Citrus Sinensis ID: 018975
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| 224067503 | 354 | predicted protein [Populus trichocarpa] | 0.997 | 0.980 | 0.602 | 1e-117 | |
| 255541032 | 355 | RING finger protein, putative [Ricinus c | 0.956 | 0.938 | 0.629 | 1e-116 | |
| 297734619 | 355 | unnamed protein product [Vitis vinifera] | 0.954 | 0.935 | 0.633 | 1e-115 | |
| 359489298 | 429 | PREDICTED: uncharacterized protein LOC10 | 0.916 | 0.743 | 0.636 | 1e-110 | |
| 359806693 | 366 | uncharacterized protein LOC100791789 [Gl | 0.931 | 0.885 | 0.558 | 1e-100 | |
| 30695166 | 366 | ubiquitin-protein ligase RNF25 [Arabidop | 0.784 | 0.745 | 0.603 | 5e-95 | |
| 334186148 | 383 | ubiquitin-protein ligase RNF25 [Arabidop | 0.784 | 0.712 | 0.561 | 2e-90 | |
| 297817326 | 335 | predicted protein [Arabidopsis lyrata su | 0.683 | 0.710 | 0.565 | 2e-82 | |
| 108864512 | 379 | RWD domain containing protein, expressed | 0.841 | 0.773 | 0.496 | 3e-82 | |
| 226499170 | 358 | LOC100282323 [Zea mays] gi|195621552|gb| | 0.922 | 0.896 | 0.473 | 5e-82 |
| >gi|224067503|ref|XP_002302496.1| predicted protein [Populus trichocarpa] gi|222844222|gb|EEE81769.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 429 bits (1102), Expect = e-117, Method: Compositional matrix adjust.
Identities = 214/355 (60%), Positives = 262/355 (73%), Gaps = 8/355 (2%)
Query: 1 MAEEEVAMELEAVQAVYGDECVVLDSYPPHLHLRIKPRTADVSSQQFVEAVIGIRASPKY 60
MAEEEV +E+EAV A+YGD+CV+L+S+PPHLHL IKPRTAD+SSQQFVEAVIGIRA P+Y
Sbjct: 1 MAEEEVLIEVEAVLAMYGDDCVILESFPPHLHLHIKPRTADISSQQFVEAVIGIRAGPQY 60
Query: 61 PEHPPRIDLIESKGLDDQRQKHLISCIQDKAHELTSCLMLVALCEEAVAKLSAMNHPDGD 120
P PP IDLIESKGLD +RQK LI+ IQ+KA EL+SCLMLVALCEEAV KL+ MNHPDGD
Sbjct: 61 PSKPPWIDLIESKGLDGERQKQLITGIQEKACELSSCLMLVALCEEAVEKLTVMNHPDGD 120
Query: 121 CPLCLYPLFRKDKNVEVLPFMKLMSCFHCFHSECIVRWWNWLQNGIETDSCATVHPN--- 177
CPLC+ P +D+ E LPFMKLMSCFHCFH ECIVRWWNW+Q E+++ +
Sbjct: 121 CPLCMCPFVPEDEQDEALPFMKLMSCFHCFHCECIVRWWNWIQKEKESNTSTSSSTTLLQ 180
Query: 178 -TDMRNQ---KDMLGPIDGNMGTCPVCRKVFHVKDLEHVLNLVGSQSSHLSSNGNEVDDD 233
+M NQ D+ G ++ MG CPVCRKVFHVKD EHVL+LVG+Q+S L S E+ +
Sbjct: 181 IKEMGNQNGLSDVHGVLEERMGDCPVCRKVFHVKDFEHVLDLVGTQASQLDSEA-EIKYE 239
Query: 234 DKYLHSDSENIRRQKFEAILKLQEENSGLIEPKRDLVVLPGMFLPQPATLPTPTSTKETT 293
+K LHSDSEN RRQKFEAILKLQ+ENSGLIEPKR++VV+PG++LPQ AT T KET
Sbjct: 240 EKLLHSDSENFRRQKFEAILKLQQENSGLIEPKREIVVVPGIYLPQRATSAAQTVNKETA 299
Query: 294 EQEQGEQSAPAEINATGSSNRASGSKHWNSGMRKRRGRNLRNQRQWIRKDDSSVN 348
E + E E N S NR + NSG R+ + R QW+R+++ + +
Sbjct: 300 EHQGTEARPSTETNLGSSLNRPRPRESRNSGRRQGVRNSRRPVSQWVRRENGTAD 354
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255541032|ref|XP_002511580.1| RING finger protein, putative [Ricinus communis] gi|223548760|gb|EEF50249.1| RING finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297734619|emb|CBI16670.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359489298|ref|XP_002270913.2| PREDICTED: uncharacterized protein LOC100253028 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359806693|ref|NP_001241545.1| uncharacterized protein LOC100791789 [Glycine max] gi|255644864|gb|ACU22932.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30695166|ref|NP_191589.3| ubiquitin-protein ligase RNF25 [Arabidopsis thaliana] gi|66865936|gb|AAY57602.1| RING finger family protein [Arabidopsis thaliana] gi|332646519|gb|AEE80040.1| ubiquitin-protein ligase RNF25 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334186148|ref|NP_001190140.1| ubiquitin-protein ligase RNF25 [Arabidopsis thaliana] gi|332646520|gb|AEE80041.1| ubiquitin-protein ligase RNF25 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297817326|ref|XP_002876546.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322384|gb|EFH52805.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|108864512|gb|ABA94379.2| RWD domain containing protein, expressed [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|226499170|ref|NP_001148707.1| LOC100282323 [Zea mays] gi|195621552|gb|ACG32606.1| ubiquitin-protein ligase/ zinc ion binding protein [Zea mays] gi|219884689|gb|ACL52719.1| unknown [Zea mays] gi|413925312|gb|AFW65244.1| Ubiquitin-protein ligase/ zinc ion binding protein [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 348 | ||||||
| FB|FBgn0033884 | 374 | CG13344 [Drosophila melanogast | 0.623 | 0.580 | 0.276 | 3.4e-12 | |
| ZFIN|ZDB-GENE-040426-1581 | 513 | rnf25 "ring finger protein 25" | 0.482 | 0.327 | 0.296 | 7.5e-12 | |
| UNIPROTKB|F1P4G1 | 469 | RNF25 "Uncharacterized protein | 0.479 | 0.356 | 0.270 | 5e-11 | |
| MGI|MGI:1890215 | 456 | Rnf25 "ring finger protein 25" | 0.505 | 0.385 | 0.299 | 2.6e-10 | |
| RGD|1311557 | 454 | Rnf25 "ring finger protein 25" | 0.451 | 0.345 | 0.289 | 9.7e-10 | |
| UNIPROTKB|E2RE32 | 459 | RNF25 "Uncharacterized protein | 0.485 | 0.368 | 0.264 | 1.3e-09 | |
| UNIPROTKB|F1MWS4 | 458 | RNF25 "E3 ubiquitin-protein li | 0.482 | 0.366 | 0.264 | 1.7e-09 | |
| UNIPROTKB|Q5E9N3 | 458 | RNF25 "E3 ubiquitin-protein li | 0.482 | 0.366 | 0.259 | 1.4e-08 | |
| UNIPROTKB|Q96BH1 | 459 | RNF25 "E3 ubiquitin-protein li | 0.482 | 0.366 | 0.241 | 1.4e-08 | |
| UNIPROTKB|I3LCK8 | 470 | LOC100739271 "Uncharacterized | 0.474 | 0.351 | 0.268 | 7.3e-08 |
| FB|FBgn0033884 CG13344 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 185 (70.2 bits), Expect = 3.4e-12, P = 3.4e-12
Identities = 66/239 (27%), Positives = 100/239 (41%)
Query: 35 IKPRTADVSSQQFVEAVIGIRASPKYPEHPPRIDLIESKGLDDQRQKHLISCIQDKAHEL 94
+ P T + QQ+V + + +P YPE P L+ +GLDD R + + S K E
Sbjct: 36 VLPLTGEEEEQQYVCVTLQVHPTPGYPEESPTFKLLRPRGLDDARLEAIRSACNAKIKES 95
Query: 95 TSCLMLVALCEEAVAKLSAMNHPDGDCPLCLYPLFRKDKNVEVLPFMKLMSCFHCFHSEC 154
++ L E LS N P G C +CLY D+ F + CFH HS C
Sbjct: 96 IGFPVVFDLIEVVREHLSGSNLPSGQCVVCLYGFADGDE------FTRT-ECFHYLHSYC 148
Query: 155 IVRWWNWLQNGIETDSCATVHPNTDMRNQKDMLGPIDGNMGTCPVCRKVFHVKDLEHVLN 214
+ R N L+ + + QK D CPVCR+ H+ D L
Sbjct: 149 LARHLNALRRNYQEE-----FDKLPAWLQKTA----DPFQALCPVCRE--HIGDETDSLK 197
Query: 215 LVGSQSSHLSSNGNEVDDDDKYLHSD-SENIRRQKFE-AILKLQEENSGLI--EPKRDL 269
S L++ +V ++ + + SE +QK AI+ + E S +I E + D+
Sbjct: 198 CAMPPSELLNAPEFKVTEELRQMQQRMSELYLQQKSRGAIIDVNAEGSAVISIETEEDI 256
|
|
| ZFIN|ZDB-GENE-040426-1581 rnf25 "ring finger protein 25" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4G1 RNF25 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1890215 Rnf25 "ring finger protein 25" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1311557 Rnf25 "ring finger protein 25" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE32 RNF25 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MWS4 RNF25 "E3 ubiquitin-protein ligase RNF25" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5E9N3 RNF25 "E3 ubiquitin-protein ligase RNF25" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96BH1 RNF25 "E3 ubiquitin-protein ligase RNF25" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LCK8 LOC100739271 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| pfam05773 | 113 | pfam05773, RWD, RWD domain | 8e-19 | |
| smart00591 | 107 | smart00591, RWD, domain in RING finger and WD repe | 9e-18 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 2e-04 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 4e-04 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 0.001 | |
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 0.004 |
| >gnl|CDD|218742 pfam05773, RWD, RWD domain | Back alignment and domain information |
|---|
Score = 80.4 bits (199), Expect = 8e-19
Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 2/109 (1%)
Query: 1 MAEEEVAMELEAVQAVYGDEC--VVLDSYPPHLHLRIKPRTADVSSQQFVEAVIGIRASP 58
++E ELEA++++Y DE V +S PP +++K T++ S V V+
Sbjct: 1 ESKELQEEELEALESIYPDEFEDEVKESSPPTFTIKLKLLTSEAESSPLVSLVLTFTLPE 60
Query: 59 KYPEHPPRIDLIESKGLDDQRQKHLISCIQDKAHELTSCLMLVALCEEA 107
YP+ PP+I L L DQ + L+ +++ A E +M+ L E
Sbjct: 61 DYPDEPPKISLSSPWLLRDQDKLQLLKELEELAEENLGEVMIFELIEWL 109
|
This domain was identified in WD40 repeat proteins and Ring finger domain proteins. The function of this domain is unknown. GCN2 is the alpha-subunit of the only translation initiation factor (eIF2 alpha) kinase that appears in all eukaryotes. Its function requires an interaction with GCN1 via the domain at its N-terminus, which is termed the RWD domain after three major RWD-containing proteins: RING finger-containing proteins, WD-repeat-containing proteins, and yeast DEAD (DEXD)-like helicases. The structure forms an alpha + beta sandwich fold consisting of two layers: a four-stranded antiparallel beta-sheet, and three side-by-side alpha-helices. Length = 113 |
| >gnl|CDD|214735 smart00591, RWD, domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| smart00591 | 107 | RWD domain in RING finger and WD repeat containing | 99.7 | |
| PF05773 | 113 | RWD: RWD domain; InterPro: IPR006575 The RWD eukar | 99.67 | |
| KOG4018 | 215 | consensus Uncharacterized conserved protein, conta | 99.61 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.44 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.26 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 99.23 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.02 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.98 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.98 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.96 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.94 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.86 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.83 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.83 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.83 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.72 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.67 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.62 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.61 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.61 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.59 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.55 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.51 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.5 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.48 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.48 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.42 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.35 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.3 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 98.28 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.28 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.25 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 98.25 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.23 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.23 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.2 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.2 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.13 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.93 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 97.92 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.87 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.85 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.84 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.83 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.68 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.65 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.55 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 97.48 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.39 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.34 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.29 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.29 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.16 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.99 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.79 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 96.78 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.73 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.68 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 96.47 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.27 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.26 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.91 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 95.89 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 95.87 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 95.83 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.75 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.73 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.36 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.24 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.19 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 95.18 | |
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 94.78 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 94.74 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 94.67 | |
| PHA02862 | 156 | 5L protein; Provisional | 94.66 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 94.33 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 94.33 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.28 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 93.89 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 93.87 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.78 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 93.51 | |
| PHA03096 | 284 | p28-like protein; Provisional | 93.37 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 93.25 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 93.19 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 92.64 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.56 | |
| KOG0421 | 175 | consensus Ubiquitin-protein ligase [Posttranslatio | 92.55 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 92.37 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 92.03 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 91.93 | |
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 91.64 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 91.57 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.55 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 91.34 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 91.08 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 90.98 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.47 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 90.47 | |
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 90.32 | |
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 89.99 | |
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 89.45 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 89.39 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 89.23 | |
| KOG0417 | 148 | consensus Ubiquitin-protein ligase [Posttranslatio | 89.12 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 88.64 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 87.89 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.81 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 86.98 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 86.32 | |
| KOG1829 | 580 | consensus Uncharacterized conserved protein, conta | 86.15 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 85.06 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 84.44 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 83.48 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 83.3 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 82.65 | |
| KOG0416 | 189 | consensus Ubiquitin-protein ligase [Posttranslatio | 82.09 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 81.54 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.74 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.25 |
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.9e-41 Score=307.31 Aligned_cols=231 Identities=21% Similarity=0.406 Sum_probs=179.9
Q ss_pred HHHHHHHhhcCCCceeccCCCCeeEEEEecCCCCCCCCcceEEEEEEEcCCCCCCCCCcccccCCCCCCHHHHHHHHHHH
Q 018975 8 MELEAVQAVYGDECVVLDSYPPHLHLRIKPRTADVSSQQFVEAVIGIRASPKYPEHPPRIDLIESKGLDDQRQKHLISCI 87 (348)
Q Consensus 8 ~ElEAL~sIY~dd~~v~~~~~~~~~i~i~p~~~~~~~~~~v~i~L~i~lp~~YP~~~P~i~i~~~~GL~~~~i~~L~~~L 87 (348)
.|++||.+|+..- .+-+..+..++++++|.++++.++++|+|+|.+..+++||.++|.|.++++|||++.++..|++.+
T Consensus 6 ~e~~~ld~i~~~~-~~~s~~~~~i~~t~hpit~eedesqyvcvtl~m~vs~gYP~esPtvtl~nPRGl~d~~~~~i~~~~ 84 (368)
T KOG4445|consen 6 GEIEALDSIWDGV-HVESKLEASIRYTKHPITSEEDESQYVCVTLEMTVSEGYPAESPTVTLSNPRGLGDPEFREIQRQI 84 (368)
T ss_pred hhhHhhhhHhhcc-CCCCCChhhheeeecccccccccceeEEEEEEEecCCCCCCcCCceEecCCCCCCcHHHHHHHHHH
Confidence 4677777776642 233445678999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCchhhHHHHHHHHHhhhCCCCCCCCCccccccccCCCCccccCcccccCCCCcccHHHHHHHHHHhhcCcc
Q 018975 88 QDKAHELTSCLMLVALCEEAVAKLSAMNHPDGDCPLCLYPLFRKDKNVEVLPFMKLMSCFHCFHSECIVRWWNWLQNGIE 167 (348)
Q Consensus 88 ~~~~ee~~G~~ml~elie~~kE~Lte~n~~~~~C~ICl~~f~~~~~~~~~~p~~k~~~C~H~FH~~Cl~~w~~~~q~~~~ 167 (348)
.+++++++|++|+|+||+..+++|+++|.+.++|+||||+|...+. |++ |.||||||++||+||++++.+++.
T Consensus 85 ~~iikq~~g~pii~~lie~~~e~LT~nn~p~gqCvICLygfa~~~~------ft~-T~C~Hy~H~~ClaRyl~~~~~~lr 157 (368)
T KOG4445|consen 85 QEIIKQNSGMPIICQLIEHCSEFLTENNHPNGQCVICLYGFASSPA------FTV-TACDHYMHFACLARYLTECLTGLR 157 (368)
T ss_pred HHHHHhcCCCchhHHHHHHHHHHcccCCCCCCceEEEEEeecCCCc------eee-ehhHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999987664 886 999999999999999998765442
Q ss_pred cccccccCCCcccccccccCCCCCCCCCCCCCCCcccCccchHHHHhhhcCCCCCCCCCCCCCCccccccCChhH--HHH
Q 018975 168 TDSCATVHPNTDMRNQKDMLGPIDGNMGTCPVCRKVFHVKDLEHVLNLVGSQSSHLSSNGNEVDDDDKYLHSDSE--NIR 245 (348)
Q Consensus 168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CPvCR~~~~~~d~~~~~~l~~~~~~~~~s~~~e~~~~~~~~~~~~~--~~~ 245 (348)
.+..+++++.+..+.....+|||||+.|-.+ .. .+..+.- . +.-+ .+.+...+ +..
T Consensus 158 ---------qe~q~~~~~~qh~~~~~eavcpVcre~i~~e-~~---slk~a~~---P--t~~l----~~~~~~~eslrq~ 215 (368)
T KOG4445|consen 158 ---------QEIQDAQKERQHMKEQVEAVCPVCRERIKIE-EN---SLKIAEF---P--TYPM----ELYQPSAESLRQQ 215 (368)
T ss_pred ---------HHHHHHHHHHHHhhhhHhhhhhHhhhhcccc-cc---ceeccCC---C--cccc----ccCcccHHHHHHH
Confidence 2334444444445556677899999998442 11 1111000 0 0000 12222233 444
Q ss_pred HHHHHHHHHHHHhcCCccccCccc
Q 018975 246 RQKFEAILKLQEENSGLIEPKRDL 269 (348)
Q Consensus 246 q~~~~~i~~~Q~~~ggiId~~~~~ 269 (348)
++++ .+|.+||++|||||.+++.
T Consensus 216 ~~r~-~ly~~qk~rg~iid~~ae~ 238 (368)
T KOG4445|consen 216 EERK-RLYQRQQERGGIIDLEAER 238 (368)
T ss_pred HHHH-HHHHHHhhcCceEeeeccC
Confidence 4566 9999999999999998765
|
|
| >smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain | Back alignment and domain information |
|---|
| >PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG4018 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 348 | |||
| 2day_A | 128 | Ring finger protein 25; ligase, metal-binding, UB1 | 4e-21 | |
| 1ukx_A | 137 | GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple | 2e-18 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 7e-17 | |
| 2yz0_A | 138 | Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- | 2e-16 | |
| 2ebk_A | 128 | RWD domain-containing protein 3; alpha+beta sandwi | 2e-10 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 3e-06 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 9e-06 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 3e-05 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 4e-05 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 5e-05 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 1e-04 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 2e-04 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-04 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 7e-04 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 8e-04 |
| >2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Length = 128 | Back alignment and structure |
|---|
Score = 86.9 bits (215), Expect = 4e-21
Identities = 26/117 (22%), Positives = 54/117 (46%), Gaps = 4/117 (3%)
Query: 3 EEEVAMELEAVQAVYGDECVVLDS----YPPHLHLRIKPRTADVSSQQFVEAVIGIRASP 58
+ + E+E ++++Y DE V+ P +++ + P TA+ Q+V + ++
Sbjct: 10 DWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQVPA 69
Query: 59 KYPEHPPRIDLIESKGLDDQRQKHLISCIQDKAHELTSCLMLVALCEEAVAKLSAMN 115
+YP P+I + +GL D++ ++ + A ML L E+ LS +
Sbjct: 70 EYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEILSGPS 126
|
| >1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Length = 137 | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Length = 138 | Back alignment and structure |
|---|
| >2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| 2day_A | 128 | Ring finger protein 25; ligase, metal-binding, UB1 | 99.86 | |
| 1ukx_A | 137 | GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple | 99.83 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 99.82 | |
| 2yz0_A | 138 | Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- | 99.81 | |
| 2ebk_A | 128 | RWD domain-containing protein 3; alpha+beta sandwi | 99.76 | |
| 2dax_A | 152 | Protein C21ORF6; RWD domain, alpha+beta sandwich f | 99.61 | |
| 2daw_A | 154 | RWD domain containing protein 2; alpha+beta sandwi | 99.56 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.23 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.23 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.22 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.22 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.21 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.19 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.19 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.18 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.18 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.16 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.12 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.12 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.11 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.1 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.1 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.09 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.08 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 99.08 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.07 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.05 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.03 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.02 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.01 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.01 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.0 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.0 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.98 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.98 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.98 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.97 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.97 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.96 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.96 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.95 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.93 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.92 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.9 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.88 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.85 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.83 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.82 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.82 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.82 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.81 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.79 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.78 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.77 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.77 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.76 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.76 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.74 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.7 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.66 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.65 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.64 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.58 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.58 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.53 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.5 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.46 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.45 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.43 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.39 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.34 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.34 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.23 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.14 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.07 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.04 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.0 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.88 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.69 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 94.55 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 94.52 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 94.34 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 94.19 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 94.14 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 93.86 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 93.76 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 93.73 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 93.61 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 93.51 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 93.43 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 93.37 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 93.35 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 93.08 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 93.04 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 93.01 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 92.77 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 92.72 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 92.61 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 92.47 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 92.22 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 92.18 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 92.17 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 92.02 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 91.8 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 91.35 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 91.34 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 91.14 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 90.89 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 90.68 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 90.68 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 90.56 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 89.71 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 89.04 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 88.91 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 88.91 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 88.74 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 88.7 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 88.59 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 88.53 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 88.29 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 88.21 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 87.54 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 87.15 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 87.03 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 86.87 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 86.8 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 86.37 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 84.52 | |
| 3kpa_A | 168 | Probable ubiquitin fold modifier conjugating ENZY; | 84.1 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 83.77 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 81.79 | |
| 2z6o_A | 172 | UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p | 80.96 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 80.88 |
| >2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A | Back alignment and structure |
|---|
Probab=99.86 E-value=2.5e-21 Score=161.67 Aligned_cols=113 Identities=23% Similarity=0.387 Sum_probs=102.1
Q ss_pred HHHHHHHHHHHHhhcCCCceeccC----CCCeeEEEEecCCCCCCCCcceEEEEEEEcCCCCCCCCCcccccCCCCCCHH
Q 018975 3 EEEVAMELEAVQAVYGDECVVLDS----YPPHLHLRIKPRTADVSSQQFVEAVIGIRASPKYPEHPPRIDLIESKGLDDQ 78 (348)
Q Consensus 3 ~Ee~~~ElEAL~sIY~dd~~v~~~----~~~~~~i~i~p~~~~~~~~~~v~i~L~i~lp~~YP~~~P~i~i~~~~GL~~~ 78 (348)
.|+|++|||||+|||+|+|.+... .+..|.|+|.|...++....++.+.|.|.+|++||+.+|.|.+.+.+||++.
T Consensus 10 ~e~~~~EleaL~SIY~de~~~~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~~~L~~~~p~~YP~~~P~i~~~~~~~L~~~ 89 (128)
T 2day_A 10 DWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQVPAEYPHEVPQISIRNPRGLSDE 89 (128)
T ss_dssp CCHHHHHHHHHHHHSTTTEEEECCTTSSCCEEEEEEECCSCCSSSSCCCCEEEEEEEECSSTTSSCCEEEEEEEESSCHH
T ss_pred HHHHHHHHHHHHHHCCCceEEecCCCCCCCeEEEEEEecCCCCCccccceeEEEEEEcCCCCCCCCCCeEEEcCCCCCHH
Confidence 468999999999999999988864 4678999998876554445678999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHhcCCchhhHHHHHHHHHhhhCC
Q 018975 79 RQKHLISCIQDKAHELTSCLMLVALCEEAVAKLSAMN 115 (348)
Q Consensus 79 ~i~~L~~~L~~~~ee~~G~~ml~elie~~kE~Lte~n 115 (348)
++..|.+.|...++++.|++|+|+|+++++++|.+.|
T Consensus 90 ~~~~L~~~L~~~~~e~~G~~mif~lv~~lqe~l~~~n 126 (128)
T 2day_A 90 QIHTILQVLGHVAKAGLGTAMLYELIEKGKEILSGPS 126 (128)
T ss_dssp HHHHHHHHHHHHHHHTTTSCCHHHHHHHHHHHHCCCC
T ss_pred HHHHHHHHHHHHHHHhCCCEEhHHHHHHHHHHHHhcc
Confidence 9999999999999999999999999999999998876
|
| >1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 348 | ||||
| d2daya1 | 115 | d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF | 4e-18 | |
| d1ukxa_ | 137 | d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like prote | 3e-17 | |
| d2daxa1 | 140 | d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 | 2e-05 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 1e-04 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 5e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 5e-04 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 0.002 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 0.003 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 0.003 | |
| d2dawa1 | 141 | d.20.1.3 (A:8-148) RWD domain-containing protein 2 | 0.004 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 0.004 |
| >d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: RWD domain domain: E3 ubiquitin-protein ligase RNF25 species: Human (Homo sapiens) [TaxId: 9606]
Score = 76.9 bits (189), Expect = 4e-18
Identities = 25/107 (23%), Positives = 50/107 (46%), Gaps = 4/107 (3%)
Query: 9 ELEAVQAVYGDECVVLDS----YPPHLHLRIKPRTADVSSQQFVEAVIGIRASPKYPEHP 64
E+E ++++Y DE V+ P +++ + P TA+ Q+V + ++ +YP
Sbjct: 9 EVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQVPAEYPHEV 68
Query: 65 PRIDLIESKGLDDQRQKHLISCIQDKAHELTSCLMLVALCEEAVAKL 111
P+I + +GL D++ ++ + A ML L E+ L
Sbjct: 69 PQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKEIL 115
|
| >d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Length = 137 | Back information, alignment and structure |
|---|
| >d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 348 | |||
| d2daya1 | 115 | E3 ubiquitin-protein ligase RNF25 {Human (Homo sap | 99.84 | |
| d1ukxa_ | 137 | EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu | 99.83 | |
| d2daxa1 | 140 | Uncharacterized protein C21orf6 {Human (Homo sapie | 99.61 | |
| d2dawa1 | 141 | RWD domain-containing protein 2 {Human (Homo sapie | 99.59 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.42 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.38 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.28 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.27 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.23 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.21 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.1 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.09 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.07 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.85 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.84 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.83 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.82 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.76 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.54 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.4 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 95.35 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 93.18 | |
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 93.13 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 93.06 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 92.38 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 92.22 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 92.07 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 91.85 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 91.7 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 91.47 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 91.4 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 91.08 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 90.97 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 90.43 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 90.41 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 90.32 | |
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 90.18 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 90.07 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 89.66 | |
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 89.51 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 89.42 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 89.0 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 87.37 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 86.35 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 84.57 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 83.97 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 82.95 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 80.16 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 80.04 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 80.02 |
| >d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: RWD domain domain: E3 ubiquitin-protein ligase RNF25 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84 E-value=5.1e-21 Score=155.00 Aligned_cols=107 Identities=23% Similarity=0.411 Sum_probs=98.5
Q ss_pred HHHHHHHHHHhhcCCCceeccCC----CCeeEEEEecCCCCCCCCcceEEEEEEEcCCCCCCCCCcccccCCCCCCHHHH
Q 018975 5 EVAMELEAVQAVYGDECVVLDSY----PPHLHLRIKPRTADVSSQQFVEAVIGIRASPKYPEHPPRIDLIESKGLDDQRQ 80 (348)
Q Consensus 5 e~~~ElEAL~sIY~dd~~v~~~~----~~~~~i~i~p~~~~~~~~~~v~i~L~i~lp~~YP~~~P~i~i~~~~GL~~~~i 80 (348)
-+++|||||+|||+|+|.+.... +..|.|++.|..+++....++++.|.|.+|++||..+|.+.+.+++||+..++
T Consensus 5 ~~~~EleaL~SIY~d~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~v~L~~~~p~~YP~~~P~i~~~~~~~l~~~~~ 84 (115)
T d2daya1 5 VLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVCFTLVLQVPAEYPHEVPQISIRNPRGLSDEQI 84 (115)
T ss_dssp HHHHHHHHHHHHSTTTEEEECCTTSSCCEEEEEEECCSCCSSSSCCCCEEEEEEEECSSTTSSCCEEEEEEEESSCHHHH
T ss_pred hHHHHHHHHHhHCCCceEEeccCCCCCCeEEEEEEecCCCCCCcccceEEEEEEEcCCCCCCCCCcEEeeccCCCCHHHH
Confidence 47999999999999999888653 34688999998887777889999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhcCCchhhHHHHHHHHHh
Q 018975 81 KHLISCIQDKAHELTSCLMLVALCEEAVAKL 111 (348)
Q Consensus 81 ~~L~~~L~~~~ee~~G~~ml~elie~~kE~L 111 (348)
..|.+.|...++++.|++|+|+++++++++|
T Consensus 85 ~~L~~~l~~~~~e~~G~~mif~lv~~~qE~L 115 (115)
T d2daya1 85 HTILQVLGHVAKAGLGTAMLYELIEKGKEIL 115 (115)
T ss_dssp HHHHHHHHHHHHHTTTSCCHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHcCCCEEHHHHHHHHHhhC
Confidence 9999999999999999999999999999986
|
| >d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|