIMKDVRQRYSHVKDDI 279

Query: 122 HVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLV 181
            VTLIEA +ILSSFDDRLRHYA  QL+KSGV+LVRGIVK+V  QKLIL+DGTEVPYG LV
Sbjct: 280 RVTLIEARDILSSFDDRLRHYAIKQLNKSGVKLVRGIVKEVKPQKLILDDGTEVPYGPLV 339

Query: 182 WSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALA 241
           WSTGVGPS+ V+SLD PK PGGRIGIDEW+RVPSVQDVFA+GDCSGYLESTGK+ LPALA
Sbjct: 340 WSTGVGPSSFVRSLDFPKDPGGRIGIDEWMRVPSVQDVFAIGDCSGYLESTGKSTLPALA 399

Query: 242 QVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQN 301
           QVAER+GKYL +L N +GKAGGGRANSAK+MELG+PFVY+HLGSMATIGRYKALVDLR++
Sbjct: 400 QVAEREGKYLANLFNVMGKAGGGRANSAKEMELGEPFVYKHLGSMATIGRYKALVDLRES 459

Query: 302 KESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI 352
           KE KG+S+AGFLSW +WRSAYLTRVVSWRNRFYVA+NW TTFVFGRDISRI
Sbjct: 460 KEGKGISMAGFLSWFIWRSAYLTRVVSWRNRFYVAINWLTTFVFGRDISRI 510

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|O80874|NDA2_ARATH Alternative NAD(P)H dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=1 SV=1 Back     alignment and function description
>sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 Back     alignment and function description
>sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 Back     alignment and function description
>sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 Back     alignment and function description
>sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 Back     alignment and function description
>sp|Q1JPL4|NDB1_ARATH NAD(P)H dehydrogenase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 Back     alignment and function description
>sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 Back     alignment and function description
>sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 Back     alignment and function description
>sp|F4JJJ3|NDB3_ARATH NAD(P)H dehydrogenase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
357490831 566 hypothetical protein MTR_5g071250 [Medic 0.988 0.614 0.844 1e-169
449450824 505 PREDICTED: alternative NAD(P)H dehydroge 0.994 0.693 0.845 1e-169
118488127 488 unknown [Populus trichocarpa] 0.994 0.717 0.857 1e-169
224104264452 predicted protein [Populus trichocarpa] 0.994 0.774 0.857 1e-169
21536893 510 putative NADH dehydrogenase (ubiquinone 0.997 0.688 0.840 1e-168
297826393 504 NDA2 H dehydrogenase 2 [Arabidopsis lyra 0.997 0.696 0.840 1e-168
18390737 510 alternative NAD(P)H dehydrogenase 1 [Ara 0.997 0.688 0.837 1e-167
297843508 509 hypothetical protein ARALYDRAFT_887930 [ 0.997 0.689 0.834 1e-167
15227684 508 NADH dehydrogenase [Arabidopsis thaliana 0.997 0.690 0.834 1e-167
356500874 485 PREDICTED: probable NADH dehydrogenase-l 0.994 0.721 0.82 1e-166
>gi|357490831|ref|XP_003615703.1| hypothetical protein MTR_5g071250 [Medicago truncatula] gi|355517038|gb|AES98661.1| hypothetical protein MTR_5g071250 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  602 bits (1551), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 294/348 (84%), Positives = 326/348 (93%)

Query: 2   KVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRR 61
           +V CETVT+  +TL+PWKF ISYDKLVIALGA+ +TFGIHGV E+A FLREV+HAQEIRR
Sbjct: 151 EVQCETVTEGTQTLDPWKFTISYDKLVIALGAQPTTFGIHGVYEHAIFLREVYHAQEIRR 210

Query: 62  KLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYI 121
           KLLLNLM+SDVPGISEEEK RLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRY+HVKDYI
Sbjct: 211 KLLLNLMMSDVPGISEEEKKRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYAHVKDYI 270

Query: 122 HVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLV 181
           HVTLIEANEILSSFDDRLRHYAT QL+KSGVRLVRGIVKDV  +K+ILNDGTEVPYGLLV
Sbjct: 271 HVTLIEANEILSSFDDRLRHYATNQLTKSGVRLVRGIVKDVQEKKIILNDGTEVPYGLLV 330

Query: 182 WSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALA 241
           WSTGVGPS  + SLDLPKSPGGRIGIDEWLRVPSVQD+F++GDCSG++ESTGK  LPALA
Sbjct: 331 WSTGVGPSPFIHSLDLPKSPGGRIGIDEWLRVPSVQDIFSIGDCSGFVESTGKPTLPALA 390

Query: 242 QVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQN 301
           QVAERQGKYL +LLN++G+A GGRANS KD++LG+ FVY+HLGSMAT+G YKALVDLRQN
Sbjct: 391 QVAERQGKYLAALLNKVGEANGGRANSMKDIDLGNQFVYKHLGSMATVGSYKALVDLRQN 450

Query: 302 KESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDI 349
           K++KGLSLAGFLSW VWRSAYLTRV+SWRNRFYVA+NWATTFVFGRDI
Sbjct: 451 KDAKGLSLAGFLSWFVWRSAYLTRVISWRNRFYVAINWATTFVFGRDI 498

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449450824|ref|XP_004143162.1| PREDICTED: alternative NAD(P)H dehydrogenase 1, mitochondrial-like [Cucumis sativus] gi|449523139|ref|XP_004168582.1| PREDICTED: alternative NAD(P)H dehydrogenase 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|118488127|gb|ABK95883.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104264|ref|XP_002313376.1| predicted protein [Populus trichocarpa] gi|222849784|gb|EEE87331.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|21536893|gb|AAM61225.1| putative NADH dehydrogenase (ubiquinone oxidoreductase) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297826393|ref|XP_002881079.1| NDA2 H dehydrogenase 2 [Arabidopsis lyrata subsp. lyrata] gi|297326918|gb|EFH57338.1| NDA2 H dehydrogenase 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18390737|ref|NP_563783.1| alternative NAD(P)H dehydrogenase 1 [Arabidopsis thaliana] gi|75328901|sp|Q8GWA1.1|NDA1_ARATH RecName: Full=Alternative NAD(P)H dehydrogenase 1, mitochondrial; AltName: Full=Internal non-phosphorylating NAD(P)H dehydrogenase 1; Short=AtNDI1; Flags: Precursor gi|26452964|dbj|BAC43558.1| unknown protein [Arabidopsis thaliana] gi|28973319|gb|AAO63984.1| unknown protein [Arabidopsis thaliana] gi|332189968|gb|AEE28089.1| alternative NAD(P)H dehydrogenase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297843508|ref|XP_002889635.1| hypothetical protein ARALYDRAFT_887930 [Arabidopsis lyrata subsp. lyrata] gi|297335477|gb|EFH65894.1| hypothetical protein ARALYDRAFT_887930 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15227684|ref|NP_180560.1| NADH dehydrogenase [Arabidopsis thaliana] gi|75318710|sp|O80874.1|NDA2_ARATH RecName: Full=Alternative NAD(P)H dehydrogenase 2, mitochondrial; Flags: Precursor gi|3420052|gb|AAC31853.1| putative NADH dehydrogenase (ubiquinone oxidoreductase) [Arabidopsis thaliana] gi|330253238|gb|AEC08332.1| NADH dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356500874|ref|XP_003519255.1| PREDICTED: probable NADH dehydrogenase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
TAIR|locus:2007427510 NDA1 "AT1G07180" [Arabidopsis 0.997 0.688 0.837 3.6e-160
TAIR|locus:2045708508 NDA2 "AT2G29990" [Arabidopsis 0.997 0.690 0.834 2e-159
TAIR|locus:2123713571 NDB1 "AT4G28220" [Arabidopsis 0.633 0.390 0.395 9.9e-60
DICTYBASE|DDB_G0270104451 DDB_G0270104 "putative NADH de 0.886 0.691 0.398 8.4e-58
TAIR|locus:2119667580 NDB3 "AT4G21490" [Arabidopsis 0.636 0.386 0.394 1.6e-57
TAIR|locus:2051431582 NDB4 "AT2G20800" [Arabidopsis 0.627 0.379 0.386 2e-55
ASPGD|ASPL0000060585570 ndiF [Emericella nidulans (tax 0.661 0.408 0.389 6.9e-53
DICTYBASE|DDB_G0290197654 DDB_G0290197 "putative NADH de 0.389 0.209 0.391 4e-50
UNIPROTKB|G4N8E7587 MGG_06276 "Uncharacterized pro 0.656 0.393 0.380 9.7e-50
DICTYBASE|DDB_G0295661584 DDB_G0295661 "pyridine nucleot 0.670 0.404 0.371 1e-49
TAIR|locus:2007427 NDA1 "AT1G07180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1560 (554.2 bits), Expect = 3.6e-160, P = 3.6e-160
 Identities = 294/351 (83%), Positives = 325/351 (92%)

Query:     2 KVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRR 61
             +VHCETVT+   TL+PWKFKI+YDKLV+A GAEASTFGI+GV ENA FLREVHHAQEIRR
Sbjct:   160 EVHCETVTEGSSTLKPWKFKIAYDKLVLACGAEASTFGINGVLENAIFLREVHHAQEIRR 219

Query:    62 KLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYI 121
             KLLLNLMLS+VPGI E+EK RLLHCVVVGGGPTGVEFSGELSDFIM+DVRQRYSHVKD I
Sbjct:   220 KLLLNLMLSEVPGIGEDEKKRLLHCVVVGGGPTGVEFSGELSDFIMKDVRQRYSHVKDDI 279

Query:   122 HVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLV 181
              VTLIEA +ILSSFDDRLRHYA  QL+KSGV+LVRGIVK+V  QKLIL+DGTEVPYG LV
Sbjct:   280 RVTLIEARDILSSFDDRLRHYAIKQLNKSGVKLVRGIVKEVKPQKLILDDGTEVPYGPLV 339

Query:   182 WSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALA 241
             WSTGVGPS+ V+SLD PK PGGRIGIDEW+RVPSVQDVFA+GDCSGYLESTGK+ LPALA
Sbjct:   340 WSTGVGPSSFVRSLDFPKDPGGRIGIDEWMRVPSVQDVFAIGDCSGYLESTGKSTLPALA 399

Query:   242 QVAERQGKYLFSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQN 301
             QVAER+GKYL +L N +GKAGGGRANSAK+MELG+PFVY+HLGSMATIGRYKALVDLR++
Sbjct:   400 QVAEREGKYLANLFNVMGKAGGGRANSAKEMELGEPFVYKHLGSMATIGRYKALVDLRES 459

Query:   302 KESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI 352
             KE KG+S+AGFLSW +WRSAYLTRVVSWRNRFYVA+NW TTFVFGRDISRI
Sbjct:   460 KEGKGISMAGFLSWFIWRSAYLTRVVSWRNRFYVAINWLTTFVFGRDISRI 510
GO:0003954 "NADH dehydrogenase activity" evidence=ISS;IMP
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0071482 "cellular response to light stimulus" evidence=IEP
GO:0031304 "intrinsic to mitochondrial inner membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
TAIR|locus:2045708 NDA2 "AT2G29990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123713 NDB1 "AT4G28220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0270104 DDB_G0270104 "putative NADH dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2119667 NDB3 "AT4G21490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051431 NDB4 "AT2G20800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000060585 ndiF [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290197 DDB_G0290197 "putative NADH dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8E7 MGG_06276 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0295661 DDB_G0295661 "pyridine nucleotide-disulphide oxidoreductase, NAD-binding region domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GWA1NDA1_ARATH1, ., 6, ., -, ., -0.83760.99710.6882yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IX.3717.1
SubName- Full=Putative uncharacterized protein; (452 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 1e-124
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 4e-79
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 5e-29
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 7e-22
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 2e-15
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 2e-14
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 1e-13
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 4e-13
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 1e-09
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 5e-08
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 3e-07
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 6e-07
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 8e-07
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 1e-06
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 3e-06
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 6e-06
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD 1e-05
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 3e-05
PLN02546558 PLN02546, PLN02546, glutathione reductase 3e-05
PLN02507499 PLN02507, PLN02507, glutathione reductase 6e-05
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 7e-05
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 7e-05
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 1e-04
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 2e-04
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 3e-04
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 4e-04
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 8e-04
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 0.002
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information 
 Score =  363 bits (933), Expect = e-124
 Identities = 155/335 (46%), Positives = 211/335 (62%), Gaps = 22/335 (6%)

Query: 20  FKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEE 79
           F + YDKLV+A GA  +TF I GV+E A FL+EV+HA+ IR++++  +  + +P  S EE
Sbjct: 110 FSVPYDKLVVAHGARPNTFNIPGVEERAFFLKEVNHARGIRKRIVQCIERASLPTTSVEE 169

Query: 80  KSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEA-NEILSSFDDR 138
           + RLLH VVVGGGPTGVEF+ EL+DF   DVR     + +   VT++EA +E+L SFD  
Sbjct: 170 RKRLLHFVVVGGGPTGVEFAAELADFFRDDVRNLNPELVEECKVTVLEAGSEVLGSFDQA 229

Query: 139 LRHYATTQLSKSGVRLV-RGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDL 197
           LR Y   +L + GV +  +  VK+V  ++++L DG  +P GL+VWSTGVGP  L K L +
Sbjct: 230 LRKYGQRRLRRLGVDIRTKTAVKEVLDKEVVLKDGEVIPTGLVVWSTGVGPGPLTKQLKV 289

Query: 198 PKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKYLFSLLNR 257
            K+  GRI +D+ LRV  + +VFA+GDC+    +  +  LP LAQVA +QG YL    N 
Sbjct: 290 DKTSRGRISVDDHLRVKPIPNVFALGDCA----ANEERPLPTLAQVASQQGVYLAKEFN- 344

Query: 258 IGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLV 317
                    N  K   +  PFVYR LGS+A +G Y A+V L          L+GF + L 
Sbjct: 345 ---------NELKGKPMSKPFVYRSLGSLAYLGNYSAIVQL------GAFDLSGFKALLF 389

Query: 318 WRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISRI 352
           WRSAYLT + SWR++ YV VNWA T +FGRDI+R 
Sbjct: 390 WRSAYLTILGSWRSKLYVLVNWAGTAIFGRDITRF 424

Length = 424
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 352
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.98
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.98
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.98
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.97
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.97
PRK07846451 mycothione reductase; Reviewed 99.97
PLN02507499 glutathione reductase 99.97
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.97
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.97
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.97
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.97
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.96
PRK06116450 glutathione reductase; Validated 99.96
PLN02546558 glutathione reductase 99.96
PRK06370463 mercuric reductase; Validated 99.96
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.96
PRK14727479 putative mercuric reductase; Provisional 99.96
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.96
TIGR02053463 MerA mercuric reductase. This model represents the 99.96
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.96
PRK14694468 putative mercuric reductase; Provisional 99.96
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.96
PRK13748561 putative mercuric reductase; Provisional 99.96
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.95
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.95
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.95
PTZ00052499 thioredoxin reductase; Provisional 99.95
PTZ00058561 glutathione reductase; Provisional 99.95
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.95
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.95
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.95
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.95
PTZ00153659 lipoamide dehydrogenase; Provisional 99.94
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.94
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.94
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.94
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.94
PRK10262321 thioredoxin reductase; Provisional 99.94
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.94
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.93
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.92
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.92
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.92
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.91
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.9
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.9
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.9
PRK12831464 putative oxidoreductase; Provisional 99.9
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.9
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.89
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.89
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.88
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.87
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.87
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.87
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.87
PRK13984604 putative oxidoreductase; Provisional 99.86
PRK12814652 putative NADPH-dependent glutamate synthase small 99.86
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.85
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.83
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.83
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.81
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.81
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.8
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.8
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.79
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.74
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.72
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.7
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.69
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.63
PLN02852491 ferredoxin-NADP+ reductase 99.63
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.48
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.48
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.38
KOG2755334 consensus Oxidoreductase [General function predict 99.35
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.31
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.19
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.19
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.08
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.91
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.87
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.84
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 98.81
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.74
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.69
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.68
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.67
COG2081408 Predicted flavoproteins [General function predicti 98.61
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.61
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.59
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.59
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.54
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.54
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.5
PRK06116 450 glutathione reductase; Validated 98.49
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.49
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.48
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.47
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.45
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 98.44
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.44
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.43
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.37
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.37
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.34
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.34
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.33
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 98.33
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.32
PRK06847375 hypothetical protein; Provisional 98.3
PRK10262321 thioredoxin reductase; Provisional 98.3
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.29
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.26
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 98.25
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.23
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 98.23
PRK07845 466 flavoprotein disulfide reductase; Reviewed 98.22
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.22
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.17
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 98.17
PLN02463 447 lycopene beta cyclase 98.16
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.16
PLN02546 558 glutathione reductase 98.15
PRK06370 463 mercuric reductase; Validated 98.15
PRK12831464 putative oxidoreductase; Provisional 98.14
TIGR02053 463 MerA mercuric reductase. This model represents the 98.13
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.12
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 98.12
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.11
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.11
PLN02852 491 ferredoxin-NADP+ reductase 98.09
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.08
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.06
PRK07236386 hypothetical protein; Provisional 98.06
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.06
KOG1336 478 consensus Monodehydroascorbate/ferredoxin reductas 98.04
PLN02661357 Putative thiazole synthesis 98.04
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 98.04
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 98.03
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.01
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.01
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 98.01
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 97.98
PRK06834 488 hypothetical protein; Provisional 97.97
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.97
PRK14694 468 putative mercuric reductase; Provisional 97.94
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.92
PTZ00058 561 glutathione reductase; Provisional 97.91
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.9
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 97.87
PRK08163396 salicylate hydroxylase; Provisional 97.87
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.86
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.85
PRK07588391 hypothetical protein; Provisional 97.85
PLN02507 499 glutathione reductase 97.85
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.85
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.84
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.82
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.81
PLN02697 529 lycopene epsilon cyclase 97.81
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 97.81
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.8
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.79
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.79
PTZ00188 506 adrenodoxin reductase; Provisional 97.78
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.77
PRK06184 502 hypothetical protein; Provisional 97.76
PRK05868372 hypothetical protein; Validated 97.75
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.75
PRK08244 493 hypothetical protein; Provisional 97.74
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.74
PRK07846 451 mycothione reductase; Reviewed 97.73
PRK13748 561 putative mercuric reductase; Provisional 97.71
PRK09126392 hypothetical protein; Provisional 97.69
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.68
PRK06753373 hypothetical protein; Provisional 97.67
PRK07190 487 hypothetical protein; Provisional 97.67
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 97.67
PRK09897 534 hypothetical protein; Provisional 97.66
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.65
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.65
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.65
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 97.64
PRK11728393 hydroxyglutarate oxidase; Provisional 97.63
KOG0404322 consensus Thioredoxin reductase [Posttranslational 97.63
PTZ00188506 adrenodoxin reductase; Provisional 97.63
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.63
PRK07045388 putative monooxygenase; Reviewed 97.62
PRK10157428 putative oxidoreductase FixC; Provisional 97.62
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.62
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.6
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.6
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.59
PRK08013400 oxidoreductase; Provisional 97.59
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.57
PTZ00052 499 thioredoxin reductase; Provisional 97.56
COG0579429 Predicted dehydrogenase [General function predicti 97.55
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.55
PRK06475400 salicylate hydroxylase; Provisional 97.53
PRK13984604 putative oxidoreductase; Provisional 97.52
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.51
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 97.5
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.5
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.5
KOG2755334 consensus Oxidoreductase [General function predict 97.49
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.48
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.47
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 97.47
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.46
PRK06996398 hypothetical protein; Provisional 97.46
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.46
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 97.44
KOG2495 491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.44
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.43
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.43
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.43
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.42
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.41
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 97.4
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.4
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.4
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 97.4
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.39
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.36
PRK06185407 hypothetical protein; Provisional 97.33
PRK10015 429 oxidoreductase; Provisional 97.32
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.31
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.28
PRK14727 479 putative mercuric reductase; Provisional 97.27
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.26
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.26
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.25
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 97.25
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 97.23
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.23
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.21
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 97.2
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.19
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.13
KOG03992142 consensus Glutamate synthase [Amino acid transport 97.1
PTZ00153 659 lipoamide dehydrogenase; Provisional 97.09
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.07
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 97.04
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.03
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.03
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.01
PRK07538413 hypothetical protein; Provisional 97.01
PRK06126 545 hypothetical protein; Provisional 96.91
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 96.88
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 96.86
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.78
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 96.73
PRK11445351 putative oxidoreductase; Provisional 96.72
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.64
PLN02985 514 squalene monooxygenase 96.6
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.59
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 96.57
PRK06481506 fumarate reductase flavoprotein subunit; Validated 96.48
PRK08401 466 L-aspartate oxidase; Provisional 96.37
PRK08294 634 phenol 2-monooxygenase; Provisional 96.37
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 96.25
KOG0405 478 consensus Pyridine nucleotide-disulphide oxidoredu 96.12
KOG1335 506 consensus Dihydrolipoamide dehydrogenase [Energy p 96.12
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.11
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 95.91
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 95.83
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.82
PRK09897534 hypothetical protein; Provisional 95.76
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.72
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.63
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 95.37
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 95.35
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 95.31
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 95.31
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 95.29
PRK07804 541 L-aspartate oxidase; Provisional 95.27
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 95.23
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.16
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 95.1
PRK06175433 L-aspartate oxidase; Provisional 95.06
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 95.02
PRK08275 554 putative oxidoreductase; Provisional 95.0
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 94.9
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.87
KOG2852 380 consensus Possible oxidoreductase [General functio 94.78
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.76
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 94.75
PTZ00367 567 squalene epoxidase; Provisional 94.57
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 94.55
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 94.55
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.46
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.45
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 94.45
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 94.44
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 94.25
PRK05562223 precorrin-2 dehydrogenase; Provisional 94.23
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 93.99
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 93.92
PRK11883 451 protoporphyrinogen oxidase; Reviewed 93.91
COG3349 485 Uncharacterized conserved protein [Function unknow 93.86
PRK00711 416 D-amino acid dehydrogenase small subunit; Validate 93.74
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 93.65
PLN02268 435 probable polyamine oxidase 93.63
PRK07233 434 hypothetical protein; Provisional 93.44
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 93.41
PLN02464 627 glycerol-3-phosphate dehydrogenase 93.4
PRK07208 479 hypothetical protein; Provisional 93.34
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 93.31
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.22
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.21
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.19
KOG1276 491 consensus Protoporphyrinogen oxidase [Coenzyme tra 93.18
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 93.1
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 93.08
PRK06719157 precorrin-2 dehydrogenase; Validated 93.07
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 92.92
KOG4716 503 consensus Thioredoxin reductase [Posttranslational 92.9
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 92.84
PRK12416 463 protoporphyrinogen oxidase; Provisional 92.74
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 92.68
PRK06249313 2-dehydropantoate 2-reductase; Provisional 92.54
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.47
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 92.42
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 92.4
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 92.39
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 92.39
KOG2853 509 consensus Possible oxidoreductase [General functio 92.39
PLN02576 496 protoporphyrinogen oxidase 92.27
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.05
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 92.02
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 91.83
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 91.82
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.74
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 91.63
PLN02529 738 lysine-specific histone demethylase 1 91.5
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.44
PRK12842 574 putative succinate dehydrogenase; Reviewed 91.28
PRK12921305 2-dehydropantoate 2-reductase; Provisional 91.25
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.05
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 90.98
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 90.93
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 90.92
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 90.85
PRK05257 494 malate:quinone oxidoreductase; Validated 90.85
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 90.67
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 90.63
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 90.63
PRK08274 466 tricarballylate dehydrogenase; Validated 90.32
PTZ00383 497 malate:quinone oxidoreductase; Provisional 90.28
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 90.15
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 90.06
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 90.03
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 90.03
PLN02487 569 zeta-carotene desaturase 89.71
PRK09231582 fumarate reductase flavoprotein subunit; Validated 89.7
PLN03000 881 amine oxidase 89.69
PRK08275554 putative oxidoreductase; Provisional 89.65
PLN02328 808 lysine-specific histone demethylase 1 homolog 89.62
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 89.6
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.55
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 89.41
COG2907 447 Predicted NAD/FAD-binding protein [General functio 89.2
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.98
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 88.9
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 88.79
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 88.75
PRK13339497 malate:quinone oxidoreductase; Reviewed 88.75
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 88.74
PRK07121 492 hypothetical protein; Validated 88.69
PRK08229341 2-dehydropantoate 2-reductase; Provisional 88.55
PRK02106 560 choline dehydrogenase; Validated 88.3
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.22
PLN02676 487 polyamine oxidase 88.02
PLN02612 567 phytoene desaturase 87.88
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 87.76
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 87.73
PRK07804541 L-aspartate oxidase; Provisional 87.71
TIGR02730493 carot_isom carotene isomerase. Members of this fam 87.62
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 87.6
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.49
PRK13977 576 myosin-cross-reactive antigen; Provisional 87.17
PRK08071510 L-aspartate oxidase; Provisional 87.14
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 87.1
PRK12842 574 putative succinate dehydrogenase; Reviewed 87.09
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 86.93
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 86.89
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 86.8
PRK11730 715 fadB multifunctional fatty acid oxidation complex 86.63
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 86.58
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 86.45
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 86.44
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 86.37
PLN02612567 phytoene desaturase 86.25
PRK10637 457 cysG siroheme synthase; Provisional 86.21
PRK09077536 L-aspartate oxidase; Provisional 86.19
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 86.18
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 86.08
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.96
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.93
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 85.88
cd01483143 E1_enzyme_family Superfamily of activating enzymes 85.81
PLN02568 539 polyamine oxidase 85.75
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 85.73
PTZ00383497 malate:quinone oxidoreductase; Provisional 85.69
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 85.64
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 85.19
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 85.05
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 85.01
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 84.99
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 84.96
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 84.88
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 84.83
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.83
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 84.79
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 84.78
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 84.77
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 84.74
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 84.69
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 84.59
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 84.56
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 84.53
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 84.43
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 84.36
PLN02602350 lactate dehydrogenase 84.22
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 84.13
PRK04148134 hypothetical protein; Provisional 83.96
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 83.94
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 83.86
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 83.83
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 83.82
PRK08401466 L-aspartate oxidase; Provisional 83.78
COG0569225 TrkA K+ transport systems, NAD-binding component [ 83.74
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 83.72
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 83.69
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 83.64
PRK07512513 L-aspartate oxidase; Provisional 83.63
PRK08328231 hypothetical protein; Provisional 83.56
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 83.52
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 83.45
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 83.41
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 83.25
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 83.14
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 83.06
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 82.97
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 82.95
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 82.9
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 82.87
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 82.83
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 82.78
COG0421282 SpeE Spermidine synthase [Amino acid transport and 82.78
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 82.7
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 82.69
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 82.66
PF01134392 GIDA: Glucose inhibited division protein A; InterP 82.59
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 82.59
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 82.45
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 82.43
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 82.26
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 82.17
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 81.91
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 81.75
PLN02785 587 Protein HOTHEAD 81.74
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 81.7
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.68
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 81.68
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 81.64
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 81.62
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 81.49
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 81.43
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 81.28
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 81.24
PRK06153393 hypothetical protein; Provisional 81.23
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.08
PRK13339 497 malate:quinone oxidoreductase; Reviewed 80.68
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 80.36
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 80.03
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-64  Score=458.95  Aligned_cols=325  Identities=52%  Similarity=0.862  Sum_probs=295.3

Q ss_pred             eeEeeCCEEEEcCCCCCCCCCCCCccccCcCCCCHHHHHHHHHHHHHHHhhccCCCCCHHHhccCCcEEEECCChHHHHH
Q 018671           19 KFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEF   98 (352)
Q Consensus        19 ~~~i~yD~LViAtGs~~~~~~ipG~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvVvGgG~~g~e~   98 (352)
                      ...+.|||||+|+|+.++.++|||+.||+++++.++||.++|.++.+++|.++.|+..++++++.+++|||||||+|+|+
T Consensus       154 e~~i~YDyLViA~GA~~~TFgipGV~e~~~FLKEv~dAqeIR~~~~~~le~a~~~~l~~eerkRlLh~VVVGGGPTGVEF  233 (491)
T KOG2495|consen  154 EFVIGYDYLVIAVGAEPNTFGIPGVEENAHFLKEVEDAQEIRRKVIDNLEKAELPGLSDEERKRLLHFVVVGGGPTGVEF  233 (491)
T ss_pred             eeeecccEEEEeccCCCCCCCCCchhhchhhhhhhhHHHHHHHHHHHHHHHhhcCCCChHHhhheEEEEEECCCCcceee
Confidence            36899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhHhhHHHhhcCCCCCccEEEEEeCC-CCCCCCcHHHHHHHHHHHHhCCCEEEeC-ceEEEECCeEEEcCC----
Q 018671           99 SGELSDFIMRDVRQRYSHVKDYIHVTLIEAN-EILSSFDDRLRHYATTQLSKSGVRLVRG-IVKDVDSQKLILNDG----  172 (352)
Q Consensus        99 A~~l~~~~~~~~~~~~~~~~~~~~V~lv~~~-~~l~~~~~~~~~~~~~~l~~~gV~v~~~-~V~~v~~~~v~~~~g----  172 (352)
                      |+||+++..+++.+-||++.++.+|||+++. .+|+.|+..+.+++++.+.+.+|++.++ .|+.|+++.++.+++    
T Consensus       234 AaEL~Dfi~~Dl~k~yp~l~~~i~vtLiEA~d~iL~mFdkrl~~yae~~f~~~~I~~~~~t~Vk~V~~~~I~~~~~~g~~  313 (491)
T KOG2495|consen  234 AAELADFIPEDLRKIYPELKKDIKVTLIEAADHILNMFDKRLVEYAENQFVRDGIDLDTGTMVKKVTEKTIHAKTKDGEI  313 (491)
T ss_pred             hHHHHHHHHHHHHHhhhcchhheEEEeeccchhHHHHHHHHHHHHHHHHhhhccceeecccEEEeecCcEEEEEcCCCce
Confidence            9999999999999999999999999999998 6999999999999999999999999999 799999998887655    


Q ss_pred             cEEecceEEEecCCCcchhhhhcCCCCCCCC--ccccCCccccCCCCCEEEEccccccccCCCCcCCCCchHHHHHHHHH
Q 018671          173 TEVPYGLLVWSTGVGPSTLVKSLDLPKSPGG--RIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQVAERQGKY  250 (352)
Q Consensus       173 ~~i~~D~vi~a~G~~~~~~~~~~~l~~~~~G--~i~Vd~~l~~~~~~~IfaiGD~a~~~~~~~~~~~~~~~~~A~~qg~~  250 (352)
                      ++|||.+++|+||..|.++.+.+....++.|  ++.||++||+++.+||||+|||+..      ..++++||+|.|||.+
T Consensus       314 ~~iPYG~lVWatG~~~rp~~k~lm~~i~e~~rr~L~vDE~LrV~G~~nvfAiGDca~~------~~~~~tAQVA~QqG~y  387 (491)
T KOG2495|consen  314 EEIPYGLLVWATGNGPRPVIKDLMKQIDEQGRRGLAVDEWLRVKGVKNVFAIGDCADQ------RGLKPTAQVAEQQGAY  387 (491)
T ss_pred             eeecceEEEecCCCCCchhhhhHhhcCCccCceeeeeeceeeccCcCceEEecccccc------ccCccHHHHHHHHHHH
Confidence            6899999999999999999998887777777  8999999999999999999999943      2357799999999999


Q ss_pred             HHHHHHHHhhhCCCCCCCc-cc----CCCCCCceeeccceEEEecCcceeeeccccccCCCeEeecHHHHHHHHHHHHHh
Q 018671          251 LFSLLNRIGKAGGGRANSA-KD----MELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTR  325 (352)
Q Consensus       251 ~a~~i~~~~~~~~g~~~~~-~~----~~~~~~f~~~~~g~~~~lG~~~av~~~~~~~~~~~~~~~G~~~~~~~~~~~l~~  325 (352)
                      +|++++.+.+..+....+. ..    ....+||+|+++|.+++||+.+|+++++..   ..+...|..+|++|+++||.+
T Consensus       388 LAk~fn~m~k~~~~~e~~~~r~~~~~~~~f~PF~Y~H~GalA~lG~ekaiAdl~~g---~~~~~~G~~s~~lWrS~Yls~  464 (491)
T KOG2495|consen  388 LAKNFNKMGKGGNLPEGPSARLRGEGRHQFKPFKYKHLGALAYLGREKAIADLPVG---KMWVSAGGSSFWLWRSAYLSK  464 (491)
T ss_pred             HHHHHHHHhcccCCCccchhhhhhhhhhccCCcccccccceeeccccchhhcCccC---CeeeeccchhhHHHHHHHHHH
Confidence            9999999887443311111 11    111289999999999999999999999732   338999999999999999999


Q ss_pred             cCCcchhHHhHHHHHHHhccCCCCCCC
Q 018671          326 VVSWRNRFYVAVNWATTFVFGRDISRI  352 (352)
Q Consensus       326 ~~~~~~~~~~~~~w~~~~~~~~~~~~~  352 (352)
                      ..+||+|+.|++||+..++||||++++
T Consensus       465 ~~S~R~R~lV~~dW~~~~~fGRd~s~i  491 (491)
T KOG2495|consen  465 LVSWRNRFLVAIDWEKTFFFGRDSSSI  491 (491)
T ss_pred             hhhhhhheeeeeheeeeEEeccccccC
Confidence            999999999999999999999999985

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
4g6g_A502 Crystal Structure Of Ndh With Trt Length = 502 5e-37
4g9k_A471 Structure Of The Ndi1 Protein From Saccharomyces Ce 7e-37
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 2e-07
1q1r_A431 Crystal Structure Of Putidaredoxin Reductase From P 7e-06
3lb8_A436 Crystal Structure Of The Covalent Putidaredoxin Red 7e-06
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 1e-05
3icr_A 588 Crystal Structure Of Oxidized Bacillus Anthracis Co 1e-05
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 1e-05
2cdu_A452 The Crystal Structure Of Water-Forming Nad(P)h Oxid 3e-05
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 4e-05
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 1e-04
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 1e-04
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 1e-04
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 1e-04
3ntd_A 565 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 2e-04
3hyw_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 2e-04
3hyv_A430 3-D X-Ray Structure Of The Sulfide:quinone Oxidored 2e-04
1nhr_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 3e-04
1nhs_A447 An L40c Mutation Converts The Cysteine-Sulfenic Aci 3e-04
3oc4_A452 Crystal Structure Of A Pyridine Nucleotide-Disulfid 3e-04
1nhp_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 4e-04
1nhq_A447 Crystallographic Analyses Of Nadh Peroxidase Cys42a 4e-04
1joa_A447 Nadh Peroxidase With Cysteine-Sulfenic Acid Length 4e-04
1f8w_A447 Crystal Structure Of Nadh Peroxidase Mutant: R303m 5e-04
1lvl_A458 The Refined Structure Of Pseudomonas Putida Lipoami 5e-04
>pdb|4G6G|A Chain A, Crystal Structure Of Ndh With Trt Length = 502 Back     alignment and structure 
Iteration: 1

 Score =  151 bits (381), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 114/361 (31%), Positives = 195/361 (54%), Gaps = 33/361 (9%)
Query: 12  LRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSD 71
           L   EP +  I YD L+ A+GAE +TFGI GV +   FL+E+ ++ EIRR    NL  ++
Sbjct: 148 LHQAEPAE--IKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKAN 205
Query: 72  VPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEI 131
           +    + E+ RLL  VVVGGGPTGVE +GEL D++ +D+R+    + + + + L+EA  I
Sbjct: 206 LLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPI 265
Query: 132 -LSSFDDRLRHYATTQLSKSGVRL-VRGIVKDVDSQKLILNDGTE--------VPYGLLV 181
            L+ F+ +L  YA + L  + +++ +R  V  V+ ++L+     E        +PYG L+
Sbjct: 266 VLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLI 325
Query: 182 WSTGVGPSTLVKSL--DLPKSPGGRIG--IDEWLRVPSVQDVFAVGDCSGYLESTGKTVL 237
           W+TG     ++  L   +P+    + G  ++++L+V    ++FA+GD +          L
Sbjct: 326 WATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAF-------AGL 378
Query: 238 PALAQVAERQGKYLFSLLNRIGKAGGGRAN--SAKD-----MELGD--PFVYRHLGSMAT 288
           P  AQVA ++ +YL    +++ +    + N  S KD      E  +  PF Y  LG++A 
Sbjct: 379 PPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAY 438
Query: 289 IGRYKALVDLRQNKESKGLSLAGFLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRD 348
           +G  +A+  +R  K +   +  G +++ +WR  YL+ ++S R+R  V  +W     F RD
Sbjct: 439 LGSERAIATIRSGKRT-FYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRD 497
Query: 349 I 349
Sbjct: 498 F 498
>pdb|4G9K|A Chain A, Structure Of The Ndi1 Protein From Saccharomyces Cerevisiae Length = 471 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|1Q1R|A Chain A, Crystal Structure Of Putidaredoxin Reductase From Pseudomonas Putida Length = 431 Back     alignment and structure
>pdb|3LB8|A Chain A, Crystal Structure Of The Covalent Putidaredoxin Reductase- Putidaredoxin Complex Length = 436 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|2CDU|A Chain A, The Crystal Structure Of Water-Forming Nad(P)h Oxidase From Lactobacillus Sanfranciscensis Length = 452 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|3NTD|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C531s Mutant Length = 565 Back     alignment and structure
>pdb|3HYW|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase Of The Hyperthermophilic Bacterium Aquifex Aeolicus In Complex With Decylubiquinone Length = 430 Back     alignment and structure
>pdb|3HYV|A Chain A, 3-D X-Ray Structure Of The Sulfide:quinone Oxidoreductase From The Hyperthermophilic Bacterium Aquifex Aeolicus Length = 430 Back     alignment and structure
>pdb|1NHR|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|1NHS|A Chain A, An L40c Mutation Converts The Cysteine-Sulfenic Acid Redox Centre In Enterococcal Nadh Peroxidase To A Disulfide Length = 447 Back     alignment and structure
>pdb|3OC4|A Chain A, Crystal Structure Of A Pyridine Nucleotide-Disulfide Family Oxidoreductase From The Enterococcus Faecalis V583 Length = 452 Back     alignment and structure
>pdb|1NHP|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1NHQ|A Chain A, Crystallographic Analyses Of Nadh Peroxidase Cys42ala And Cys42ser Mutants: Active Site Structure, Mechanistic Implications, And An Unusual Environment Of Arg303 Length = 447 Back     alignment and structure
>pdb|1JOA|A Chain A, Nadh Peroxidase With Cysteine-Sulfenic Acid Length = 447 Back     alignment and structure
>pdb|1F8W|A Chain A, Crystal Structure Of Nadh Peroxidase Mutant: R303m Length = 447 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 1e-33
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 4e-31
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 9e-04
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 1e-30
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 7e-30
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 5e-29
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 8e-29
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 2e-28
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 3e-26
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 5e-26
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 2e-25
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 3e-25
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 1e-24
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 4e-24
1fec_A490 Trypanothione reductase; redox-active center, oxid 8e-16
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 1e-15
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 6e-15
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 2e-14
4dna_A463 Probable glutathione reductase; structural genomic 7e-14
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 1e-13
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 2e-13
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 4e-13
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 8e-13
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 3e-12
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 9e-12
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 2e-11
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 2e-11
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 2e-11
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 3e-11
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 3e-11
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 3e-11
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 4e-11
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 5e-11
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 5e-11
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 7e-11
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 7e-11
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 1e-10
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 1e-10
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 2e-10
4fk1_A304 Putative thioredoxin reductase; structural genomic 5e-10
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 6e-09
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 1e-06
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 6e-06
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 1e-05
1fcd_A 401 Flavocytochrome C sulfide dehydrogenase (flavin- b 1e-05
1fcd_A401 Flavocytochrome C sulfide dehydrogenase (flavin- b 2e-04
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 1e-04
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 2e-04
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 4e-04
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
 Score =  127 bits (321), Expect = 1e-33
 Identities = 51/316 (16%), Positives = 105/316 (33%), Gaps = 29/316 (9%)

Query: 11  ELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLL----LN 66
                +    +  YD +++ +GA  +T  + G  +    + E   A ++R KL      N
Sbjct: 89  YYTKPDGSMAEEEYDYVIVGIGAHLATELVKGWDKYGYSVCEPEFATKLREKLESFQGGN 148

Query: 67  LMLSDVPGISEEEKSRLLHCVVVGGGP-TGVEFSGELSDFIMRDVRQRYSHVKDYIHVTL 125
           + +   P          +    V            E+S  ++    ++   + D +HVT+
Sbjct: 149 IAIGSGPFYQGHNPKPKVPENFVPNADSACEGPVFEMS-LMLHGYFKKK-GMLDKVHVTV 206

Query: 126 IEANEILSSFDDRLRHYATTQLSKSGVRLVRG-IVKDVDSQKLILNDGTEVPYGLLVWST 184
               E LS      R    +  ++ G++LV    +K++   +++   G  +P  + +   
Sbjct: 207 FSPGEYLSDLSPNSRKAVASIYNQLGIKLVHNFKIKEIREHEIVDEKGNTIPADITILLP 266

Query: 185 GVGPSTLVK-SLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALAQV 243
               +  +K S       GG I  D  +      +V+AVGD +    +  K        +
Sbjct: 267 PYTGNPALKNSTPDLVDDGGFIPTDLNMVSIKYDNVYAVGDANSM--TVPKL-----GYL 319

Query: 244 AERQGKYL-FSLLNRIGKAGGGRANSAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNK 302
           A   G+     L NR+   G                    +  +A        V ++ + 
Sbjct: 320 AVMTGRIAAQHLANRL---GVPTKVDKYYP---------TIVCVADNPYEGYAVSVKDDT 367

Query: 303 ESKGLSLAGFLSWLVW 318
              G       + +  
Sbjct: 368 WYGGTVSIADPAAVNH 383
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.98
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.98
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.97
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.97
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.97
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.97
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.97
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.97
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.97
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.97
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.97
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.97
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.97
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.97
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.97
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.96
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.96
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.96
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.96
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.96
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.96
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.96
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.96
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.96
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.96
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.96
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.96
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.96
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.96
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.96
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.96
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.96
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.96
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.96
4dna_A463 Probable glutathione reductase; structural genomic 99.96
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.96
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.96
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.95
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.95
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.95
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.95
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.95
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.95
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.95
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.95
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.95
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.95
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.95
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.95
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.95
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.95
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.94
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.94
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.94
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.94
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.94
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.94
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.94
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.94
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.93
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.93
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.93
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.93
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.93
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.93
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.93
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.91
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.91
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.91
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.9
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.88
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.88
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.87
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.86
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.86
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.85
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.84
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.84
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.82
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.81
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.8
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.77
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.75
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.73
2cul_A232 Glucose-inhibited division protein A-related PROT 99.7
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.45
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.23
2bry_A 497 NEDD9 interacting protein with calponin homology a 98.95
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.83
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.82
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.78
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.74
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.73
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.72
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.67
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.66
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.64
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.62
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.62
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.61
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.61
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.61
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.6
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.58
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.57
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.55
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.55
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.55
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 98.53
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 98.51
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.51
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 98.5
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.49
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.49
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.48
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.48
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.45
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.44
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.44
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.44
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.44
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.43
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.41
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.41
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.37
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.37
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.35
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.34
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 98.34
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.32
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.32
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 98.31
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.3
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.3
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.29
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.29
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 98.28
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.28
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.28
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 98.27
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.27
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 98.26
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.26
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.26
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.25
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.25
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.25
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.25
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.24
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.24
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.24
4dna_A 463 Probable glutathione reductase; structural genomic 98.23
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 98.21
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.21
1fec_A 490 Trypanothione reductase; redox-active center, oxid 98.2
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.2
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.2
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.18
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 98.18
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.17
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 98.17
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.17
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.16
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.16
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 98.15
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.15
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.12
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.11
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.11
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 98.11
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.1
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.1
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.1
3dme_A369 Conserved exported protein; structural genomics, P 98.09
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.08
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.08
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.08
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.08
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.07
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.02
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.01
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.01
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.01
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.01
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 98.01
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.0
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.99
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.98
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.97
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.97
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.97
1ojt_A 482 Surface protein; redox-active center, glycolysis, 97.96
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.95
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 97.94
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.93
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.89
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.89
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.88
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.88
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.87
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.87
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.87
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.86
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.83
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.82
3atr_A 453 Conserved archaeal protein; saturating double bond 97.81
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.79
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.79
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.79
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.79
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.79
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.78
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.77
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.77
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.77
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.77
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.76
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.76
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.74
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.71
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.71
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.7
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.65
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.64
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.62
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.58
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.58
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.52
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.47
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.44
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.41
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.41
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.39
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.34
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.34
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.33
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.28
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.24
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.14
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 97.0
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.95
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.66
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.65
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.58
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.58
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 96.45
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 96.44
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.32
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 96.25
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 95.92
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.8
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.47
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.4
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 95.09
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.07
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 94.8
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 94.71
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 94.57
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 94.44
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 94.33
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 94.04
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 94.04
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 93.97
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 93.83
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 93.64
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 93.48
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 93.22
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 93.17
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 93.14
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.13
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.07
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 92.97
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 92.61
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 92.6
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 92.33
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 92.29
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 92.28
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 92.17
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 92.04
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 92.02
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 91.96
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 91.85
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 91.68
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 91.62
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 91.44
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 91.42
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 91.32
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 91.31
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 91.2
1id1_A153 Putative potassium channel protein; RCK domain, E. 91.14
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 91.13
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 91.08
1lss_A140 TRK system potassium uptake protein TRKA homolog; 91.07
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 90.9
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 90.89
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.74
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 90.45
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.13
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 90.12
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 89.88
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 89.61
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 89.47
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 89.22
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 89.12
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 89.02
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 88.86
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 88.83
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 88.68
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 88.53
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 88.47
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 88.21
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.19
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 87.91
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 87.89
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 87.7
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 87.63
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 87.6
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 87.6
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 87.3
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.25
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 86.96
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 86.23
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 85.2
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 85.12
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 84.95
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 84.36
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 84.34
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 84.34
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 83.99
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 83.85
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 83.77
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 83.75
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 83.44
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 83.13
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 82.92
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 82.88
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 82.67
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 82.36
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 82.28
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 81.85
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 81.77
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 80.74
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 80.69
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 80.47
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 80.3
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 80.12
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 80.06
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 80.04
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
Probab=100.00  E-value=9.3e-63  Score=482.37  Aligned_cols=327  Identities=32%  Similarity=0.608  Sum_probs=280.1

Q ss_pred             CCCeeEeeCCEEEEcCCCCCCCCCCCCccccCcCCCCHHHHHHHHHHHHHHHhhccCCCCCHHHhccCCcEEEECCChHH
Q 018671           16 EPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTG   95 (352)
Q Consensus        16 ~~~~~~i~yD~LViAtGs~~~~~~ipG~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvVvGgG~~g   95 (352)
                      .+++.+++||+||||||++|+++++||++++++++++++|+.++++++.++++.+..+...+++++..++++|||||++|
T Consensus       150 ~~~~~~i~YD~LViAtGs~~~~~~ipG~~e~a~~l~t~~dA~~ir~~l~~~~e~a~~~~~~~~~~~~~~~vvVvGgG~tG  229 (502)
T 4g6h_A          150 QAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTG  229 (502)
T ss_dssp             TTCCEEEECSEEEECCCCEECCTTCTTHHHHCEECSSHHHHHHHHHHHHHHHHHHHHSCTTCHHHHHHTEEEEECCSHHH
T ss_pred             cCCceEEeCCEEEEcCCcccccCCccCcccccCCCCCHHHHHHHHHHHHHHHHHHhcccccchhhccccceEEECCCcch
Confidence            35678999999999999999999999999999999999999999999999998877655555666777899999999999


Q ss_pred             HHHHHHHHHhHhhHHHhhcCCCCCccEEEEEeCC-CCCCCCcHHHHHHHHHHHHhCCCEEEeC-ceEEEECCeEEE----
Q 018671           96 VEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEAN-EILSSFDDRLRHYATTQLSKSGVRLVRG-IVKDVDSQKLIL----  169 (352)
Q Consensus        96 ~e~A~~l~~~~~~~~~~~~~~~~~~~~V~lv~~~-~~l~~~~~~~~~~~~~~l~~~gV~v~~~-~V~~v~~~~v~~----  169 (352)
                      +|+|.+|+++.+..+.+.|+.+.++.+|+|+++. +++|.+++++++.+.+.|+++||+++++ +|++++++.+.+    
T Consensus       230 vE~A~~l~~~~~~~l~~~~~~~~~~~~V~lve~~~~il~~~~~~~~~~~~~~L~~~GV~v~~~~~v~~v~~~~~~~~~~~  309 (502)
T 4g6h_A          230 VEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKH  309 (502)
T ss_dssp             HHHHHHHHHHHHHTHHHHCHHHHHHCEEEEECSSSSSSTTSCHHHHHHHHHHHHHTTCEEETTEEEEEECSSEEEEEEEC
T ss_pred             hhhHHHHHHHHHHHHHhhcccccccceeEEeccccccccCCCHHHHHHHHHHHHhcceeeecCceEEEEeCCceEEEEEe
Confidence            9999999999877776667666667899999997 7999999999999999999999999999 899999997765    


Q ss_pred             cCC----cEEecceEEEecCCCcchhhh----hcCCCCCCCCccccCCccccCCCCCEEEEccccccccCCCCcCCCCch
Q 018671          170 NDG----TEVPYGLLVWSTGVGPSTLVK----SLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYLESTGKTVLPALA  241 (352)
Q Consensus       170 ~~g----~~i~~D~vi~a~G~~~~~~~~----~~~l~~~~~G~i~Vd~~l~~~~~~~IfaiGD~a~~~~~~~~~~~~~~~  241 (352)
                      .||    +++++|++|||+|.+|+++..    .+++..+.+|+|.||++||++++|||||+|||+..       +.|+++
T Consensus       310 ~dg~~~~~~i~ad~viwa~Gv~~~~~~~~l~~~~~~~~~~~g~I~Vd~~lq~~~~~~IfAiGD~a~~-------~~p~~a  382 (502)
T 4g6h_A          310 EDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFA-------GLPPTA  382 (502)
T ss_dssp             TTSCEEEEEEECSEEEECCCEECCHHHHHHHHHSGGGTTCCSSEEBCTTSBBTTCSSEEECGGGEES-------SSCCCH
T ss_pred             cCcccceeeeccCEEEEccCCcCCHHHHhHHHhccccccCCCceeECCccccCCCCCEEEEEcccCC-------CCCCch
Confidence            355    369999999999999986544    34566677899999999999999999999999974       458999


Q ss_pred             HHHHHHHHHHHHHHHHHhhhC------CCCCC----CcccCCCCCCceeeccceEEEecCcceeeeccccccCCCeEeec
Q 018671          242 QVAERQGKYLFSLLNRIGKAG------GGRAN----SAKDMELGDPFVYRHLGSMATIGRYKALVDLRQNKESKGLSLAG  311 (352)
Q Consensus       242 ~~A~~qg~~~a~~i~~~~~~~------~g~~~----~~~~~~~~~~f~~~~~g~~~~lG~~~av~~~~~~~~~~~~~~~G  311 (352)
                      +.|.+||+++|+||.+..+..      ..+..    .....++ +||+|+++|+|++||+++||+++.+... ..+.+.|
T Consensus       383 ~~A~qqg~~~A~ni~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~pF~y~~~G~~a~lG~~~av~~~~~~~~-~~~~~~G  460 (502)
T 4g6h_A          383 QVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNF-KPFKYNDLGALAYLGSERAIATIRSGKR-TFYTGGG  460 (502)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCHHHHHHTTSSSCCHHHHHHHTTC-CCCCCCCCEEEEECSTTCEEEEEEETTE-EEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHhccchhhhhhhhccchhhhhhcCCCC-CCCEecCcceEEEEeCCceEEEccCCCc-cceeccc
Confidence            999999999999998754310      00000    0011234 8999999999999999999999864322 3367789


Q ss_pred             HHHHHHHHHHHHHhcCCcchhHHhHHHHHHHhccCCCCCC
Q 018671          312 FLSWLVWRSAYLTRVVSWRNRFYVAVNWATTFVFGRDISR  351 (352)
Q Consensus       312 ~~~~~~~~~~~l~~~~~~~~~~~~~~~w~~~~~~~~~~~~  351 (352)
                      +++|++|+++|++++++||||+.++++|++.+||+||++|
T Consensus       461 ~~a~~~w~~~yl~~l~~~r~r~~v~~~W~~~~~fgRdisr  500 (502)
T 4g6h_A          461 LMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFK  500 (502)
T ss_dssp             HHHHHHHHHHHHHHCSCHHHHHHHHHHHHHHHHSCCCCCT
T ss_pred             HHHHHHHHHHHHHHccchhhhHHHHHHHHHHHhCCCCCcC
Confidence            9999999999999999999999999999999999999997
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 352
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 2e-10
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 1e-09
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 2e-09
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 1e-08
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 1e-07
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 5e-07
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 1e-06
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 1e-06
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-05
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 2e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 3e-04
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 5e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 6e-04
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 7e-04
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 8e-04
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 0.001
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 0.003
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH-dependent ferredoxin reductase, BphA4
species: Pseudomonas sp., KKS102 [TaxId: 306]

 Score = 57.4 bits (137), Expect = 2e-10
 Identities = 36/171 (21%), Positives = 66/171 (38%), Gaps = 7/171 (4%)

Query: 87  VVVGGGPTGVEFSGELSDFIMR-DVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATT 145
           VV+G G   V F  EL     +  +       +       +  + +     +++R     
Sbjct: 7   VVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHGDAEKIRLDCKR 66

Query: 146 QLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPG--- 202
                 +  V     D  +  + L+DG  +PYG LV +TG  P  ++ +  L ++ G   
Sbjct: 67  APEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGTLVLATGAAPRAVLANDALARAAGLAC 126

Query: 203 -GRIGIDEWLRVPSVQDVFAVGDC-SGYLESTGKTVLPALAQVAERQGKYL 251
              I +D + R  +  DV+A+GD        +G+         A+ QG  +
Sbjct: 127 DDGIFVDAYGR-TTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAV 176
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.9
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.89
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.89
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.88
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.88
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.85
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.84
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.83
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.78
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.76
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.75
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.75
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.74
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.74
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.74
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.74
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.72
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.71
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.7
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.7
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.7
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.69
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.66
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.66
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.65
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.63
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.63
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.62
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.61
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.61
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.61
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.58
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.58
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.56
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.55
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.53
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.53
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.53
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.48
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.46
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.38
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.19
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.18
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.17
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.12
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.0
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.99
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.9
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.88
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.88
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.81
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.77
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.61
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.59
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.57
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.53
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.47
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.45
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.45
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 98.44
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.38
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.36
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.35
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.25
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.24
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.23
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.22
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.2
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.14
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.14
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.09
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.07
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.97
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.93
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.93
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.76
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.75
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.66
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.64
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.59
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.58
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.54
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.32
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.21
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.79
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.77
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 96.76
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.74
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.63
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.62
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.17
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.82
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.76
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.53
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.38
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 95.36
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.54
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.51
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 94.43
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.28
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 94.17
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.07
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.0
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.75
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 93.29
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.29
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.01
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.81
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 92.78
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.6
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.3
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.29
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.18
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 92.06
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 91.0
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.92
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.8
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 90.29
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 89.75
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.74
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.12
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 88.61
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.72
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.31
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 86.87
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 86.6
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 86.51
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 86.41
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 86.37
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 86.22
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 86.12
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 85.62
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 85.18
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 84.56
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 84.13
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 81.69
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.08
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 80.89
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 80.82
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 80.62
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 80.53
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 80.32
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH oxidase /nitrite reductase
species: Pyrococcus furiosus [TaxId: 2261]

Probab=99.90  E-value=3e-23  Score=171.26  Aligned_cols=149  Identities=30%  Similarity=0.488  Sum_probs=120.2

Q ss_pred             cEEEECCChHHHHHHHHHHHhHhhHHHhhcCCCCCccEEEEEeCCCCCCCCcHHH-------------HHHHHHHHHhCC
Q 018671           85 HCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRL-------------RHYATTQLSKSG  151 (352)
Q Consensus        85 ~vvVvGgG~~g~e~A~~l~~~~~~~~~~~~~~~~~~~~V~lv~~~~~l~~~~~~~-------------~~~~~~~l~~~g  151 (352)
                      +|+|||||++|+|+|..|++ .              .+||++++.+.....++.+             .....+.+++.+
T Consensus         2 rVvIIGgG~~G~e~A~~l~~-~--------------~~Vtvv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   66 (167)
T d1xhca1           2 KVVIVGNGPGGFELAKQLSQ-T--------------YEVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLDWYRKRG   66 (167)
T ss_dssp             EEEEECCSHHHHHHHHHHTT-T--------------SEEEEECSSSSCCCCSTTHHHHHTTSSCGGGGCSSCHHHHHHHT
T ss_pred             eEEEECCcHHHHHHHHHHHc-C--------------CCEEEEeccccccccccchhhhhhhhhhhhhhhHHHHHHHHhcc
Confidence            89999999999999998864 2              6899998764322222222             222345677889


Q ss_pred             CEEEeC-ceEEEECC-eEEEcCCcEEecceEEEecCCCcchhhhhcCCCCCCCCccccCCccccCCCCCEEEEccccccc
Q 018671          152 VRLVRG-IVKDVDSQ-KLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGRIGIDEWLRVPSVQDVFAVGDCSGYL  229 (352)
Q Consensus       152 V~v~~~-~V~~v~~~-~v~~~~g~~i~~D~vi~a~G~~~~~~~~~~~l~~~~~G~i~Vd~~l~~~~~~~IfaiGD~a~~~  229 (352)
                      ++++.+ .+++++.+ .+.+.++++++||.++||+|..|+++....+++.+.  .+.||+++|+ +.|+|||+|||+..+
T Consensus        67 v~~~~~~~v~~i~~~~~~~~~~~~~i~~D~li~a~G~~~~~~~~~~gl~~~~--~i~v~~~~~t-~~~~i~aiGD~~~~~  143 (167)
T d1xhca1          67 IEIRLAEEAKLIDRGRKVVITEKGEVPYDTLVLATGAPNVDLARRSGIHTGR--GILIDDNFRT-SAKDVYAIGDCAEYS  143 (167)
T ss_dssp             EEEECSCCEEEEETTTTEEEESSCEEECSEEEECCCEECCHHHHHTTCCBSS--SEECCTTSBC-SSTTEEECGGGEEBT
T ss_pred             ceeeeeccccccccccccccccccccccceeEEEEEecCCchhhhcCceeCC--ceeeccccEe-cCCCeEEeeecccCC
Confidence            999998 79999865 577788889999999999999888888888887653  4999999998 899999999999753


Q ss_pred             cCCCCcCCCCchHHHHHHHHHHHHHHH
Q 018671          230 ESTGKTVLPALAQVAERQGKYLFSLLN  256 (352)
Q Consensus       230 ~~~~~~~~~~~~~~A~~qg~~~a~~i~  256 (352)
                           .+.+..++.|++||+.+|+||.
T Consensus       144 -----~~~~~~~~~a~~~a~~~a~~i~  165 (167)
T d1xhca1         144 -----GIIAGTAKAAMEQARVLADILK  165 (167)
T ss_dssp             -----TBCCCSHHHHHHHHHHHHHHHT
T ss_pred             -----CeEEChHHHHHHHHHHHHHHcC
Confidence                 3457789999999999999984
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure