Citrus Sinensis ID: 018850

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MVSDSITHNAPIASAPNSRDFSKKKRTNRSAKLKQCKLDVRREQWLSQVGAVKSKCCKEDQNGARKESARSLENLKPRDEDNSNDSGSMHHDSDSESPSNSPTNSLLCGNSGTNPGTNFIGSSSSSSSVSGSSGGGCCSGSITEEEEEDGCLDDWEAVADALAADDDNNKQEPEHDRSCSQSPSESQLSVKSDSLHELANGLSLDSVKSMPDGARMVPSVSENNRRAWRPDDAFRPQSLPNLAKQRSFPAADRHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLARSCSMIARS
cccccccccccccccccccccHHHccccHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccEEccccccHHHHccccccccccc
ccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHEHHHHHHHHHccccccccccccccccEEEEEccHHHHHHHHHcccccHHEcc
mvsdsithnapiasapnsrdfskkkrtnrsaklkqckldvRREQWLSQVGAVkskcckedqngarkESARSlenlkprdednsndsgsmhhdsdsespsnsptnsllcgnsgtnpgtnfigsssssssvsgssgggccsgsiteeeeedgclDDWEAVADALaadddnnkqepehdrscsqspsesqlsvksdSLHElanglsldsvksmpdgarmvpsvsennrrawrpddafrpqslpnlakqrsfpaadrhfgqggvpwacnnvlaapsscpicyedldytdssflpclcgfrlclFCHKrileedgrcpgcrkpyehdqveseaivqGGSMTFRLARSCSMIARS
mvsdsithnapiasapnsrdfskkkrtnrsaklkqckldvrreqwlsqvgavkskcckedqngarkesarslenlkprdednsndSGSMHHDSDSESPSNSPTNSLLCGNSGTNPGTNFIGSSSSSSSVSGSSGGGCCSGSITEEEEEDGCLDDWEAVADALAADDDNNKQEpehdrscsqspsesqLSVKSDSLHELANGlsldsvksmpdGARMVpsvsennrrawrpddafrpqslpNLAKQRSFPAADRHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVeseaivqggsmtfRLARscsmiars
MVSDSITHNAPIASAPNSRDFSKKKRTNRSAKLKQCKLDVRREQWLSQVGAVKSKCCKEDQNGARKESARSLENLKPRDEDNSNDSGSMHHDSDSESPSNSPTNSLLCGNSGTNPGTNFIgsssssssvsgssgggccsgsITEEEEEDGCLddweavadalaadddNNKQEPEHDRscsqspsesqlsvksDSLHELANGLSLDSVKSMPDGARMVPSVSENNRRAWRPDDAFRPQSLPNLAKQRSFPAADRHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLARSCSMIARS
*************************************LDVRREQWLSQVGAV********************************************************************************************************************************************************************************************************RHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYE********IVQ****TFR***********
*******************************************************************************************************************************************************LDDWEAVADALAAD*****************************************************************************************FGQGGVPWACNN*LAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVES***********************
MVSDSITHNAPIASAP***************KLKQCKLDVRREQWLSQVGAVKS****************SLENLK*****************************LLCGNSGTNPGTNFI*****************************GCLDDWEAVADALAADD****************************LHELANGLSLDSVKSMPDGARMVPSVSENNRRAWRPDDAFRPQSLPNLAKQRSFPAADRHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLARSCSMIARS
*************************R**RSAKLKQCKLDVRREQWLSQVG****************************************************************************************************CLDDWEAVADALAADD****************************************************************DDAFRPQSLPNLAKQRS**********************APSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLAR********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSDSITHNAPIASAPNSRDFSKKKRTNRSAKLKQCKLDVRREQWLSQVGAVKSKCCKEDQNGARKESARSLENLKPRDEDNSNDSGSMHHDSDSESPSNSPTNSLLCGNSGTNPGTNFIGSSSSSSSVSGSSGGGCCSGSITEEEEEDGCLDDWEAVADALAADDDNNKQEPEHDRSCSQSPSESQLSVKSDSLHELANGLSLDSVKSMPDGARMVPSVSENNRRAWRPDDAFRPQSLPNLAKQRSFPAADRHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLARSCSMIARS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query349 2.2.26 [Sep-21-2011]
O95628 575 CCR4-NOT transcription co no no 0.174 0.106 0.451 4e-11
Q8BT14 575 CCR4-NOT transcription co no no 0.174 0.106 0.451 5e-11
Q09818 489 Putative general negative yes no 0.148 0.106 0.471 4e-10
P34909 587 General negative regulato yes no 0.146 0.086 0.462 4e-10
>sp|O95628|CNOT4_HUMAN CCR4-NOT transcription complex subunit 4 OS=Homo sapiens GN=CNOT4 PE=1 SV=3 Back     alignment and function desciption
 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 271 PSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRI-LEEDGRCPGCRKPYEHDQVESEAI 329
           P  CP+C E L+  D +F PC CG+++C FC  RI  +E+G CP CRKPY  D    + +
Sbjct: 11  PVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL 70

Query: 330 VQ 331
            Q
Sbjct: 71  SQ 72
Has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8BT14|CNOT4_MOUSE CCR4-NOT transcription complex subunit 4 OS=Mus musculus GN=Cnot4 PE=1 SV=2 Back     alignment and function description
>sp|Q09818|YAC4_SCHPO Putative general negative regulator of transcription C16C9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16C9.04c PE=3 SV=1 Back     alignment and function description
>sp|P34909|NOT4_YEAST General negative regulator of transcription subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
225457170348 PREDICTED: uncharacterized protein LOC10 0.962 0.965 0.565 4e-85
210076683348 putative anti-virus transcriptional fact 0.962 0.965 0.562 2e-84
289707891350 C4C4-type RING finger protein [Vitis pse 0.968 0.965 0.567 3e-84
210076679350 putative anti-virus transcriptional fact 0.965 0.962 0.571 3e-84
210076681349 putative anti-virus transcriptional fact 0.965 0.965 0.562 1e-82
297733853306 unnamed protein product [Vitis vinifera] 0.845 0.964 0.533 7e-82
449441037327 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.899 0.960 0.505 4e-76
224119198353 predicted protein [Populus trichocarpa] 0.954 0.943 0.523 7e-76
356512858332 PREDICTED: uncharacterized protein LOC10 0.908 0.954 0.585 9e-74
388516153348 unknown [Medicago truncatula] 0.928 0.931 0.533 2e-69
>gi|225457170|ref|XP_002283833.1| PREDICTED: uncharacterized protein LOC100248510 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  320 bits (821), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 204/361 (56%), Positives = 242/361 (67%), Gaps = 25/361 (6%)

Query: 1   MVSDSITHNAPIASAPNSRDFSKKKRTNRSAKLKQCKLDVRREQWLSQVGAVKSKCCKED 60
           M++DSIT     A+A  S++F KKKRTNR+AKLKQCKLD RREQWLS+V   K+  C+ +
Sbjct: 1   MITDSITS----AAASISKEFGKKKRTNRTAKLKQCKLDARREQWLSKV---KNNGCRGE 53

Query: 61  QNGARK----------ESARSLENLKPRDEDNSNDSGSMHHDSDSESPSNSPTNSLLCGN 110
             G  +          ES RSLENL+ R     ND GS+HHDSDSESP+NSPT+ +    
Sbjct: 54  SEGIPESSMHKRNESNESNRSLENLEVRPRGGEND-GSVHHDSDSESPANSPTSHISSIL 112

Query: 111 SGTNPGTNFIGSSSSSSSVSGSSGGGCCSGSITEEEEEDGCLDDWEAVADALAADDDNNK 170
             T+ GTN+  SSSSSSS  G   G        E  +E  CLDDWEAVADALAA   + +
Sbjct: 113 GSTDSGTNYHASSSSSSSSGGCCSGSITEEEEEEGNDE--CLDDWEAVADALAAV--DKQ 168

Query: 171 QEPEHDRSCSQ-SPSESQLSVKSDSLHELANGLSLDSVKSMPDGARMVPSVSENNRRAWR 229
           + P  +    Q S  E +  V+S S   ++    L      P+   MVP    N + AWR
Sbjct: 169 KIPVQEGHVEQESHVEQKPVVRSGSPGGISKDTGLGIEIHKPEHVGMVPRAPANGQ-AWR 227

Query: 230 PDDAFRPQSLPNLAKQRSFPA-ADRHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSF 288
            DDAFRPQSLPNL+KQ SFP  +DRH+G GGVPWA ++V A P SCPICYEDLD+TDSSF
Sbjct: 228 ADDAFRPQSLPNLSKQHSFPMNSDRHYGHGGVPWARSSVAAIPISCPICYEDLDFTDSSF 287

Query: 289 LPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLARSCSMIAR 348
           LPC CGFRLCLFCHKRILEEDGRCPGCRKPY+ D VE+EAIV GGS+TFRL RS SMIAR
Sbjct: 288 LPCSCGFRLCLFCHKRILEEDGRCPGCRKPYDCDPVEAEAIVNGGSLTFRLGRSYSMIAR 347

Query: 349 S 349
           S
Sbjct: 348 S 348

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|210076683|gb|ACJ06699.1| putative anti-virus transcriptional factor [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|289707891|gb|ADD16956.1| C4C4-type RING finger protein [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|210076679|gb|ACJ06697.1| putative anti-virus transcriptional factor [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|210076681|gb|ACJ06698.1| putative anti-virus transcriptional factor [Vitis pseudoreticulata] Back     alignment and taxonomy information
>gi|297733853|emb|CBI15100.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441037|ref|XP_004138290.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101211244 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224119198|ref|XP_002318012.1| predicted protein [Populus trichocarpa] gi|222858685|gb|EEE96232.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356512858|ref|XP_003525132.1| PREDICTED: uncharacterized protein LOC100792365 [Glycine max] Back     alignment and taxonomy information
>gi|388516153|gb|AFK46138.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query349
TAIR|locus:2097930350 AT3G48070 [Arabidopsis thalian 0.338 0.337 0.629 2.3e-66
TAIR|locus:2170708327 AT5G62910 [Arabidopsis thalian 0.813 0.868 0.357 2.2e-43
TAIR|locus:2027262289 AT1G74870 [Arabidopsis thalian 0.197 0.238 0.492 2.2e-22
UNIPROTKB|I3LC53 304 LOC100622832 "Uncharacterized 0.148 0.171 0.509 1e-10
ZFIN|ZDB-GENE-040426-1164 798 zgc:63566 "zgc:63566" [Danio r 0.171 0.075 0.467 4.7e-10
UNIPROTKB|E2QXU6 572 CNOT4 "Uncharacterized protein 0.148 0.090 0.509 4.9e-10
UNIPROTKB|O95628 575 CNOT4 "CCR4-NOT transcription 0.148 0.090 0.509 4.9e-10
MGI|MGI:1859026 575 Cnot4 "CCR4-NOT transcription 0.148 0.090 0.509 4.9e-10
UNIPROTKB|D4ADF8 575 Cnot4 "RCG28297" [Rattus norve 0.148 0.090 0.509 4.9e-10
UNIPROTKB|F1MWA7 642 CNOT4 "Uncharacterized protein 0.148 0.080 0.509 5.9e-10
TAIR|locus:2097930 AT3G48070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 435 (158.2 bits), Expect = 2.3e-66, Sum P(2) = 2.3e-66
 Identities = 80/127 (62%), Positives = 92/127 (72%)

Query:   222 ENNRRAWRPDDAFRPQSLPNLAKQRSFPAADRHFGQGGVPWACNNVLAAPSSCPICYEDL 281
             + + +AWRPDD  RPQ LPNL KQRSFP  + HF         ++V   PSSCPICYEDL
Sbjct:   201 QKSNQAWRPDDKLRPQGLPNLEKQRSFPVMNLHF---------SSVTVVPSSCPICYEDL 251

Query:   282 DYTDSSFLPCLCGFRLCLFCHKRILEEDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLAR 341
             D TDS+FLPC CGFRLCLFCHK I + DGRCPGCRKPYE + ++ EA VQGG +T RLAR
Sbjct:   252 DLTDSNFLPCPCGFRLCLFCHKTICDGDGRCPGCRKPYERNTIKFEASVQGGGLTIRLAR 311

Query:   342 SCSMIAR 348
             S SM  R
Sbjct:   312 SSSMFCR 318
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2170708 AT5G62910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027262 AT1G74870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|I3LC53 LOC100622832 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1164 zgc:63566 "zgc:63566" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXU6 CNOT4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95628 CNOT4 "CCR4-NOT transcription complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1859026 Cnot4 "CCR4-NOT transcription complex, subunit 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4ADF8 Cnot4 "RCG28297" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWA7 CNOT4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0015008701
hypothetical protein (353 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
COG5175 480 COG5175, MOT2, Transcriptional repressor [Transcri 5e-12
PLN02248 1135 PLN02248, PLN02248, cellulose synthase-like protei 2e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
>gnl|CDD|227502 COG5175, MOT2, Transcriptional repressor [Transcription] Back     alignment and domain information 
 Score = 66.2 bits (161), Expect = 5e-12
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 274 CPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILEE-DGRCPGCRKPYEHDQVE 325
           CP+C E +D TD +F PC CG+++C FC+  I +  +GRCP CR+ Y+ + V 
Sbjct: 17  CPLCIEPMDITDKNFFPCPCGYQICQFCYNNIRQNLNGRCPACRRKYDDENVR 69

Length = 480
>gnl|CDD|215138 PLN02248, PLN02248, cellulose synthase-like protein Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 349
KOG2068327 consensus MOT2 transcription factor [Transcription 100.0
COG5175 480 MOT2 Transcriptional repressor [Transcription] 99.86
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 99.84
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.26
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.1
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.07
PF1463444 zf-RING_5: zinc-RING finger domain 98.05
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.74
PHA02929238 N1R/p28-like protein; Provisional 97.73
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.49
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.42
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.35
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.34
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.33
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.31
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.23
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.22
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 96.94
PHA02926242 zinc finger-like protein; Provisional 96.91
PLN02189 1040 cellulose synthase 96.83
PLN02436 1094 cellulose synthase A 96.55
KOG3002 299 consensus Zn finger protein [General function pred 96.39
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.38
PLN02248 1135 cellulose synthase-like protein 95.32
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.27
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.23
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 95.17
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 95.16
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 95.08
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 94.77
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 94.67
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 94.61
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 94.48
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 94.43
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 94.1
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 93.83
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 93.75
PF04641260 Rtf2: Rtf2 RING-finger 93.41
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 93.35
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 93.33
PLN02400 1085 cellulose synthase 92.8
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 92.0
KOG0297 391 consensus TNF receptor-associated factor [Signal t 91.87
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 91.85
PLN02195 977 cellulose synthase A 91.1
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 91.05
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 90.08
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.06
COG5222427 Uncharacterized conserved protein, contains RING Z 89.8
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 89.76
COG5236 493 Uncharacterized conserved protein, contains RING Z 89.75
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 89.63
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 89.35
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 88.28
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 87.07
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 86.85
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 86.24
KOG1941518 consensus Acetylcholine receptor-associated protei 85.13
COG52191525 Uncharacterized conserved protein, contains RING Z 83.66
PHA02825162 LAP/PHD finger-like protein; Provisional 83.65
KOG3039303 consensus Uncharacterized conserved protein [Funct 83.08
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 83.02
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 82.97
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 81.61
COG521667 Uncharacterized conserved protein [Function unknow 81.42
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 80.74
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-41  Score=324.45  Aligned_cols=312  Identities=42%  Similarity=0.616  Sum_probs=215.4

Q ss_pred             CCcccccccCCCCCCCCCcchhhhhcccchhhhhhhhhhhhhhhHhhhhhhccccccccccCCcc-cccccc-ccccCCC
Q 018850            1 MVSDSITHNAPIASAPNSRDFSKKKRTNRSAKLKQCKLDVRREQWLSQVGAVKSKCCKEDQNGAR-KESARS-LENLKPR   78 (349)
Q Consensus         1 M~~Dsi~~~a~~~aa~~srd~~KKKR~NrSAKLKQ~KlDaRREQWLSQv~avK~k~~k~~~~~~~-~~~~~~-~~~~~~r   78 (349)
                      ||.|++.+... ..++   +  |||+.|+++|+||.||+.||+||++|| ++||++-|++..--+ ....++ +..+-+=
T Consensus         3 qIc~~cwh~i~-~~~~---~--~grcpncr~ky~e~ki~~r~~~~~~l~-~~~n~~kk~e~e~k~~~~s~r~~ls~~rvV   75 (327)
T KOG2068|consen    3 QICDSCWHHIA-TSAE---K--KGRCPNCRTKYKEEKIVLRRVQWESLV-AEKNKEKKKEQEIKRKLSSNRKHLSGVRVV   75 (327)
T ss_pred             eeeHHHHhccc-cccc---c--ccCCccccCccchhhhccccccHHHHH-HhhhhhhhhHHHHhhhhhhcccccccchhh
Confidence            67788877522 2332   2  899999999999999999999999999 777777776554332 111111 2222211


Q ss_pred             CCCCCCCCCCC---cCCCCCCCCCCCCCCCcCCCCCCCCCCCcccCCCCCCCcccCCCCCccccCCcchhccc--cCccc
Q 018850           79 DEDNSNDSGSM---HHDSDSESPSNSPTNSLLCGNSGTNPGTNFIGSSSSSSSVSGSSGGGCCSGSITEEEEE--DGCLD  153 (349)
Q Consensus        79 ~rg~~~~~g~~---~~~sd~eSp~nSP~~~~~~~~~~~~~~~~f~g~s~~sss~SssSs~~~cSgsitEee~d--DgclD  153 (349)
                      +|-.+...|..   +++++++++.+...      .|...+..+|.+.+      ++++++++||+.||++++|  |+|||
T Consensus        76 qknlvyvvgl~~~~ade~~l~~~eyfgq------ygki~ki~~~~~~S------~~s~~~~~~s~yITy~~~eda~rci~  143 (327)
T KOG2068|consen   76 QKNLVYVVGLPLDLADESVLERTEYFGQ------YGKINKIVKNKDPS------SSSSSGGTCSVYITYEEEEDADRCID  143 (327)
T ss_pred             hhhhhhhhCCCccccchhhhhCcccccc------cccceEEeecCCcc------cccCCCCCCcccccccchHhhhhHHH
Confidence            22221223333   78888999888773      13344445554221      5688889999999999865  99999


Q ss_pred             cHHHHHHHhhccCcCCCCCCc------cCCCCCCCCCcccccccccchhhhcccCCCCccCCCCCCCCCCCccCCCCCcc
Q 018850          154 DWEAVADALAADDDNNKQEPE------HDRSCSQSPSESQLSVKSDSLHELANGLSLDSVKSMPDGARMVPSVSENNRRA  227 (349)
Q Consensus       154 DWEAvADAL~add~~~~q~~~------~~~~~~es~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~ra  227 (349)
                      +|++|+|||++..... -...      ...+|..        ..+.|.++.......-.-.++....-++-.+......+
T Consensus       144 ~v~g~~~dg~~lka~~-gttkycs~~l~~~~c~~--------~~cmylhe~~~~~Ds~~k~e~~~~~~~~~~~~~~~n~~  214 (327)
T KOG2068|consen  144 DVDGFVDDGRALKASL-GTTKYCSFYLRNDICQN--------PDCMYLHEIGDQEDSFTKDEMKSAKHRESSRKQTSNIA  214 (327)
T ss_pred             HhhhHHhhhhhhHHhh-CCCcchhHHhhhhcccC--------ccccccccccccccccchHHHHHHhhhhhcccccccce
Confidence            9999999999822211 1000      0001111        11222222211111100000001111111113334689


Q ss_pred             cCCCCCCCCCCCCcccccCCCCCCcCCCCCCCCccccccCCCCCCCCCCcccCCCCCCCccccccCCceehHHHHhhhhh
Q 018850          228 WRPDDAFRPQSLPNLAKQRSFPAADRHFGQGGVPWACNNVLAAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILE  307 (349)
Q Consensus       228 wrpdd~~RP~slpnlsKQ~sfp~~~~~~g~~g~~w~~~~~~~~~~~CPIC~E~LDlTD~~F~PC~CGyqiC~fC~~rI~e  307 (349)
                      |+.++..||+-|||+.||.+||....+++         ++.+++..||||.+++|.+|..|.||+||+++|+||+..|..
T Consensus       215 ~~~~~~~~p~~l~~~~~~~s~p~~~~~~~---------~~~~v~~s~p~~~~~~~~~d~~~lP~~~~~~~~l~~~~t~~~  285 (327)
T KOG2068|consen  215 RRSDDKLRPQPLPNLEKQRSAPDAQLDFS---------SVTSVPPSCPICYEDLDLTDSNFLPCPCGFRLCLFCHKTISD  285 (327)
T ss_pred             eccCcccCCCcccccccccCCcccccCCc---------cccccCCCCCCCCCcccccccccccccccccchhhhhhcccc
Confidence            99999999999999999999999876652         233679999999999999999999999999999999999999


Q ss_pred             hcCCCCCCccccccCccceeeeeecccceeeccccccccccC
Q 018850          308 EDGRCPGCRKPYEHDQVESEAIVQGGSMTFRLARSCSMIARS  349 (349)
Q Consensus       308 ~dgrCPaCRr~Yde~~~~~~~~~~~~~~~~rlsRScSM~~rs  349 (349)
                      -+++||+||++|...+..+...+.++..+++|++|.+|..|+
T Consensus       286 ~~~~~~~~rk~~~~~t~~s~~~~~~~~~~~~~~~s~~~~~~~  327 (327)
T KOG2068|consen  286 GDGRCPGCRKPYERNTKKSETSVQGGGLTIRLARSSSMLCRA  327 (327)
T ss_pred             cCCCCCccCCccccCccccccccccCcccccccCChhhcccC
Confidence            999999999999999999999999999999999999998764

>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN02248 cellulose synthase-like protein Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5216 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
1e4u_A78 N-Terminal Ring Finger Domain Of Human Not-4 Length 3e-10
1ur6_B52 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 8e-10
>pdb|1E4U|A Chain A, N-Terminal Ring Finger Domain Of Human Not-4 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 1/62 (1%)
Query: 271 PSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRI-LEEDGRCPGCRKPYEHDQVESEAI 329
           P  CP+C E L+  D +F PC CG+++C FC  RI  +E+G CP CRKPY  D    + +
Sbjct: 11  PVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL 70
Query: 330 VQ 331
            Q
Sbjct: 71  SQ 72
>pdb|1UR6|B Chain B, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query349
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 6e-16
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 1e-05
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 6e-04
2ecm_A55 Ring finger and CHY zinc finger domain- containing 8e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 8e-04
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
 Score = 70.9 bits (173), Expect = 6e-16
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 271 PSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRIL-EEDGRCPGCRKPYEHDQVE 325
           P  CP+C E L+  D +F PC CG+++C FC  RI  +E+G CP CRKPY  D   
Sbjct: 11  PVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAV 66
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.57
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.85
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.68
2ect_A78 Ring finger protein 126; metal binding protein, st 98.6
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.59
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.58
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.54
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.53
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.52
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.52
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.5
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.5
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.48
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.47
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.46
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.46
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.4
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.4
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.37
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.32
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.29
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.27
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.24
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.24
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.22
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.21
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.2
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.18
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.17
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.16
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.15
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.12
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.1
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.07
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.06
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.03
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.02
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.0
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.97
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.92
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.92
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.89
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.88
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.88
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.85
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.83
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.81
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.78
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.75
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.67
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.63
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.59
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.54
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.54
2ea5_A68 Cell growth regulator with ring finger domain prot 97.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.5
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.46
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.45
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.33
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.25
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.07
2f42_A179 STIP1 homology and U-box containing protein 1; cha 96.86
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.77
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 95.85
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 95.55
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 95.51
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 94.64
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 94.06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 92.03
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 89.24
3nw0_A238 Non-structural maintenance of chromosomes element 85.01
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 80.65
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
Probab=99.57  E-value=1.6e-15  Score=117.18  Aligned_cols=60  Identities=45%  Similarity=1.151  Sum_probs=54.3

Q ss_pred             CCCCCCCCcccCCCCCCCccccccCCceehHHHHhhhhh-hcCCCCCCccccccCccceee
Q 018850          269 AAPSSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILE-EDGRCPGCRKPYEHDQVESEA  328 (349)
Q Consensus       269 ~~~~~CPIC~E~LDlTD~~F~PC~CGyqiC~fC~~rI~e-~dgrCPaCRr~Yde~~~~~~~  328 (349)
                      ..+.+||||+|+++++|..|+||+|||++|++|++++.+ ..++||.||++|....+.+..
T Consensus         9 ~~~~~CpICle~~~~~d~~~~p~~CGH~fC~~Cl~~~~~~~~~~CP~CR~~~~~~~~~~~~   69 (78)
T 1e4u_A            9 EDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKP   69 (78)
T ss_dssp             CCCCBCTTTCCBCCTTTTTCCSSTTSCCCCHHHHHHHTTSSCSBCTTTCCBCSSCSSCCCS
T ss_pred             ccCCcCCccCccCccccccccccCCCCCcCHHHHHHHHhcCCCCCCCCCCccCCCchhhcc
Confidence            356799999999999999999999999999999999975 568999999999998887665
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 349
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 3e-08
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 4e-06
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 5e-05
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 8e-04
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.004
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Not-4 N-terminal RING finger domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.4 bits (112), Expect = 3e-08
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 273 SCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILE-EDGRCPGCRKPYEHD 322
            CP+C E L+  D +F PC CG+++C FC  RI   E+G CP CRKPY  D
Sbjct: 2   ECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPED 52
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query349
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.35
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.72
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.5
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.38
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.33
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.22
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.15
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.03
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.85
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.78
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.77
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.63
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.63
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.61
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.51
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.5
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 96.18
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Not-4 N-terminal RING finger domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.35  E-value=1.4e-13  Score=97.37  Aligned_cols=51  Identities=51%  Similarity=1.322  Sum_probs=46.8

Q ss_pred             CCCCCcccCCCCCCCccccccCCceehHHHHhhhhh-hcCCCCCCccccccC
Q 018850          272 SSCPICYEDLDYTDSSFLPCLCGFRLCLFCHKRILE-EDGRCPGCRKPYEHD  322 (349)
Q Consensus       272 ~~CPIC~E~LDlTD~~F~PC~CGyqiC~fC~~rI~e-~dgrCPaCRr~Yde~  322 (349)
                      .+||||+++|+.+|..+++++|||.+|..|+.+++. .+.+||.||++|+++
T Consensus         1 leCpICl~~~~~~~~~~~~~~CgH~~c~~C~~~w~~~~~~~CP~CR~~~~~d   52 (52)
T d1ur6b_           1 VECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPED   52 (52)
T ss_dssp             CEETTTTEECCGGGTTCCSSSSSCCCCHHHHHHHTTTSCCBCTTTCCBCSCC
T ss_pred             CCCcCCChhhhCCCceEEecCCCCccchHHHHHHHhhcCCCCCccCCcCCCC
Confidence            379999999999999999999999999999999986 567899999999874
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure