Citrus Sinensis ID: 018965
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| 255540243 | 349 | conserved hypothetical protein [Ricinus | 0.991 | 0.988 | 0.673 | 1e-130 | |
| 224136173 | 358 | predicted protein [Populus trichocarpa] | 0.974 | 0.946 | 0.646 | 1e-122 | |
| 449440552 | 354 | PREDICTED: F-box protein At1g67340-like | 0.979 | 0.963 | 0.655 | 1e-120 | |
| 255547716 | 394 | conserved hypothetical protein [Ricinus | 0.945 | 0.835 | 0.652 | 1e-119 | |
| 224122012 | 348 | f-box family protein [Populus trichocarp | 0.908 | 0.908 | 0.665 | 1e-119 | |
| 356508806 | 344 | PREDICTED: F-box protein At1g67340-like | 0.925 | 0.936 | 0.640 | 1e-117 | |
| 449454830 | 351 | PREDICTED: F-box protein At1g67340-like | 0.853 | 0.846 | 0.666 | 1e-115 | |
| 224053499 | 403 | predicted protein [Populus trichocarpa] | 0.916 | 0.791 | 0.644 | 1e-115 | |
| 18408746 | 379 | zinc finger (MYND type) family protein / | 0.913 | 0.839 | 0.643 | 1e-114 | |
| 357465071 | 446 | F-box family protein [Medicago truncatul | 0.893 | 0.697 | 0.633 | 1e-114 |
| >gi|255540243|ref|XP_002511186.1| conserved hypothetical protein [Ricinus communis] gi|223550301|gb|EEF51788.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 471 bits (1211), Expect = e-130, Method: Compositional matrix adjust.
Identities = 235/349 (67%), Positives = 268/349 (76%), Gaps = 4/349 (1%)
Query: 1 MVQRKKLRTCRKLVEKPDLFDALPDDLLECVLSKLISSAPSPSDFINVLLTCKRLNRVGL 60
M QRK+ +T R+ EK DLFD LPDD++ C+LSKL SSA PSDFIN+L TCKRLNR+ L
Sbjct: 1 MYQRKRQKTSRRTPEKSDLFDELPDDIVVCILSKLSSSASCPSDFINILFTCKRLNRLAL 60
Query: 61 RPTVLSQAGPKALAVKAKNWSDSAHRFLKRCVFAGNLEACYTLGMIRFYCLQNRSSGTSL 120
+P VLS+AGP+ AVKAKNWSDSAHRFLK C+ AGN EA YTLGMIRFYCLQNR G SL
Sbjct: 61 QPVVLSKAGPQTFAVKAKNWSDSAHRFLKLCINAGNTEASYTLGMIRFYCLQNRGVGASL 120
Query: 121 MAKAAMKSHAPALYSLAVIQFNGSGGGKNEKDLRAGVALCARAASIGHVDAVRELGHCLQ 180
MAKAA+KSHAPALYSLAV+QFNGSGG K +KDLRAGV+LCARAA +GH+DA+RELGHCLQ
Sbjct: 121 MAKAAIKSHAPALYSLAVMQFNGSGGSKIDKDLRAGVSLCARAAVLGHIDALRELGHCLQ 180
Query: 181 DGYGVRQNIEKGRRLLIEANAREFFQSVSKTRTR--HQSYYFQLARATDAQIPCSPLLSD 238
DGYGV QNI +GRRLL++ANARE S+ T H ++ Q A + PLLSD
Sbjct: 181 DGYGVAQNIAEGRRLLVQANARELASSLRSMLTWQPHNQHHRQYASCEVMESAGCPLLSD 240
Query: 239 FGYNVEAPEVHPVNNFLKEWFESGVSDLGNGLRLCSYSGCGRPETRVHEYRRCSVCGKVN 298
FG NV A EVHP N FL EWFESG LG GLRLCS+SGCGRPETR HE+RRCSVCG VN
Sbjct: 241 FGCNVPAREVHPANRFLSEWFESGRGLLGPGLRLCSHSGCGRPETRPHEFRRCSVCGTVN 300
Query: 299 YCSRACQAIDWKTRHKRECVPPLAPLI--NDGDADGLEGMVEIAPAEFV 345
YCSR CQA+DWK RHK ECVP L+ +DG + + MVEI E V
Sbjct: 301 YCSRGCQALDWKLRHKMECVPLEQWLVVEDDGHDNEIGAMVEIEEREIV 349
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224136173|ref|XP_002322257.1| predicted protein [Populus trichocarpa] gi|222869253|gb|EEF06384.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449440552|ref|XP_004138048.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] gi|449519733|ref|XP_004166889.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255547716|ref|XP_002514915.1| conserved hypothetical protein [Ricinus communis] gi|223545966|gb|EEF47469.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224122012|ref|XP_002318728.1| f-box family protein [Populus trichocarpa] gi|222859401|gb|EEE96948.1| f-box family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356508806|ref|XP_003523145.1| PREDICTED: F-box protein At1g67340-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449454830|ref|XP_004145157.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] gi|449474252|ref|XP_004154118.1| PREDICTED: F-box protein At1g67340-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224053499|ref|XP_002297844.1| predicted protein [Populus trichocarpa] gi|222845102|gb|EEE82649.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18408746|ref|NP_564894.1| zinc finger (MYND type) family protein / F-box family protein [Arabidopsis thaliana] gi|75173237|sp|Q9FYF9.1|FB76_ARATH RecName: Full=F-box protein At1g67340 gi|9828618|gb|AAG00241.1|AC002130_6 F1N21.16 [Arabidopsis thaliana] gi|16209726|gb|AAL14418.1| At1g67340/F1N21_16 [Arabidopsis thaliana] gi|20260406|gb|AAM13101.1| unknown protein [Arabidopsis thaliana] gi|23197876|gb|AAN15465.1| unknown protein [Arabidopsis thaliana] gi|332196512|gb|AEE34633.1| zinc finger (MYND type) family protein / F-box family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357465071|ref|XP_003602817.1| F-box family protein [Medicago truncatula] gi|355491865|gb|AES73068.1| F-box family protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| TAIR|locus:2019604 | 379 | AT1G67340 "AT1G67340" [Arabido | 0.873 | 0.802 | 0.648 | 4e-106 | |
| TAIR|locus:2177522 | 336 | AT5G50450 [Arabidopsis thalian | 0.844 | 0.875 | 0.625 | 2.2e-98 | |
| UNIPROTKB|Q74B01 | 213 | GSU2395 "Uncharacterized prote | 0.321 | 0.525 | 0.327 | 1.8e-06 | |
| TIGR_CMR|GSU_2395 | 213 | GSU_2395 "conserved hypothetic | 0.321 | 0.525 | 0.327 | 1.8e-06 | |
| UNIPROTKB|G4NGF6 | 1240 | MGG_04327 "Uncharacterized pro | 0.114 | 0.032 | 0.6 | 3.8e-06 | |
| UNIPROTKB|F5GYS7 | 188 | PDCD2 "Programmed cell death p | 0.215 | 0.398 | 0.367 | 5.1e-06 | |
| UNIPROTKB|J3QK82 | 221 | PDCD2 "Programmed cell death 2 | 0.215 | 0.339 | 0.367 | 1.4e-05 | |
| UNIPROTKB|E9PCU7 | 228 | PDCD2 "Programmed cell death p | 0.215 | 0.328 | 0.367 | 1.6e-05 | |
| UNIPROTKB|I3L6K4 | 250 | PDCD2 "Uncharacterized protein | 0.215 | 0.3 | 0.367 | 1.7e-05 | |
| UNIPROTKB|Q2YDC9 | 344 | PDCD2 "Programmed cell death p | 0.206 | 0.209 | 0.369 | 2.8e-05 |
| TAIR|locus:2019604 AT1G67340 "AT1G67340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1050 (374.7 bits), Expect = 4.0e-106, P = 4.0e-106
Identities = 205/316 (64%), Positives = 244/316 (77%)
Query: 31 VLSKLISSAPSPSDFINVLLTCKRLNRVGLRPTVLSQAGPKALAVKAKNWSDSAHRFLKR 90
+L KL S++ P+DFINVLLTCKRL + + P VLS+ PKA+AVKA NWS+ +HRFLKR
Sbjct: 55 ILCKLGSTSRCPADFINVLLTCKRLKGLAMNPIVLSRLSPKAIAVKAHNWSEYSHRFLKR 114
Query: 91 CVFAGNLEACYTLGMIRFYCLQNRSSGTSLMAKAAMKSHAPALYSLAVIQFNGSGGGKNE 150
CV AG+LEACYTLGMIRFYCLQNR +G SLMAKAA+ SHAPALYSLAVIQFNGSGG KN+
Sbjct: 115 CVDAGSLEACYTLGMIRFYCLQNRGNGASLMAKAAISSHAPALYSLAVIQFNGSGGSKND 174
Query: 151 KDLRAGVALCARAASIGHVDAVRELGHCLQDGYGVRQNIEKGRRLLIEANAREFFQSVSK 210
KDLRAGVALCARAA +GHVDA+RELGHCLQDGYGV QN+ +GRR L++ANARE +V
Sbjct: 175 KDLRAGVALCARAAFLGHVDALRELGHCLQDGYGVPQNVSEGRRFLVQANAREL-AAVLS 233
Query: 211 TRTRHQSYYFQLARATDAQIP------CSPLLSDFGYNVEAPEVHPVNNFLKEWFESGVS 264
+ + +S + L++ +P C PLLSDFG NV APE HP N FL +WF
Sbjct: 234 SGIQARSTWLSLSQPPPPVVPNHGQQTC-PLLSDFGCNVPAPETHPANRFLADWFAVRGG 292
Query: 265 DL-GNGLRLCSYSGCGRPETRVHEYRRCSVCGKVNYCSRACQAIDWKTRHKRECVPPLAP 323
D G+GLRLCS++GCGRPETR HE+RRCSVCG VNYCSRACQA+DWK RHK +C P +
Sbjct: 293 DCPGDGLRLCSHAGCGRPETRKHEFRRCSVCGVVNYCSRACQALDWKLRHKMDCAP-VQR 351
Query: 324 LINDGDADGLEGMVEI 339
+ +GD G EG V+I
Sbjct: 352 WLEEGD--GGEGNVQI 365
|
|
| TAIR|locus:2177522 AT5G50450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74B01 GSU2395 "Uncharacterized protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2395 GSU_2395 "conserved hypothetical protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NGF6 MGG_04327 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GYS7 PDCD2 "Programmed cell death protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QK82 PDCD2 "Programmed cell death 2, isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PCU7 PDCD2 "Programmed cell death protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L6K4 PDCD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2YDC9 PDCD2 "Programmed cell death protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 9e-11 | |
| pfam01753 | 39 | pfam01753, zf-MYND, MYND finger | 1e-08 | |
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 2e-05 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 6e-04 | |
| COG0790 | 292 | COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily | 0.001 |
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
Score = 61.6 bits (149), Expect = 9e-11
Identities = 27/115 (23%), Positives = 47/115 (40%), Gaps = 6/115 (5%)
Query: 94 AGNLEACYTLGMIRFY---CLQNRSSGTSLMAKAAMKSHAPA---LYSLAVIQFNGSGGG 147
G EA + LG++ + KAA + A +Y L + +G
Sbjct: 106 DGLAEALFNLGLMYANGRGVPLDLVKALKYYEKAAKLGNVEAALAMYRLGLAYLSGLQAL 165
Query: 148 KNEKDLRAGVALCARAASIGHVDAVRELGHCLQDGYGVRQNIEKGRRLLIEANAR 202
D + + L +AA +G+ DA LG + G GV ++++K R +A +
Sbjct: 166 AVAYDDKKALYLYRKAAELGNPDAQLLLGRMYEKGLGVPRDLKKAFRWYKKAAEQ 220
|
Length = 292 |
| >gnl|CDD|201954 pfam01753, zf-MYND, MYND finger | Back alignment and domain information |
|---|
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
| >gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 99.88 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 99.8 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 99.77 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 99.73 | |
| KOG4014 | 248 | consensus Uncharacterized conserved protein (conta | 99.43 | |
| KOG4014 | 248 | consensus Uncharacterized conserved protein (conta | 99.26 | |
| PF01753 | 37 | zf-MYND: MYND finger; InterPro: IPR002893 Zinc fin | 98.89 | |
| smart00671 | 36 | SEL1 Sel1-like repeats. These represent a subfamil | 98.62 | |
| PF08238 | 39 | Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r | 98.57 | |
| PF08238 | 39 | Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r | 98.52 | |
| smart00671 | 36 | SEL1 Sel1-like repeats. These represent a subfamil | 98.52 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.22 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 97.88 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.71 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.61 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 97.59 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.58 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.58 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.52 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 97.5 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.47 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.37 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.36 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 97.35 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.34 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.34 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.32 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.27 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.22 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.18 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.18 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.1 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.08 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 96.92 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.92 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.88 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 96.87 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 96.79 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.76 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 96.74 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 96.61 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.55 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.5 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 96.45 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 96.45 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.45 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 96.4 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 96.35 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.33 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.3 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.26 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.18 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 96.16 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 96.12 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 96.07 | |
| KOG3612 | 588 | consensus PHD Zn-finger protein [General function | 96.03 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 95.98 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 95.94 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.83 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 95.77 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 95.73 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 95.71 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 95.68 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 95.68 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 95.65 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.64 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 95.61 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 95.56 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 95.54 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.49 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 95.44 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 95.43 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 95.42 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 95.36 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 95.33 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 95.27 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 95.22 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 95.17 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 95.12 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 95.06 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 95.01 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 94.95 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 94.91 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 94.69 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 94.52 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 94.47 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.46 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 94.39 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 94.28 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 94.23 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 94.15 | |
| KOG2061 | 362 | consensus Uncharacterized MYND Zn-finger protein [ | 94.11 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 94.04 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 93.86 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 93.59 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 93.55 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 93.52 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 93.51 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 93.44 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 92.96 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 92.7 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 92.56 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 92.08 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 92.04 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 91.91 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 91.67 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 91.54 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 91.29 | |
| PLN03158 | 396 | methionine aminopeptidase; Provisional | 91.24 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 91.18 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 90.83 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 90.67 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 90.28 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 90.24 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 89.7 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 89.67 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 89.61 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 89.5 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 88.77 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 88.51 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 88.18 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 87.97 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 87.96 | |
| PF13824 | 55 | zf-Mss51: Zinc-finger of mitochondrial splicing su | 87.79 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 87.65 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 87.55 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 87.49 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 87.29 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 87.28 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 86.96 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 86.76 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 86.73 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 86.44 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 86.35 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 86.03 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 85.88 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 85.84 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 85.62 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 85.4 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 85.16 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 84.78 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 83.91 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 83.07 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 81.92 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 81.61 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 81.5 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 80.74 | |
| PLN02789 | 320 | farnesyltranstransferase | 80.47 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 80.12 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 80.07 |
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.88 E-value=3.2e-21 Score=181.38 Aligned_cols=128 Identities=22% Similarity=0.248 Sum_probs=122.8
Q ss_pred cHHHHHHHHHHHHHCCCHHHHHHhhhhhh---hccCCHHHHHHHHHHHHhCCCHHH---HHHHHHHHHcc---CCCCCCc
Q 018965 80 WSDSAHRFLKRCVFAGNLEACYTLGMIRF---YCLQNRSSGTSLMAKAAMKSHAPA---LYSLAVIQFNG---SGGGKNE 150 (348)
Q Consensus 80 ~~~~A~~~~~kaA~~G~~~A~~~Lg~~y~---~~~~d~~~A~~~~~~AA~~G~~~A---~~~Lg~~y~~G---~g~~~~~ 150 (348)
+..+|+.||+++++.|++.+++.||.+|. |+++|..+|+.||++||++|++.| ++.||.+|..| .+ ++
T Consensus 92 ~~~~A~~~~~~~a~~g~~~a~~~lg~~~~~G~gv~~d~~~A~~~~~~Aa~~g~~~a~~~~~~l~~~~~~g~~~~~---~~ 168 (292)
T COG0790 92 DKTKAADWYRCAAADGLAEALFNLGLMYANGRGVPLDLVKALKYYEKAAKLGNVEAALAMYRLGLAYLSGLQALA---VA 168 (292)
T ss_pred cHHHHHHHHHHHhhcccHHHHHhHHHHHhcCCCcccCHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHcChhhhc---cc
Confidence 37899999999999999999999999998 689999999999999999999999 99999999999 77 99
Q ss_pred cCHHHHHHHHHHHHhCCCHHHHHHHHHHHhccCCCCCCHHHHHHHHHHHHhcCCHHHHHh
Q 018965 151 KDLRAGVALCARAASIGHVDAVRELGHCLQDGYGVRQNIEKGRRLLIEANAREFFQSVSK 210 (348)
Q Consensus 151 ~d~~~A~~~~~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~~Aa~~G~~~A~~~ 210 (348)
.|..+|+.||.+|+++|++.|++.||.+|..|.||++|.++|++||.+|+++|+..++..
T Consensus 169 ~~~~~A~~~~~~aa~~~~~~a~~~lg~~y~~G~Gv~~d~~~A~~wy~~Aa~~g~~~a~~~ 228 (292)
T COG0790 169 YDDKKALYLYRKAAELGNPDAQLLLGRMYEKGLGVPRDLKKAFRWYKKAAEQGDGAACYN 228 (292)
T ss_pred HHHHhHHHHHHHHHHhcCHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHHCCCHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999777764
|
|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] | Back alignment and domain information |
|---|
| >KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] | Back alignment and domain information |
|---|
| >PF01753 zf-MYND: MYND finger; InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00671 SEL1 Sel1-like repeats | Back alignment and domain information |
|---|
| >PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] | Back alignment and domain information |
|---|
| >PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] | Back alignment and domain information |
|---|
| >smart00671 SEL1 Sel1-like repeats | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3612 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG2061 consensus Uncharacterized MYND Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03158 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13824 zf-Mss51: Zinc-finger of mitochondrial splicing suppressor 51 | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 2e-12 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 3e-09 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 2e-05 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 3e-12 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 3e-12 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 3e-12 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 4e-12 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-11 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-11 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 6e-11 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 2e-05 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 4e-12 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 6e-12 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 7e-12 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 1e-11 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 1e-08 | |
| 2dj8_A | 60 | Protein CBFA2T1; zinc finger MYND domain, protein | 3e-10 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 5e-10 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 5e-06 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 6e-10 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 1e-09 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 5e-09 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 1e-07 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 3e-07 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 2e-06 | |
| 2odd_A | 64 | Protein CBFA2T1; MYND zinc finger, cross-braced to | 6e-10 | |
| 2jw6_A | 52 | Deformed epidermal autoregulatory factor 1 homolo; | 1e-09 | |
| 2od1_A | 60 | Protein CBFA2T1; zinc finger, cross-braced topolog | 1e-09 | |
| 2d8q_A | 70 | BLU protein, zinc finger MYND domain containing pr | 3e-09 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 4e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-04 |
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 | Back alignment and structure |
|---|
Score = 64.6 bits (158), Expect = 2e-12
Identities = 21/106 (19%), Positives = 33/106 (31%), Gaps = 5/106 (4%)
Query: 94 AGNLEACYTLGMIRFYCLQNRSSGTSLMAKAAMKSHAPALYSLAVIQFNGSGGGKNEKDL 153
AG+ A Y L + + KAA + AL LA ++ + D
Sbjct: 15 AGDRRAQYYLADT-WVSSGDYQKAEYWAQKAAAQGDGDALALLAQLKIRNPQ----QADY 69
Query: 154 RAGVALCARAASIGHVDAVRELGHCLQDGYGVRQNIEKGRRLLIEA 199
L +A G L L + ++ LL +A
Sbjct: 70 PQARQLAEKAVEAGSKSGEIVLARVLVNRQAGATDVAHAITLLQDA 115
|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 | Back alignment and structure |
|---|
| >2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 60 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 | Back alignment and structure |
|---|
| >2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 Length = 52 | Back alignment and structure |
|---|
| >2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A Length = 70 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.95 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 99.93 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.92 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.91 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 99.87 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 99.84 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 99.84 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 99.83 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.75 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.74 | |
| 2d8q_A | 70 | BLU protein, zinc finger MYND domain containing pr | 99.08 | |
| 2dj8_A | 60 | Protein CBFA2T1; zinc finger MYND domain, protein | 98.99 | |
| 2od1_A | 60 | Protein CBFA2T1; zinc finger, cross-braced topolog | 98.98 | |
| 2odd_A | 64 | Protein CBFA2T1; MYND zinc finger, cross-braced to | 98.96 | |
| 2jw6_A | 52 | Deformed epidermal autoregulatory factor 1 homolo; | 98.95 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.31 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.31 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.3 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 98.27 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.24 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.23 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.21 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.18 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.14 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.1 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.08 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.08 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.08 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.07 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.07 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 98.06 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 98.06 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.06 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.06 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.02 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.02 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.99 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.99 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.96 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.96 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.96 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.96 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.95 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.94 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.94 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.94 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.92 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.92 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.92 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.87 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.86 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.85 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.85 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.84 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.84 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.84 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.81 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.8 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.79 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.79 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.78 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.78 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.78 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.77 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.77 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.76 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 97.75 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 97.74 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.72 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.71 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.71 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.71 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.71 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.7 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.7 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.7 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.68 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 97.68 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.67 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.67 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.67 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.66 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.66 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.66 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.65 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.65 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.63 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.63 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.63 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.62 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.6 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.6 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 97.6 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.59 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.58 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 97.55 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.53 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.53 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.52 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.52 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.51 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.51 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.5 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.5 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 97.49 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.48 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.47 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.44 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.44 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.43 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.43 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.42 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.42 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 97.42 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.41 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.4 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 97.39 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.39 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.39 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.39 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.38 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.38 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 97.37 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.35 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.34 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.34 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.33 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.32 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.32 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.3 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.3 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 97.29 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 97.29 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.28 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.27 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.26 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.24 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.24 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 97.24 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.24 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 97.23 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.21 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.2 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.18 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.18 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.17 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.16 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.15 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.15 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.15 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 97.14 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.13 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.13 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.12 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.12 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.09 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.07 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.05 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 97.05 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 97.0 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 96.98 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 96.96 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.96 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 96.95 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 96.94 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 96.93 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.92 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.91 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 96.89 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 96.89 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 96.88 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 96.87 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.85 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.83 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 96.81 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.81 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 96.75 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.74 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 96.72 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.69 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.64 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 96.53 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 96.45 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 96.34 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 96.06 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.02 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.98 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.93 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 95.66 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.53 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 95.52 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 95.49 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 95.0 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 94.98 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 94.92 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 94.89 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 94.84 | |
| 2yqq_A | 56 | Zinc finger HIT domain-containing protein 3; struc | 94.68 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 94.64 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 94.28 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 93.06 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 92.48 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 92.4 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 92.18 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 91.98 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 91.49 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 90.93 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 90.77 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 89.79 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 88.59 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 87.69 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 87.63 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 87.44 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 86.93 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 86.44 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 86.25 | |
| 1x4s_A | 59 | Protein FON, zinc finger HIT domain containing pro | 85.52 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 84.91 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 82.31 |
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
Probab=99.95 E-value=1.3e-26 Score=193.17 Aligned_cols=124 Identities=18% Similarity=0.156 Sum_probs=118.9
Q ss_pred HHHHHHHHHHHHHCCCHHHHHHhhhhhhhccCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHccCCCCCCccCHHHHHHHH
Q 018965 81 SDSAHRFLKRCVFAGNLEACYTLGMIRFYCLQNRSSGTSLMAKAAMKSHAPALYSLAVIQFNGSGGGKNEKDLRAGVALC 160 (348)
Q Consensus 81 ~~~A~~~~~kaA~~G~~~A~~~Lg~~y~~~~~d~~~A~~~~~~AA~~G~~~A~~~Lg~~y~~G~g~~~~~~d~~~A~~~~ 160 (348)
.++|+.||+++++.|+++|+ ||.+|. ...+.++|++||++|+++|++.|+++||.+|..|.| +++|+++|++||
T Consensus 11 ~~~A~~~~~~aa~~g~~~a~--lg~~y~-~g~~~~~A~~~~~~Aa~~g~~~a~~~Lg~~y~~G~g---~~~d~~~A~~~~ 84 (138)
T 1klx_A 11 LKKAIQYYVKACELNEMFGC--LSLVSN-SQINKQKLFQYLSKACELNSGNGCRFLGDFYENGKY---VKKDLRKAAQYY 84 (138)
T ss_dssp HHHHHHHHHHHHHTTCTTHH--HHHHTC-TTSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSS---SCCCHHHHHHHH
T ss_pred HHHHHHHHHHHHcCCCHhhh--HHHHHH-cCCCHHHHHHHHHHHHcCCCHHHHHHHHHHHHcCCC---CCccHHHHHHHH
Confidence 78999999999999999999 999998 345667799999999999999999999999999999 999999999999
Q ss_pred HHHHhCCCHHHHHHHHHHHhccCCCCCCHHHHHHHHHHHHhcCCHHHHHh
Q 018965 161 ARAASIGHVDAVRELGHCLQDGYGVRQNIEKGRRLLIEANAREFFQSVSK 210 (348)
Q Consensus 161 ~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~~Aa~~G~~~A~~~ 210 (348)
++|++.|++.|+++||.+|.+|.||++|.++|++||++|+++|++.|+.+
T Consensus 85 ~~Aa~~g~~~a~~~Lg~~y~~G~g~~~d~~~A~~~~~~Aa~~g~~~A~~~ 134 (138)
T 1klx_A 85 SKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACGI 134 (138)
T ss_dssp HHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHHHHHTTCHHHHHH
T ss_pred HHHHcCCCHHHHHHHHHHHHCCCCCCcCHHHHHHHHHHHHHCCCHHHHHH
Confidence 99999999999999999999999999999999999999999999999975
|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2d8q_A BLU protein, zinc finger MYND domain containing protein 10; zmynd10, ZF-MYND, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.1 PDB: 2dan_A | Back alignment and structure |
|---|
| >2dj8_A Protein CBFA2T1; zinc finger MYND domain, protein MTG8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.85.1.1 | Back alignment and structure |
|---|
| >2od1_A Protein CBFA2T1; zinc finger, cross-braced topology, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2odd_A Protein CBFA2T1; MYND zinc finger, cross-braced topology, poly-proline, proline-tryptophan interaction, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw6_A Deformed epidermal autoregulatory factor 1 homolo; zinc binding domain, transcription, alternative splicing, DI mutation, DNA-binding; NMR {Homo sapiens} SCOP: g.85.1.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2yqq_A Zinc finger HIT domain-containing protein 3; structure genomics, ZF-HIT domain, TRIP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1x4s_A Protein FON, zinc finger HIT domain containing protein 2; structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.85.1.2 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 348 | ||||
| d2dj8a1 | 47 | g.85.1.1 (A:8-54) Zinc finger MYND domain-containi | 2e-08 | |
| d2jw6a1 | 38 | g.85.1.1 (A:503-540) Zinc finger MYND domain-conta | 2e-08 | |
| d2dana1 | 47 | g.85.1.1 (A:8-54) Zinc finger MYND domain-containi | 4e-08 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 2e-04 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 0.001 | |
| d1ouva_ | 265 | a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He | 0.004 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 0.004 |
| >d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
class: Small proteins fold: HIT/MYND zinc finger-like superfamily: HIT/MYND zinc finger-like family: MYND zinc finger domain: Zinc finger MYND domain-containing protein 2, MTG8 species: Human (Homo sapiens) [TaxId: 9606]
Score = 48.1 bits (114), Expect = 2e-08
Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 8/55 (14%)
Query: 263 VSDLGNGLRLCSYSGCGRPETRVHEYRRCSVCGKVNYCSRACQAIDWKTRHKREC 317
++ + C CGR + CS C YC CQ DW+ +H C
Sbjct: 1 INQQEDSSESCWN--CGRKASE-----TCSGCNTARYCGSFCQHKDWE-KHHHIC 47
|
| >d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 99.95 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 99.86 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 99.83 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 99.73 | |
| d2dana1 | 47 | Zinc finger MYND domain-containing protein 10, ZMY | 99.3 | |
| d2jw6a1 | 38 | Zinc finger MYND domain-containing protein 2, MTG8 | 99.26 | |
| d2dj8a1 | 47 | Zinc finger MYND domain-containing protein 2, MTG8 | 99.22 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.14 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.04 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.99 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.97 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.93 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.87 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.84 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.81 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.8 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.62 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.58 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.54 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.53 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.47 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.44 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.43 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.37 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.36 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.34 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.3 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 97.25 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.25 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 97.19 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.17 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.14 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.02 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.97 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 96.95 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 96.9 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.84 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 96.77 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.7 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.65 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.58 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 96.51 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.29 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 96.21 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.2 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.17 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.16 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 94.85 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 94.51 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 94.2 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 93.66 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 92.67 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 92.27 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 91.97 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 91.09 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 90.62 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 90.46 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 90.07 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 88.79 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 86.15 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 85.54 |
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: HCP-like family: HCP-like domain: Cysteine rich protein B (HcpB) species: Helicobacter pylori [TaxId: 210]
Probab=99.95 E-value=2.2e-27 Score=194.76 Aligned_cols=123 Identities=18% Similarity=0.139 Sum_probs=119.2
Q ss_pred HHHHHHHHHHHHHCCCHHHHHHhhhhhhhccCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHccCCCCCCccCHHHHHHHH
Q 018965 81 SDSAHRFLKRCVFAGNLEACYTLGMIRFYCLQNRSSGTSLMAKAAMKSHAPALYSLAVIQFNGSGGGKNEKDLRAGVALC 160 (348)
Q Consensus 81 ~~~A~~~~~kaA~~G~~~A~~~Lg~~y~~~~~d~~~A~~~~~~AA~~G~~~A~~~Lg~~y~~G~g~~~~~~d~~~A~~~~ 160 (348)
.++|++||++||+.|++.|++.||.. .++|.++|++||++|+++|++.|++.||.+|.+|.+ +++|..+|++||
T Consensus 9 ~~~A~~~~~kaa~~g~~~a~~~l~~~---~~~~~~~a~~~~~~aa~~g~~~a~~~Lg~~y~~g~~---~~~d~~~A~~~~ 82 (133)
T d1klxa_ 9 LKKAIQYYVKACELNEMFGCLSLVSN---SQINKQKLFQYLSKACELNSGNGCRFLGDFYENGKY---VKKDLRKAAQYY 82 (133)
T ss_dssp HHHHHHHHHHHHHTTCTTHHHHHHTC---TTSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHCSS---SCCCHHHHHHHH
T ss_pred HHHHHHHHHHHHHCCChhhhhhhccc---cccCHHHHHHHHhhhhcccchhhhhhHHHhhhhccc---cchhhHHHHHHH
Confidence 78999999999999999999999865 568999999999999999999999999999999999 999999999999
Q ss_pred HHHHhCCCHHHHHHHHHHHhccCCCCCCHHHHHHHHHHHHhcCCHHHHH
Q 018965 161 ARAASIGHVDAVRELGHCLQDGYGVRQNIEKGRRLLIEANAREFFQSVS 209 (348)
Q Consensus 161 ~kAA~~G~~~A~~~Lg~~y~~G~Gv~~d~~~A~~w~~~Aa~~G~~~A~~ 209 (348)
++|++.|++.|+++||.+|.+|.||++|.++|++||++|+++|++.|+.
T Consensus 83 ~~aa~~g~~~a~~~Lg~~y~~G~gv~~d~~~A~~~~~~Aa~~G~~~A~~ 131 (133)
T d1klxa_ 83 SKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFEKACRLGSEDACG 131 (133)
T ss_dssp HHHHHTTCHHHHHHHHHHHHHTSSSCCCHHHHHHHHHHHHHTTCHHHHH
T ss_pred hhhhccCcchHHHHHHHHHHcCCccCCCHHHHHHHHHHHHHCCCHHHHH
Confidence 9999999999999999999999999999999999999999999999986
|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2dana1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 10, ZMYND10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jw6a1 g.85.1.1 (A:503-540) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj8a1 g.85.1.1 (A:8-54) Zinc finger MYND domain-containing protein 2, MTG8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|