Citrus Sinensis ID: 018960
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| 359488195 | 333 | PREDICTED: double-stranded RNA-binding p | 0.882 | 0.921 | 0.555 | 3e-85 | |
| 224069354 | 452 | predicted protein [Populus trichocarpa] | 0.522 | 0.402 | 0.659 | 9e-67 | |
| 255583419 | 289 | double-stranded RNA binding protein, put | 0.790 | 0.951 | 0.457 | 9e-58 | |
| 356551805 | 434 | PREDICTED: uncharacterized protein LOC10 | 0.502 | 0.403 | 0.542 | 3e-49 | |
| 449464150 | 385 | PREDICTED: uncharacterized protein LOC10 | 0.528 | 0.477 | 0.497 | 1e-44 | |
| 449502333 | 385 | PREDICTED: uncharacterized LOC101213863 | 0.528 | 0.477 | 0.497 | 1e-44 | |
| 357492171 | 357 | hypothetical protein MTR_5g079490 [Medic | 0.494 | 0.481 | 0.465 | 4e-40 | |
| 242081359 | 298 | hypothetical protein SORBIDRAFT_07g01938 | 0.497 | 0.580 | 0.477 | 4e-36 | |
| 357141254 | 281 | PREDICTED: double-stranded RNA-binding p | 0.494 | 0.612 | 0.472 | 3e-35 | |
| 212276238 | 323 | uncharacterized protein LOC100191297 [Ze | 0.497 | 0.535 | 0.427 | 7e-29 |
| >gi|359488195|ref|XP_002272597.2| PREDICTED: double-stranded RNA-binding protein 4-like [Vitis vinifera] gi|296087161|emb|CBI33535.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 321 bits (823), Expect = 3e-85, Method: Compositional matrix adjust.
Identities = 196/353 (55%), Positives = 233/353 (66%), Gaps = 46/353 (13%)
Query: 1 MHKNRLQEHAQRSGIPLPVYQSHNEGFQHAPKFRASVSVDGVTYTSPNTFSHRKAAEQDV 60
MHKNRLQE+ QRS IPLP+YQ+ NEGFQHAPKFR++V VDG TYTSPNTFSHRKAAEQDV
Sbjct: 22 MHKNRLQEYTQRSAIPLPIYQTVNEGFQHAPKFRSTVLVDGATYTSPNTFSHRKAAEQDV 81
Query: 61 AKIALECISKKIKDEGCPLINQDTVFCKSILNEFAVKMNLELPAYSTRQSEALLPVFVSS 120
A++ALE ISKKIKDEGCPLI +DTVFCKSILNEFAVKMNLE P Y+T Q E LLPVFVSS
Sbjct: 82 ARLALEFISKKIKDEGCPLIREDTVFCKSILNEFAVKMNLEKPTYTTVQPEGLLPVFVSS 141
Query: 121 LVFNGVTYTGEPGRSKKEAEQLAARAVIRTLLVTSGSATILSEIIKSKGKLYAALNKVKE 180
LVFNGVTYTG+ GR+KKEAEQLAAR VI ++L SGS T+LSEIIKSK KLYAAL++VK+
Sbjct: 142 LVFNGVTYTGDAGRNKKEAEQLAARTVILSILGNSGSGTLLSEIIKSKVKLYAALHRVKD 201
Query: 181 SNYSTQKIATSYVPTTAIPKSSSGIHPIPTTPEASVGMHSIPTIPEATAGIHPTPA---- 236
+Y +GI PI G+ T+GI P
Sbjct: 202 PSY-----------------IHTGILPI--------GL---------TSGIPPCKGKEVE 227
Query: 237 ITEASTGMHPTSAAIEVSTGMHSTAADSETSTGMNLPCHPFKKPKLEPPSEPVVLPIPFV 296
+ + + PT+ ++ +S + + P H +KPK SE + PI FV
Sbjct: 228 VAPGTDQLLPTAVSVPLSGQLVHVPV-------THPPVHELEKPKPNVSSEVIAPPISFV 280
Query: 297 PPVLGQ-HSEGGSSSTNKRRKNKRKANKKLRTDAQPCVSAQPLTQVPPCSVAQ 348
P V Q ++ + RKNK+KANKKLRTDAQ V+ PL Q PCSVAQ
Sbjct: 281 PSVFEQPLVVSPTTGRKRNRKNKKKANKKLRTDAQLPVAVLPLNQASPCSVAQ 333
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224069354|ref|XP_002302963.1| predicted protein [Populus trichocarpa] gi|222844689|gb|EEE82236.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255583419|ref|XP_002532469.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223527827|gb|EEF29925.1| double-stranded RNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356551805|ref|XP_003544264.1| PREDICTED: uncharacterized protein LOC100798730 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449464150|ref|XP_004149792.1| PREDICTED: uncharacterized protein LOC101213863 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449502333|ref|XP_004161611.1| PREDICTED: uncharacterized LOC101213863 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357492171|ref|XP_003616374.1| hypothetical protein MTR_5g079490 [Medicago truncatula] gi|355517709|gb|AES99332.1| hypothetical protein MTR_5g079490 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|242081359|ref|XP_002445448.1| hypothetical protein SORBIDRAFT_07g019380 [Sorghum bicolor] gi|241941798|gb|EES14943.1| hypothetical protein SORBIDRAFT_07g019380 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|357141254|ref|XP_003572154.1| PREDICTED: double-stranded RNA-binding protein 4-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|212276238|ref|NP_001130203.1| uncharacterized protein LOC100191297 [Zea mays] gi|194688536|gb|ACF78352.1| unknown [Zea mays] gi|414870581|tpg|DAA49138.1| TPA: hypothetical protein ZEAMMB73_523306 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| UNIPROTKB|Q0IQN6 | 424 | DRB8 "Double-stranded RNA-bind | 0.477 | 0.391 | 0.385 | 1.8e-27 | |
| TAIR|locus:2829928 | 359 | DRB3 "dsRNA-binding protein 3" | 0.419 | 0.406 | 0.378 | 1.6e-22 | |
| TAIR|locus:2024407 | 419 | HYL1 "HYPONASTIC LEAVES 1" [Ar | 0.413 | 0.343 | 0.397 | 7e-22 | |
| TAIR|locus:2057491 | 434 | DRB2 "dsRNA-binding protein 2" | 0.770 | 0.617 | 0.300 | 5.2e-21 | |
| TAIR|locus:2163016 | 393 | DRB5 "dsRNA-binding protein 5" | 0.433 | 0.384 | 0.379 | 4.2e-20 | |
| TAIR|locus:2081620 | 355 | DRB4 "double-stranded-RNA-bind | 0.695 | 0.681 | 0.277 | 6.9e-16 | |
| CGD|CAL0004775 | 1409 | MSB2 [Candida albicans (taxid: | 0.359 | 0.088 | 0.320 | 0.00039 | |
| UNIPROTKB|Q5ALT5 | 1409 | MSB2 "Potential cell surface f | 0.359 | 0.088 | 0.320 | 0.00039 |
| UNIPROTKB|Q0IQN6 DRB8 "Double-stranded RNA-binding protein 8" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 281 (104.0 bits), Expect = 1.8e-27, Sum P(2) = 1.8e-27
Identities = 66/171 (38%), Positives = 101/171 (59%)
Query: 3 KNRLQEHAQRSGIPLPVYQSHNEGFQHAPKFRASVSVDGVTYTSPNTFSHRKAAEQDVAK 62
K+RLQE+AQ++G+ P Y + EG H P F+++V ++ +Y S F +RKAAEQ A+
Sbjct: 35 KSRLQEYAQKTGLQTPEYHTFKEGPSHEPVFKSTVVINNTSYDSLPGFFNRKAAEQSAAE 94
Query: 63 IALECISKKIK-DEGCPLINQDTVFCKSILNEFAVKMNLELPAY-STRQSEALLPVFVSS 120
+AL I K I + P + Q+T CK++L E+A KMN +P+Y T+ + L P F+ +
Sbjct: 95 VALMEIVKSIPANANIPAV-QETGLCKNLLQEYAQKMNYAIPSYICTKSASGLAP-FICT 152
Query: 121 LVFNGVTYTGEPGRSKKEAEQLAARAVIRTLLVTS-GSATILSEIIKSKGK 170
+ G+ Y G R+KK+AE AAR + + S GSA ++ I GK
Sbjct: 153 VEIGGIQYIGAAARTKKDAEIKAARTALLAIQGQSEGSANGATKYIVVPGK 203
|
|
| TAIR|locus:2829928 DRB3 "dsRNA-binding protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024407 HYL1 "HYPONASTIC LEAVES 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057491 DRB2 "dsRNA-binding protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163016 DRB5 "dsRNA-binding protein 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081620 DRB4 "double-stranded-RNA-binding protein 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004775 MSB2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ALT5 MSB2 "Potential cell surface flocculin" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 1e-12 | |
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 2e-12 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 1e-11 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 3e-11 | |
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 2e-10 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 3e-09 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 9e-09 | |
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 9e-09 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 2e-08 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 6e-08 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 7e-08 | |
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 2e-06 | |
| TIGR04238 | 201 | TIGR04238, seadorna_dsRNA, seadornavirus double-st | 0.001 |
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
Score = 65.7 bits (161), Expect = 1e-12
Identities = 30/66 (45%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
Query: 2 HKNRLQEHAQRSGIPLPVYQ-SHNEGFQHAPKFRASVSVDGVTYTSPNTFSHRKAAEQDV 60
+K LQE AQ G PLP Y+ EG H +F VSV+G Y S +K AEQ+
Sbjct: 154 YKTALQEWAQARGKPLPEYRLIKEEGPDHDKEFTVEVSVNGEPYGEGKGKS-KKEAEQNA 212
Query: 61 AKIALE 66
AK ALE
Sbjct: 213 AKAALE 218
|
This family consists of bacterial examples of ribonuclease III. This enzyme cleaves double-stranded rRNA. It is involved in processing ribosomal RNA precursors. It is found even in minimal genones such as Mycoplasma genitalium and Buchnera aphidicola, and in some cases has been shown to be an essential gene. These bacterial proteins contain a double-stranded RNA binding motif (pfam00035) and a ribonuclease III domain (pfam00636). Eukaryotic homologs tend to be much longer proteins with additional domains, localized to the nucleus, and not included in this family [Transcription, RNA processing]. Length = 220 |
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|234517 TIGR04238, seadorna_dsRNA, seadornavirus double-stranded RNA-binding protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.92 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 99.78 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.75 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 99.73 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 99.71 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.62 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 99.61 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 99.6 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.6 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.58 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.54 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.52 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 99.31 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.25 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 99.22 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.21 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.2 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.2 | |
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.19 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 99.17 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.14 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.02 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 98.99 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 98.93 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 98.87 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 98.84 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 98.81 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 98.78 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 98.65 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 98.13 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 97.77 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 97.4 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 96.89 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 96.6 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 96.46 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 96.33 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 94.92 | |
| PF14954 | 252 | LIX1: Limb expression 1 | 94.19 | |
| KOG2334 | 477 | consensus tRNA-dihydrouridine synthase [Translatio | 91.7 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 89.32 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 88.49 |
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
Probab=99.92 E-value=9.4e-25 Score=211.86 Aligned_cols=202 Identities=23% Similarity=0.213 Sum_probs=160.1
Q ss_pred hHHHHHHHHHHcCCCCCceEEec-cCCCCCCceEEEEEECceEEeCCCCCCchHHHHHHHHHHHHHHHHhhhhcCCC---
Q 018960 2 HKNRLQEHAQRSGIPLPVYQSHN-EGFQHAPKFRASVSVDGVTYTSPNTFSHRKAAEQDVAKIALECISKKIKDEGC--- 77 (348)
Q Consensus 2 yKS~LqE~~QK~g~~LP~Y~lv~-~Gp~H~~~Ft~SV~vDGaiY~dgG~GsSKKeAKq~AAk~aL~~L~~~~~~e~~--- 77 (348)
++|.|+|||.++++ .+.|++++ +|+.|.+.|.++|.++.+. ..|.|.|||.||+.||..+|..|.......+.
T Consensus 40 ~IS~l~E~~~r~~~-~v~fevl~eeGp~H~~~fv~rvtvg~~~--a~GeG~sKK~AKh~AA~~~L~~lk~l~~l~~v~k~ 116 (339)
T KOG3732|consen 40 PISLLQEYGLRRGL-TPVYEVLREEGPPHMPNFVFRVTVGEIT--ATGEGKSKKLAKHRAAEALLKELKKLPPLANVRKD 116 (339)
T ss_pred hHHHHHHHHHHhCC-CcceeeeeccCCccCCCeEEEEEEeeeE--EecCCCchhHHHHHHHHHHHHHHhcCCCccccccC
Confidence 58999999999997 56899988 8999999999999998543 44689999999999999999999876432100
Q ss_pred ---------C---------CCCCCCCChhHHHHHHHHHcCCCCCcEEEeec--CCCCCcEEEEEEECCEEeeeeecCCHH
Q 018960 78 ---------P---------LINQDTVFCKSILNEFAVKMNLELPAYSTRQS--EALLPVFVSSLVFNGVTYTGEPGRSKK 137 (348)
Q Consensus 78 ---------~---------~~~~~~~npKs~LQE~cQk~~~~~P~Y~~v~e--pgH~~~F~v~V~I~g~~~~~G~G~SKK 137 (348)
+ +......||+++||||||+++|..|.|+++.+ .+|.++|+++|.+.+. ..+|.|.|||
T Consensus 117 ~~~~~~~~~~~~~~~q~~d~~~~~~~NPI~~L~e~~q~k~~k~P~yelv~E~G~~~~rEFv~q~sv~~~-~~~GkG~sKK 195 (339)
T KOG3732|consen 117 SLKFAKMKSSGVKKDQPGDPEYGQVLNPIGRLQELAQAKKWKLPEYELVQESGVPHRREFVIQCSVENF-TEEGKGPSKK 195 (339)
T ss_pred cccccccccCCccccCCCCcccccccChHHHHHHHHHHhCCCCCceEEEeccCCCccceEEEEEEecce-eeecCCchHH
Confidence 0 01134689999999999999999999999998 4699999999999986 4679999999
Q ss_pred HHHHHHHHHHHHHHHhhCC-----------------------C----hhHHHHHHHhhhhHHHhh-------hcccCCcc
Q 018960 138 EAEQLAARAVIRTLLVTSG-----------------------S----ATILSEIIKSKGKLYAAL-------NKVKESNY 183 (348)
Q Consensus 138 eAKq~AA~~AL~~L~~~s~-----------------------~----~~ll~e~i~sk~~l~~~~-------~k~k~~~~ 183 (348)
.||++||.+||+.|..... | .+...++-.-+..++..+ -+..+..+
T Consensus 196 iAKRnAAeamLe~l~~~~~~~~p~~~~~~~~~p~~~~~~~~~~~s~~~s~~eel~~~k~~~~~~~~~~~~~~~~~~~~~~ 275 (339)
T KOG3732|consen 196 IAKRNAAEAMLESLGFVKPNKTPENLKVSLLKPASGRALGCSDKSLDNSEGEELSRLKACLKVIFNSAGLAYIKLLSEIA 275 (339)
T ss_pred HHHHHHHHHHHHHhccCCCCcCcccccccccccccCcCCccCccccccchhhhhhhhhhhhhhccccccccccccccccc
Confidence 9999999999999983321 1 123334444455555432 11244668
Q ss_pred cceeeccCccccccccCCCCCCCCCC
Q 018960 184 STQKIATSYVPTTAIPKSSSGIHPIP 209 (348)
Q Consensus 184 s~qk~~~~~~~~~~~~~~~~~~~~~~ 209 (348)
-++.|...|..+++. +.+|+++|+
T Consensus 276 ~e~~f~~~y~d~~~~--t~sg~~~~~ 299 (339)
T KOG3732|consen 276 PENQFTVTYPDIEEL--TLSGQNQCL 299 (339)
T ss_pred cccchheecchhHHh--hhhhHHHHH
Confidence 888999999988888 889999998
|
|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14954 LIX1: Limb expression 1 | Back alignment and domain information |
|---|
| >KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 348 | ||||
| 2l2n_A | 103 | Backbone 1h, 13c, And 15n Chemical Shift Assignment | 1e-10 | ||
| 3adg_A | 73 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 1e-10 | ||
| 2l2m_A | 77 | Solution Structure Of The Second Dsrbd Of Hyl1 Leng | 4e-07 | ||
| 3adj_A | 76 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 9e-07 |
| >pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 | Back alignment and structure |
|
| >pdb|3ADG|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 73 | Back alignment and structure |
| >pdb|2L2M|A Chain A, Solution Structure Of The Second Dsrbd Of Hyl1 Length = 77 | Back alignment and structure |
| >pdb|3ADJ|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 1e-33 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 7e-10 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 2e-08 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 7e-24 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 4e-10 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 1e-22 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 9e-11 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 7e-21 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 7e-16 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 2e-15 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 3e-13 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 8e-13 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 8e-10 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 1e-12 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 3e-08 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 1e-12 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 7e-08 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 2e-11 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 1e-07 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 2e-11 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 4e-08 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 4e-11 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 1e-07 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 4e-11 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 3e-07 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 7e-11 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 1e-07 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 8e-11 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 2e-08 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 8e-11 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 7e-09 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 2e-10 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 2e-08 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 8e-10 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 4e-08 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 1e-09 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 4e-09 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 4e-09 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 4e-08 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 8e-09 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 3e-08 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 9e-09 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 7e-06 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 2e-08 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 6e-08 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 3e-08 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 8e-05 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 5e-08 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 2e-05 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 5e-07 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 1e-05 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 6e-07 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 4e-05 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 1e-06 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 2e-04 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 7e-06 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 6e-04 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 2e-05 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 5e-05 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 1e-04 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 1e-04 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 4e-04 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 2e-04 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 6e-04 |
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
Score = 121 bits (306), Expect = 1e-33
Identities = 35/157 (22%), Positives = 59/157 (37%), Gaps = 8/157 (5%)
Query: 2 HKNRLQEHAQRSGIPLPVYQSHNEGFQHAPKFRASVSVDGVTYTSPNTFSHRKAAEQDVA 61
L + Q+ G+ L + N G H +F V +DG + S +K A+ A
Sbjct: 15 FMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRS-KKEAKNAAA 73
Query: 62 KIALECISKKIKDEGCPLINQD-------TVFCKSILNEFAVKMNLELPAYSTRQSEALL 114
K+A+E ++K+ K L+ ++N A K L +
Sbjct: 74 KLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGP 133
Query: 115 PVFVSSLVFNGVTYTGEPGRSKKEAEQLAARAVIRTL 151
F Y+ G +K+EA+QLAA+ +
Sbjct: 134 EGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQI 170
|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Length = 113 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 88 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.96 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.94 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.9 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.78 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.78 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.76 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.76 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.76 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.75 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.74 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.73 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.73 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.73 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.73 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.72 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 99.71 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.7 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.7 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.69 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.69 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.68 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.68 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.68 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.67 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.66 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.65 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.64 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 99.64 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 99.6 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.59 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.59 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.59 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.59 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.55 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.55 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.5 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.49 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.49 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.48 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.47 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.46 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.44 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.44 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.43 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.41 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 99.41 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.39 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.37 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.36 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.36 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.34 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.33 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.32 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.31 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.31 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.3 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.24 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.21 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.18 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.17 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 99.15 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.09 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 99.01 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.01 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 98.86 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 98.85 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 98.15 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 97.6 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 96.54 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 94.77 | |
| 2db2_A | 119 | KIAA0890 protein; DSRM domain, structural genomics | 89.87 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 88.43 |
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
Probab=99.96 E-value=4.1e-29 Score=223.32 Aligned_cols=152 Identities=24% Similarity=0.258 Sum_probs=130.0
Q ss_pred ChHHHHHHHHHHcCCCCCceEEec-cCCCCCCceEEEEEECceEEeCCCCCCchHHHHHHHHHHHHHHHHhhhhcC-CC-
Q 018960 1 MHKNRLQEHAQRSGIPLPVYQSHN-EGFQHAPKFRASVSVDGVTYTSPNTFSHRKAAEQDVAKIALECISKKIKDE-GC- 77 (348)
Q Consensus 1 myKS~LqE~~QK~g~~LP~Y~lv~-~Gp~H~~~Ft~SV~vDGaiY~dgG~GsSKKeAKq~AAk~aL~~L~~~~~~e-~~- 77 (348)
+||+.||||||++++. |.|.++. .|+.|.+.|++.|+++|..|.. |.|.|||+||+.||+.+|..|....... +.
T Consensus 14 n~ks~LqE~~q~~~~~-p~Y~~~~~~Gp~h~~~F~~~v~v~g~~~~~-G~G~sKK~Aeq~AA~~al~~L~~~~~~~~p~~ 91 (179)
T 1qu6_A 14 FFMEELNTYRQKQGVV-LKYQELPNSGPPHDRRFTFQVIIDGREFPE-GEGRSKKEAKNAAAKLAVEILNKEKKAVSPLL 91 (179)
T ss_dssp SHHHHHHHHHHHHTCC-CEEEEEESCBTTTBCCEEEEEESSSSCCCE-EECCSSHHHHHHHHHHHHHHHHSCCSCCSCSS
T ss_pred CHHHHHHHHHHhCCCC-CeEEEeeccCCCCCCeEEEEEEECCEEEEe-cCCCCHHHHHHHHHHHHHHHHhcccccCCCcc
Confidence 4899999999999986 8999875 8999999999999999987765 4899999999999999999997643210 00
Q ss_pred -C----CCCCCCCChhHHHHHHHHHcCCCCCcEEEeec-CCCCCcEEEEEEECCEEeeeeecCCHHHHHHHHHHHHHHHH
Q 018960 78 -P----LINQDTVFCKSILNEFAVKMNLELPAYSTRQS-EALLPVFVSSLVFNGVTYTGEPGRSKKEAEQLAARAVIRTL 151 (348)
Q Consensus 78 -~----~~~~~~~npKs~LQE~cQk~~~~~P~Y~~v~e-pgH~~~F~v~V~I~g~~~~~G~G~SKKeAKq~AA~~AL~~L 151 (348)
+ ..+....||++.||||||++++.+ .|++... ++|.+.|+|+|.|+|..|+.|.|+|||+||+.||+.||..|
T Consensus 92 ~~~~~~~e~~~~~n~~~~L~E~~qk~~~~~-~Y~~~~~G~~h~~~F~~~v~v~~~~~~~g~g~sKK~Ak~~AA~~al~~L 170 (179)
T 1qu6_A 92 LTTTNSSEGLSMGNYIGLINRIAQKKRLTV-NYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQI 170 (179)
T ss_dssp CCCSCSSCCCCCCCCHHHHHHHHHHSCCEE-EEEEEEECSSSSSEEEEEEEEETTBCCEEEESSHHHHHHHHHHHHHHHH
T ss_pred CCCCCcccccCCCCHHHHHHHHHHhcCCcc-eEEecCcCCCCCCeEEEEEEECCEEEeeEEECCHHHHHHHHHHHHHHHH
Confidence 0 011245799999999999999987 9998655 57999999999999998899999999999999999999999
Q ss_pred HhhC
Q 018960 152 LVTS 155 (348)
Q Consensus 152 ~~~s 155 (348)
....
T Consensus 171 ~~~~ 174 (179)
T 1qu6_A 171 LSEE 174 (179)
T ss_dssp HHCC
T ss_pred hccc
Confidence 7654
|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A | Back alignment and structure |
|---|
| >2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 348 | ||||
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 2e-12 | |
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 1e-07 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 6e-12 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 2e-11 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 5e-11 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 5e-10 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 6e-11 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 3e-10 | |
| d1t4oa_ | 81 | d.50.1.1 (A:) RNase III, C-terminal domain {Baker' | 4e-10 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 6e-10 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 1e-05 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 4e-09 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 2e-04 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 7e-09 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 1e-06 | |
| d1x49a1 | 85 | d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p | 9e-09 | |
| d1x49a1 | 85 | d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p | 1e-04 | |
| d1uila_ | 113 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 9e-09 | |
| d1uila_ | 113 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 2e-05 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 1e-08 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 2e-08 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 2e-08 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 2e-04 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 5e-08 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 2e-04 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 8e-08 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 2e-05 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 4e-07 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 2e-05 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 5e-07 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 4e-06 | |
| d2b7ta1 | 73 | d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R | 7e-07 | |
| d2b7ta1 | 73 | d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R | 3e-04 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 7e-07 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 0.001 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 1e-05 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 0.001 |
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: dsRNA-dependent protein kinase pkr species: Mouse (Mus musculus) [TaxId: 10090]
Score = 60.0 bits (145), Expect = 2e-12
Identities = 11/69 (15%), Positives = 24/69 (34%), Gaps = 2/69 (2%)
Query: 3 KNRLQEHAQRSGIPLPVYQSHNEGFQHAPKFRASVSVDGVTYTSPNTFSHRKAAEQDVAK 62
+ AQ+ + + Q + +F + Y + ++ A+Q AK
Sbjct: 2 IGLVNSFAQKKKLSVNYEQCE-PNSELPQRFICKCKIGQTMYG-TGSGVTKQEAKQLAAK 59
Query: 63 IALECISKK 71
A + + K
Sbjct: 60 EAYQKLLKS 68
|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.78 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.75 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.75 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.75 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.74 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.72 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.72 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.71 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.71 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.69 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.67 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.67 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.63 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.62 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.59 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.55 | |
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.53 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.51 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.5 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.47 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.47 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.45 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.44 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.44 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.43 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 99.42 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.41 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.4 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.37 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.35 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.34 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.27 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.11 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.05 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.02 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 98.88 |
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: RNase III, C-terminal domain species: Thermotoga maritima [TaxId: 2336]
Probab=99.78 E-value=2.1e-19 Score=135.24 Aligned_cols=66 Identities=32% Similarity=0.333 Sum_probs=63.0
Q ss_pred ChhHHHHHHHHHcCCCCCcEEEeec--CCCCCcEEEEEEECCEEeeeeecCCHHHHHHHHHHHHHHHH
Q 018960 86 FCKSILNEFAVKMNLELPAYSTRQS--EALLPVFVSSLVFNGVTYTGEPGRSKKEAEQLAARAVIRTL 151 (348)
Q Consensus 86 npKs~LQE~cQk~~~~~P~Y~~v~e--pgH~~~F~v~V~I~g~~~~~G~G~SKKeAKq~AA~~AL~~L 151 (348)
|||+.||||||++++.+|.|+++.. ++|.+.|++.|.|+|..++.|.|+|||+|||.||+.||+.|
T Consensus 1 d~Ks~LqE~~Qk~~~~~P~Y~~~~~~g~~h~~~F~~~v~v~~~~~~~g~g~sKK~Aeq~AA~~aL~~L 68 (69)
T d1o0wa2 1 DYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKL 68 (69)
T ss_dssp CHHHHHHHHHHHHHSSCCEEEEEEEECCTTSCEEEEEEEETTEEEEEEEESSHHHHHHHHHHHHHHHH
T ss_pred ChHHHHHHHHHHcCCCCCEEEEEEeeCCCCCceEEEEEEECCEEEEEEEeCCHHHHHHHHHHHHHHHh
Confidence 7999999999999999999999776 57999999999999999999999999999999999999987
|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|