Citrus Sinensis ID: 019024

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MRGSRSQTSWFPHSAERRYGAGVTAASPSFGSPSSFSESSPWELTSKRPFSLPTRNFPSRRSYVSKAVYPLVFHNPVSDCETFGDAETSSVGRLTPGEDHISPSHWLDNNSSTVQKFHRTFTELQRLETSPDPGASSRREGFRWSSASSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGPLEESSSVSEPLQMVLRSVQRSKGIMISEADGDHSNTEASDHIRNKLGRGPRWSDSGSSLKNRLKRHFSFKASKDMFSTKVFHRMGSSSSSRQPVQRQLSIG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHcccccccEEccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccHHHcccccccEEEEEEccccEcHHHHHHcccHHccccccccccccccccccHHHHccHHHHHHHHcccccccEEEEccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccEEccc
mrgsrsqtswfphsaerrygagvtaaspsfgspssfsesspweltskrpfslptrnfpsrrsyvskavyplvfhnpvsdcetfgdaetssvgrltpgedhispshwldnnsstVQKFHRTFTELQrletspdpgassrregfrwssassydfgfdgerfdiadhidleslrspvgpvagqkcgvcskllsqkspwsshrimrggdmptagvlpcrhvfhaecleqltpktqiheppcplclkivgpleesssvsepLQMVLRSVQRSKgimiseadgdhsnteasdhirnklgrgprwsdsgssLKNRLKRHFSFKASKDMFSTKVfhrmgsssssrqpvqRQLSIG
mrgsrsqtswfphsaERRYGAGVtaaspsfgspssFSESSPWEltskrpfslptrnfpsrrSYVSKAVYPLVFHNPVSDCETFGDAETSSVGRLTPGEDHISPSHWLDNNSSTVQKFHRTFTELqrletspdpgassrregfrwSSASSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKllsqkspwsshRIMRGGDMPTAGVLPCRHVFHAECLEQLtpktqiheppCPLCLKIVGPLEESSSVSEPLQMVLRSVQRSKGIMIseadgdhsnteasdhirnklgrgprwsdsgsslKNRLKRHfsfkaskdmfSTKVFhrmgsssssrqpvqrqlsig
MRGSRSQTSWFPHSAERRYGAGVTAAspsfgspssfsesspWELTSKRPFSLPTRNFPSRRSYVSKAVYPLVFHNPVSDCETFGDAETSSVGRLTPGEDHISPSHWLDNNSSTVQKFHRTFTELQRLETSPDPGASSRREGFRWSSASSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGPLeesssvsePLQMVLRSVQRSKGIMISEADGDHSNTEASDHIRNKLGRGPRWSDSGSSLKNRLKRHFSFKASKDMFSTKVFHRMGsssssRQPVQRQLSIG
*************************************************************SYVSKAVYPLVFHNPVSDCETFG***************************************************************SSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGP*****************************************************************************************************
************************************************************************************************************************************************************************************KCGVCSKLLSQK************DMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLK*********************************************************************************************************
************HSAERRYGAGVT**********************KRPFSLPTRNFPSRRSYVSKAVYPLVFHNPVSDCETFGDAETSSVGRLTPGEDHISPSHWLDNNSSTVQKFHRTFTELQRL***************RWSSASSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGPLEESSSVSEPLQMVLRSVQRSKGIMISEADGDHSNTEASDHIRNKLGRGPRWSDSGSSLKNRLKRHFSFKASKDMFSTKVF********************
*********************************************************************************T*********************************************************************************************PVAGQKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGPLEESSSVSEPLQMVLRSVQRSKGIMIS*AD***********************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGSRSQTSWFPHSAERRYGAGVTAASPSFGSPSSFSESSPWELTSKRPFSLPTRNFPSRRSYVSKAVYPLVFHNPVSDCETFGDAETSSVGRLTPGEDHISPSHWLDNNSSTVQKFHRTFTELQRLETSPDPGASSRREGFRWSSASSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGPLEESSSVSEPLQMVLRSVQRSKGIMISEADGDHSNTEASDHIRNKLGRGPRWSDSGSSLKNRLKRHFSFKASKDMFSTKVFHRMGSSSSSRQPVQRQLSIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
224144765333 predicted protein [Populus trichocarpa] 0.927 0.966 0.677 1e-127
255568978434 ubiquitin-protein ligase, putative [Rici 0.988 0.790 0.688 1e-126
225441656 497 PREDICTED: uncharacterized protein LOC10 0.982 0.686 0.643 1e-124
297739738364 unnamed protein product [Vitis vinifera] 0.982 0.936 0.643 1e-124
224125908281 predicted protein [Populus trichocarpa] 0.786 0.971 0.739 1e-116
357138113 460 PREDICTED: uncharacterized protein LOC10 0.809 0.610 0.505 6e-72
326497625 462 predicted protein [Hordeum vulgare subsp 0.832 0.625 0.49 5e-71
195614546 459 hypothetical protein [Zea mays] 0.942 0.712 0.478 2e-70
125543703429 hypothetical protein OsI_11391 [Oryza sa 0.956 0.773 0.479 2e-68
115452781445 Os03g0326300 [Oryza sativa Japonica Grou 0.956 0.746 0.479 2e-68
>gi|224144765|ref|XP_002325406.1| predicted protein [Populus trichocarpa] gi|222862281|gb|EEE99787.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  462 bits (1189), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/329 (67%), Positives = 263/329 (79%), Gaps = 7/329 (2%)

Query: 16  ERRYGAGVTAASPSFGSPSSFSESSPWELTSKRPFSLPTRNFPSRRSYVSKAVYPLVFHN 75
           +RR+    +  SP FGSPSS S++S WE TSKRP++   RN  +RR Y+SK VYPLVF N
Sbjct: 3   QRRFAVRASVTSPDFGSPSSLSDTSHWESTSKRPYAFSNRNISTRRLYMSKTVYPLVFRN 62

Query: 76  PVSDCETFGDAETSSVGRLTPGEDHISPSHWLDNNSSTVQKFHRTFTELQRLETSPDPGA 135
           PVSDCETFGDA+ SS+GRLT  ED ISPSHW DN+SS   KFH+T TELQ+LE SPDP A
Sbjct: 63  PVSDCETFGDADNSSLGRLTSREDRISPSHWPDNSSSVEYKFHKTLTELQKLEISPDPSA 122

Query: 136 SSRREGFRWSSASSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKLLSQKSPW 195
           SSRREGFRWSSASSYD G DGERFDIA+H+D+ESLRSP GPV  QKCGVC KL+ QKSPW
Sbjct: 123 SSRREGFRWSSASSYDLGIDGERFDIAEHMDMESLRSPSGPVVEQKCGVCGKLMWQKSPW 182

Query: 196 SSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGPLEESSSVSE 255
           SSHRIMRGGDMPTAGVLPC HVFHAECLE +TPKTQIH+PPCPLCLK +G +EES  VSE
Sbjct: 183 SSHRIMRGGDMPTAGVLPCSHVFHAECLEHVTPKTQIHDPPCPLCLKTIGSIEESPPVSE 242

Query: 256 PLQMVLRSVQRSKGIMISEADGDHSNTEASDHIRNKLGRG-----PRWSDSGSSLKNRLK 310
           PLQM LRSV+RS+G++ISE  G HSN EAS HI+++L R       R +D+GSS+ +RL+
Sbjct: 243 PLQMALRSVRRSRGVVISEVQGSHSNMEASHHIKDRLRRNWPQAVSRQNDNGSSITSRLR 302

Query: 311 RHFSF--KASKDMFSTKVFHRMGSSSSSR 337
           RHF F  K+ K++ +TKV  R+GSSSS +
Sbjct: 303 RHFMFKGKSGKELLNTKVLQRIGSSSSQK 331

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255568978|ref|XP_002525459.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223535272|gb|EEF36949.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225441656|ref|XP_002277026.1| PREDICTED: uncharacterized protein LOC100247068 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739738|emb|CBI29920.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125908|ref|XP_002319705.1| predicted protein [Populus trichocarpa] gi|222858081|gb|EEE95628.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357138113|ref|XP_003570642.1| PREDICTED: uncharacterized protein LOC100830430 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326497625|dbj|BAK05902.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326526167|dbj|BAJ93260.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326531296|dbj|BAK04999.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|195614546|gb|ACG29103.1| hypothetical protein [Zea mays] Back     alignment and taxonomy information
>gi|125543703|gb|EAY89842.1| hypothetical protein OsI_11391 [Oryza sativa Indica Group] gi|222624849|gb|EEE58981.1| hypothetical protein OsJ_10684 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115452781|ref|NP_001049991.1| Os03g0326300 [Oryza sativa Japonica Group] gi|108707923|gb|ABF95718.1| expressed protein [Oryza sativa Japonica Group] gi|113548462|dbj|BAF11905.1| Os03g0326300 [Oryza sativa Japonica Group] gi|215694607|dbj|BAG89798.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
TAIR|locus:2172314320 AT5G18260 [Arabidopsis thalian 0.423 0.459 0.398 2.1e-32
TAIR|locus:2035819348 AT1G14180 [Arabidopsis thalian 0.314 0.313 0.442 4.3e-19
TAIR|locus:2136368429 AT4G39140 [Arabidopsis thalian 0.613 0.496 0.288 4e-16
TAIR|locus:2050110421 AT2G21500 [Arabidopsis thalian 0.478 0.394 0.345 2.3e-13
TAIR|locus:2013114444 AT1G19680 [Arabidopsis thalian 0.515 0.403 0.305 4.7e-11
TAIR|locus:2018404455 AT1G75400 [Arabidopsis thalian 0.489 0.373 0.295 1e-08
TAIR|locus:2172314 AT5G18260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 299 (110.3 bits), Expect = 2.1e-32, Sum P(2) = 2.1e-32
 Identities = 61/153 (39%), Positives = 88/153 (57%)

Query:   146 SASSYDFGFDGERFDIADHIDLESLRSPVGPVAGQKCGVCSKLLSQKSPWSSHRIMRGGD 205
             ++SS D   D ER   ++  ++ + RS  G +  Q+CG+C KLLSQKSPWSS++I+R  D
Sbjct:   159 NSSSNDMLLDVER---SNDTEVANPRSEQGSMTHQRCGICKKLLSQKSPWSSYKILRSRD 215

Query:   206 MPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVGPLXXXXXXXXPLQMVLRSVQ 265
             MP  GV PC HV+H ECL++ TP  Q  +P CP+C   +G +         LQM LRS++
Sbjct:   216 MPATGVFPCHHVYHVECLDKATPTAQTRDPSCPVCSNTIGVMEQPLIAPETLQMALRSLR 275

Query:   266 RSKGIMISEADGDHSNTEASDHIRNKLGRGPRW 298
             RS+  +  E     SN    +  R+   R  +W
Sbjct:   276 RSRTALELETVRVPSN---DNQRRHNTRRSHKW 305
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2035819 AT1G14180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136368 AT4G39140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050110 AT2G21500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013114 AT1G19680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018404 AT1G75400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-05
smart0018440 smart00184, RING, Ring finger 3e-04
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-04
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 40.1 bits (94), Expect = 5e-05
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 4/30 (13%)

Query: 211 VLPCRHVFHAECLEQLTPKTQIHEPPCPLC 240
           VLPC HVFH ECL++           CPLC
Sbjct: 18  VLPCGHVFHKECLDKWL----RSSNTCPLC 43

Length = 46
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.29
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.22
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.13
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.07
PHA02929238 N1R/p28-like protein; Provisional 98.93
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.82
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.82
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.8
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.8
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.78
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.74
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.69
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.63
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.59
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.59
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.54
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.53
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.48
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.45
PHA02926242 zinc finger-like protein; Provisional 98.43
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.39
PF1463444 zf-RING_5: zinc-RING finger domain 98.39
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.37
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.35
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.32
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.32
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.27
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.07
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.06
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.06
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.99
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.96
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.9
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.89
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.76
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.68
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.53
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.39
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.31
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.28
KOG1941518 consensus Acetylcholine receptor-associated protei 97.23
COG52191525 Uncharacterized conserved protein, contains RING Z 97.19
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.11
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.08
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.93
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.78
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.75
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.7
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.62
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.59
KOG1940276 consensus Zn-finger protein [General function pred 96.53
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 96.41
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.24
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.23
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 96.2
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.93
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.63
PF04641260 Rtf2: Rtf2 RING-finger 95.62
COG5222427 Uncharacterized conserved protein, contains RING Z 95.45
COG5152259 Uncharacterized conserved protein, contains RING a 95.28
KOG0297 391 consensus TNF receptor-associated factor [Signal t 95.24
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.24
KOG4445368 consensus Uncharacterized conserved protein, conta 95.23
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.98
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 94.81
KOG4739233 consensus Uncharacterized protein involved in syna 94.22
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.22
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 94.22
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 94.06
KOG2660 331 consensus Locus-specific chromosome binding protei 93.91
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.86
PHA02862156 5L protein; Provisional 93.78
KOG1002 791 consensus Nucleotide excision repair protein RAD16 93.61
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.54
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 93.42
COG5236 493 Uncharacterized conserved protein, contains RING Z 93.3
PHA02825162 LAP/PHD finger-like protein; Provisional 93.27
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 92.77
PHA03096284 p28-like protein; Provisional 92.07
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.01
COG5175 480 MOT2 Transcriptional repressor [Transcription] 91.75
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 91.65
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 91.3
KOG1001674 consensus Helicase-like transcription factor HLTF/ 91.25
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 91.18
KOG3002 299 consensus Zn finger protein [General function pred 90.05
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 89.2
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 89.1
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 86.96
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 86.59
KOG1829580 consensus Uncharacterized conserved protein, conta 85.53
KOG03091081 consensus Conserved WD40 repeat-containing protein 85.34
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 85.23
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 85.2
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 85.07
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 84.72
KOG02981394 consensus DEAD box-containing helicase-like transc 82.91
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 82.39
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 80.29
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 80.02
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information 
Probab=99.29  E-value=1e-12  Score=92.72  Aligned_cols=44  Identities=30%  Similarity=0.866  Sum_probs=35.3

Q ss_pred             ccccccccchhccCCCCccccccCCCCCcceeeCCCCcccHHHHHHhhhccCCCCCCccccc
Q 019024          180 QKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCL  241 (347)
Q Consensus       180 ~~C~ICle~L~~~s~~~s~~i~~~~d~pvvavLpCGHvFH~eCLe~Wl~~~~k~dptCPlCR  241 (347)
                      +.|+||++.|...            +  .+..|+|||+||.+||.+|+...    .+||+||
T Consensus         1 d~C~IC~~~~~~~------------~--~~~~l~C~H~fh~~Ci~~~~~~~----~~CP~CR   44 (44)
T PF13639_consen    1 DECPICLEEFEDG------------E--KVVKLPCGHVFHRSCIKEWLKRN----NSCPVCR   44 (44)
T ss_dssp             -CETTTTCBHHTT------------S--CEEEETTSEEEEHHHHHHHHHHS----SB-TTTH
T ss_pred             CCCcCCChhhcCC------------C--eEEEccCCCeeCHHHHHHHHHhC----CcCCccC
Confidence            3699999999642            2  56789999999999999999753    4999997

...
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 6e-04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 8e-04
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
 Score = 42.5 bits (99), Expect = 2e-05
 Identities = 18/68 (26%), Positives = 25/68 (36%), Gaps = 2/68 (2%)

Query: 180 QKCGVCSKLLSQKSPWS-SHRIMRGGDMPTAGVLPCRHVFHAECLEQ-LTPKTQIHEPPC 237
           + C +C + L+  S +S        G M    +  C H FH  CL        +     C
Sbjct: 26  EDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQC 85

Query: 238 PLCLKIVG 245
           P C  I G
Sbjct: 86  PSCKTIYG 93
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.36
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.35
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.34
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.33
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.3
2ect_A78 Ring finger protein 126; metal binding protein, st 99.3
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.3
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.29
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.28
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.28
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.26
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.25
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.23
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.2
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.19
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.14
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.13
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.12
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.1
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.1
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.1
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.09
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.07
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.03
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.02
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.02
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.02
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.01
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.99
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.98
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.98
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.98
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.97
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.95
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.89
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.88
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.88
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.83
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.82
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.78
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.76
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.76
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.74
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.68
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.68
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.67
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.66
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.65
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.64
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.6
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.58
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.58
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.57
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.5
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.46
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.41
2ea5_A68 Cell growth regulator with ring finger domain prot 98.37
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.33
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.32
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.19
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.18
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.17
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.14
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.13
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.83
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.81
3nw0_A238 Non-structural maintenance of chromosomes element 97.18
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.27
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.89
2k16_A75 Transcription initiation factor TFIID subunit 3; p 90.4
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 88.01
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 86.41
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 85.84
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 85.79
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 85.53
1wil_A89 KIAA1045 protein; ring finger domain, structural g 85.25
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 84.86
1we9_A64 PHD finger family protein; structural genomics, PH 84.74
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 84.46
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 83.97
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 83.95
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 83.91
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 83.11
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 81.99
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 81.51
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 81.22
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 80.36
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.36  E-value=4.4e-13  Score=104.18  Aligned_cols=63  Identities=21%  Similarity=0.410  Sum_probs=41.7

Q ss_pred             CCCccccccccchhccCCCCccccccCCCCCcceeeCCCCcccHHHHHHhhhccCCCCCCcccccCCCC
Q 019024          177 VAGQKCGVCSKLLSQKSPWSSHRIMRGGDMPTAGVLPCRHVFHAECLEQLTPKTQIHEPPCPLCLKIVG  245 (347)
Q Consensus       177 ~d~~~C~ICle~L~~~s~~~s~~i~~~~d~pvvavLpCGHvFH~eCLe~Wl~~~~k~dptCPlCR~~l~  245 (347)
                      .++++|+||++.|.+.++-..... ..++. ++.+++|||+||.+||++|+..    ..+||+||..+.
T Consensus        13 ~~~~~C~IC~~~~~~~C~iC~~~~-~~~~~-~~~~~~C~H~FH~~Ci~~Wl~~----~~~CP~CR~~~~   75 (81)
T 2ecl_A           13 VECDTCAICRVQVMDACLRCQAEN-KQEDC-VVVWGECNHSFHNCCMSLWVKQ----NNRCPLCQQDWV   75 (81)
T ss_dssp             CCCSCBTTTTBCTTSCCTTHHHHT-CTTTC-CEEEETTSCEEEHHHHHHHTTT----CCBCTTTCCBCC
T ss_pred             CCCCCCcccChhhhccCccccccc-CCCce-EEEeCCCCCccChHHHHHHHHh----CCCCCCcCCCcc
Confidence            356678888888865332211111 12231 3344469999999999999963    359999999876
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-04
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 6e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.001
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.002
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Acute promyelocytic leukaemia proto-oncoprotein PML
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 36.8 bits (85), Expect = 2e-04
 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 7/30 (23%)

Query: 211 VLPCRHVFHAECLEQLTPKTQIHEPPCPLC 240
           +LPC H   + CLE    +       CP+C
Sbjct: 21  LLPCLHTLCSGCLEASGMQ-------CPIC 43
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.37
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.36
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.33
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.31
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.31
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.23
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.95
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.94
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.9
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.9
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.89
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.89
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.77
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.76
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.45
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.17
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 91.69
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 89.42
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 88.72
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 87.45
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 82.32
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 82.09
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 80.18
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Deltex protein 2 RING-H2 domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.37  E-value=3.2e-13  Score=108.67  Aligned_cols=70  Identities=26%  Similarity=0.441  Sum_probs=47.5

Q ss_pred             CCccccccccchhccCCCCccccc-cCCCCCcceeeCCCCcccHHHHHHhhhccCC-CCCCcccccCCCCCC
Q 019024          178 AGQKCGVCSKLLSQKSPWSSHRIM-RGGDMPTAGVLPCRHVFHAECLEQLTPKTQI-HEPPCPLCLKIVGPL  247 (347)
Q Consensus       178 d~~~C~ICle~L~~~s~~~s~~i~-~~~d~pvvavLpCGHvFH~eCLe~Wl~~~~k-~dptCPlCR~~l~kl  247 (347)
                      .++.|+||++.|.....+...... ...+...+.+++|||+||.+||++|+...+. ...+||+||..+...
T Consensus        24 ~~~~C~IC~e~l~~~~~~~~~~~~~~~~~~~~~~~~~CgH~FH~~Ci~~Wl~~~~~~~~~~CP~CR~~~~~~   95 (114)
T d1v87a_          24 PEEDCIICMEKLAVASGYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEK   95 (114)
T ss_dssp             CSCEETTTTEETTSCCSTTTTCCCSSSCSSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCCBSSSC
T ss_pred             ccccccchhheecccccccccccccccccccceEECCCCChhhHHHHHHHHHhcCcCCCCccccccchhccC
Confidence            356799999999765433221111 1122335677899999999999999975321 235899999988753
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure