Citrus Sinensis ID: 019135

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGDKYPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFYGSGEVPPPYSKSKSQKERTRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
ccccccEEEEEccccEEEEEEcccEEEEEEccccccccccccccccccccccccEEEccccEEEEEEccccEEEEEEccccEEEEcccccccccEEEEEEEEEEHHHHHHHccccccEEEcccccccccccccccHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccEEEEccccccccEEEcccccccccccccccccccccccccc
ccccccEEEEEccccEEEEEccccEEEEEEcccccccccccccHHcEccccccEEEEccccEEEEEEccccEEEEEEccccHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccEEccccccccccEEcccccEEEEcccccccccEEEEEcccccccccccccccccccccccc
mddkgnlyvADTLNLAIRKIGdagvttiaggksnvagfrdgpsedakfsndfdvvyvrptcsLLVIDRGNAALRQISlnqddceyqynsisptdILMVVGAVLVGYVTCMLqqgfgpfffsrtqqpsesefneETEIKelsnkekpipivesmkeepgwpsfgQLIIDLSKLALEAMGSMFlnfvpfrfrssgtkgnltplrdtlrmpedeaappvvqrqksavplsethqvrtpgtgdkypdmkppkiksasfkdsslstkhrsSKRQEYAEfygsgevpppysksksqkertrhrqrdksgelvygvsgmepkpvemkpvdydnlkfdhynmrskygddsyrf
MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNeeteikelsnkekpiPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPpvvqrqksavplsethqvrtpgtgdkypdmkppkiksasfkdsslstkhrsskRQEYAefygsgevpppysksksqkertrhrqrdksgelvygvsgmepkpvemkpvdydnlkfdhynmrskygddsyrf
MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGDKYPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFYGSGEVPPPYSKSKSQKERTRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
******LYVADTLNLAIRKIGDAGVTTIAGGKSNVAGF********KFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFS************************************GWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFR***********************************************************************************************************************************************************
MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFF*************************************GWPSFGQLIIDLSKLALEAMGSMFLNF******************DTLRMPEDEA********************************************************************************************L**GVSGMEPKPVEMKPVDYDNLKFDHYNMRSKY*******
MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRT****************LSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDE****************************KYPDMKPPKIKS*******************YAEFYGSG************************GELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
***KGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFF************************KPIPIV****EEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRS**TKGNLTPLRDTLRMPEDEAAPPV******************************************************************PYSK*******TRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFFSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSMFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGDKYPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFYGSGEVPPPYSKSKSQKERTRHRQRDKSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGDDSYRF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
255567088 484 conserved hypothetical protein [Ricinus 0.979 0.698 0.734 1e-143
225461726 484 PREDICTED: uncharacterized protein LOC10 0.976 0.696 0.722 1e-141
356549639 487 PREDICTED: uncharacterized protein LOC10 0.979 0.694 0.701 1e-139
224117004 460 predicted protein [Populus trichocarpa] 0.979 0.734 0.711 1e-132
449438911 480 PREDICTED: uncharacterized protein LOC10 0.947 0.681 0.651 1e-122
449530424437 PREDICTED: uncharacterized LOC101210502, 0.947 0.748 0.651 1e-122
357452081 493 hypothetical protein MTR_2g075860 [Medic 0.971 0.679 0.649 1e-122
224117390 495 predicted protein [Populus trichocarpa] 0.927 0.646 0.606 1e-113
42572439 493 NHL domain-containing protein [Arabidops 0.944 0.661 0.615 1e-107
297834352 489 NHL repeat-containing protein [Arabidops 0.944 0.666 0.612 1e-107
>gi|255567088|ref|XP_002524526.1| conserved hypothetical protein [Ricinus communis] gi|223536200|gb|EEF37853.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 254/346 (73%), Positives = 281/346 (81%), Gaps = 8/346 (2%)

Query: 1   MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPT 60
           MDDKGN+YVADTLNLAIRKIGDAGVTTIAGGKSN AG+RDGPSEDAKFS DFDVVYV  T
Sbjct: 146 MDDKGNVYVADTLNLAIRKIGDAGVTTIAGGKSNTAGYRDGPSEDAKFSTDFDVVYVHST 205

Query: 61  CSLLVIDRGNAALRQISLNQDDCEYQYNSISPTDILMVVGAVLVGYVTCMLQQGFGPFFF 120
           CSLLV+DRGN ALRQISLNQ+DC+YQ +SI+ TD+LMVVGAV  GYVTCMLQQGFGP FF
Sbjct: 206 CSLLVVDRGNVALRQISLNQEDCDYQSSSITVTDLLMVVGAVFTGYVTCMLQQGFGPSFF 265

Query: 121 SRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGSM 180
           S+TQ  SES      EI E  + EKP PI  SMKEEP WPSFGQL+IDLSKL LEA+  M
Sbjct: 266 SKTQHFSES------EILEHQSMEKPTPITGSMKEEPRWPSFGQLMIDLSKLTLEALADM 319

Query: 181 FLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGDK 240
           FL  +P   RS+G++  LTPL+DTLRMPEDE  PP V RQ  +VPLSET QV  P   DK
Sbjct: 320 FLYLIPSWLRSNGSRKGLTPLKDTLRMPEDEVEPPSVHRQSISVPLSETRQVHNPNASDK 379

Query: 241 YPDMKPPKIKSASFKDSSLSTKHRSSKRQEYAEFYGSGEVPPPYSKSKSQKERTRHRQRD 300
           Y +MKPPKIKSASFKD SLS+KHRSSKRQEYAEFYGSGE+P    +SKS KE+TRHRQRD
Sbjct: 380 YSEMKPPKIKSASFKDPSLSSKHRSSKRQEYAEFYGSGEMPSS-GRSKSHKEKTRHRQRD 438

Query: 301 KSGELVYGVSGMEPKPVEMKPVDYDNLKFDHYNMRSKYGD-DSYRF 345
           KSGE+    +G EPKPV MK VDYDN KFDHYNMRSKYG  +SY+F
Sbjct: 439 KSGEVAPAATGAEPKPVNMKHVDYDNPKFDHYNMRSKYGSGNSYQF 484

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225461726|ref|XP_002285515.1| PREDICTED: uncharacterized protein LOC100245328 [Vitis vinifera] gi|302142876|emb|CBI20171.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356549639|ref|XP_003543199.1| PREDICTED: uncharacterized protein LOC100797841 [Glycine max] Back     alignment and taxonomy information
>gi|224117004|ref|XP_002317450.1| predicted protein [Populus trichocarpa] gi|222860515|gb|EEE98062.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449438911|ref|XP_004137231.1| PREDICTED: uncharacterized protein LOC101210502 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449530424|ref|XP_004172195.1| PREDICTED: uncharacterized LOC101210502, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|357452081|ref|XP_003596317.1| hypothetical protein MTR_2g075860 [Medicago truncatula] gi|355485365|gb|AES66568.1| hypothetical protein MTR_2g075860 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224117390|ref|XP_002331700.1| predicted protein [Populus trichocarpa] gi|222874306|gb|EEF11437.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|42572439|ref|NP_974315.1| NHL domain-containing protein [Arabidopsis thaliana] gi|332642057|gb|AEE75578.1| NHL domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297834352|ref|XP_002885058.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330898|gb|EFH61317.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
TAIR|locus:2099357493 AT3G14860 "AT3G14860" [Arabido 0.944 0.661 0.615 1.8e-101
TAIR|locus:2016189509 AT1G70280 "AT1G70280" [Arabido 0.956 0.648 0.321 1.5e-37
TAIR|locus:2199862545 AT1G23880 "AT1G23880" [Arabido 0.820 0.519 0.355 5.7e-36
TAIR|locus:2147780 754 AT5G14890 [Arabidopsis thalian 0.660 0.302 0.330 4.6e-26
TAIR|locus:2199872400 AT1G23890 "AT1G23890" [Arabido 0.324 0.28 0.478 3.9e-20
TAIR|locus:2099357 AT3G14860 "AT3G14860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1006 (359.2 bits), Expect = 1.8e-101, P = 1.8e-101
 Identities = 219/356 (61%), Positives = 259/356 (72%)

Query:     1 MDDKGNLYVADTLNLAIRKIGDAGVTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPT 60
             MDDKGN+YVADTLNLAIRKIGD+GVTTIAGGKSN+AG+RDGPSEDAKFSNDFDVVYVRPT
Sbjct:   157 MDDKGNVYVADTLNLAIRKIGDSGVTTIAGGKSNIAGYRDGPSEDAKFSNDFDVVYVRPT 216

Query:    61 CSLLVIDRGNAALRQISLNQDDCEYQYNS-ISPTDILMVVGAVLVGYVTCMLQQGFGPFF 119
             CSLLVIDRGNAALRQISL+++DC+YQ +S IS TDIL+V+GAVL+GY TCMLQQGFG  F
Sbjct:   217 CSLLVIDRGNAALRQISLSEEDCDYQDDSSISLTDILLVIGAVLIGYATCMLQQGFGNSF 276

Query:   120 FSRTQQPSESEFNEETEIKELSNKEKPIPIVESMKEEPGWPSFGQLIIDLSKLALEAMGS 179
             FS+TQ  SE+ + EE   KE     +P+      KEEPGWPSFGQL+ DL KLALE + S
Sbjct:   277 FSKTQVGSETSYEEEHPGKE--KLSRPVHEKTITKEEPGWPSFGQLLTDLCKLALEFITS 334

Query:   180 MFLNFVPFRFRSSGTKGNLTPLRDTLRMPEDEAAPPVVQRQKSAVPLSETHQVRTPGTGD 239
                + VP RF+   T  NL PL+D L MPEDE  PP VQR  +  P+SE+     P   D
Sbjct:   335 ---HLVPARFQ---TNPNLRPLKDRLIMPEDEQEPPRVQRHTAPAPISESRHAHLPKADD 388

Query:   240 KYPDMKPPKIKSAS-FKDSSLSTK--HR-SSKRQEYAEFYGSGEVPPPYSKSKSQKERTR 295
              YP+ K PK++S+S  KD +LS+   HR SSKRQ+YA+FY SGEV  P    K  KER+R
Sbjct:   389 SYPEHKTPKLRSSSVMKDPTLSSSKHHRTSSKRQDYAQFYASGEVAQP----KIHKERSR 444

Query:   296 HRQRDKSGELVYGVSGMEPKPVE---MKPVDYDNL-KFDHYNMRS-KYGDDS-YRF 345
              R RDK+ E        EPKP     +KPV+Y N  KFDHYNMRS KYG ++ +RF
Sbjct:   445 RRHRDKTTET-------EPKPTPSDTVKPVEYSNSSKFDHYNMRSSKYGPETPFRF 493
GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0010050 "vegetative phase change" evidence=RCA
TAIR|locus:2016189 AT1G70280 "AT1G70280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199862 AT1G23880 "AT1G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147780 AT5G14890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199872 AT1G23890 "AT1G23890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027848001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (484 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
PLN029191057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 4e-06
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information 
 Score = 48.3 bits (115), Expect = 4e-06
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 5   GNLYVADTLNLAIRKIGDAG--VTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCS 62
           G +YVAD+ N  I+K+  A   VTT+AG  +  AGF+DG +  A+ S    +        
Sbjct: 815 GQIYVADSYNHKIKKLDPATKRVTTLAG--TGKAGFKDGKALKAQLSEPAGLALG-ENGR 871

Query: 63  LLVIDRGNAALRQISLNQDD 82
           L V D  N+ +R + LN+ +
Sbjct: 872 LFVADTNNSLIRYLDLNKGE 891

Length = 1057

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 345
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.2
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.16
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.59
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 98.39
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.3
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.12
KOG4659 1899 consensus Uncharacterized conserved protein (Rhs f 97.77
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 97.67
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.56
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.41
COG3391381 Uncharacterized conserved protein [Function unknow 96.9
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.58
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.39
COG3391381 Uncharacterized conserved protein [Function unknow 95.93
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.89
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 95.08
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 94.82
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.26
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 93.29
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 93.25
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.91
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 92.75
PRK11028330 6-phosphogluconolactonase; Provisional 92.58
KOG12141289 consensus Nidogen and related basement membrane pr 92.22
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 92.16
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 91.83
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 91.62
PRK11028330 6-phosphogluconolactonase; Provisional 90.91
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 90.5
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 89.37
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 89.01
KOG12141289 consensus Nidogen and related basement membrane pr 88.91
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 86.8
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 86.56
PF05787524 DUF839: Bacterial protein of unknown function (DUF 84.72
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 83.2
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 82.78
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 82.62
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 82.3
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 81.87
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information 
Probab=99.20  E-value=1.1e-10  Score=129.03  Aligned_cols=112  Identities=25%  Similarity=0.272  Sum_probs=84.9

Q ss_pred             CCC-CCCEEEEeCCCCEEEEEcCCc-eEEEecCCCCCCCCCCCCcCccccCCCcccEEECCCC-cEEEEeCCCCEEEEEe
Q 019135            1 MDD-KGNLYVADTLNLAIRKIGDAG-VTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTC-SLLVIDRGNAALRQIS   77 (345)
Q Consensus         1 VD~-~GnIYVADt~NhrIRkId~dG-VsTiAGg~~g~~G~~DG~a~~A~Fn~P~gIA~VDsdG-~LYVADtgNhrIRKis   77 (345)
                      ||. +|+|||||+.||+|+++|.+| +.+.+|+. +..|+.||....+.|+.|.+|| +|++| .|||+|++||+||+|+
T Consensus       575 vd~~~g~lyVaDs~n~rI~v~d~~G~~i~~ig~~-g~~G~~dG~~~~a~f~~P~GIa-vd~~gn~LYVaDt~n~~Ir~id  652 (1057)
T PLN02919        575 IDLLNNRLFISDSNHNRIVVTDLDGNFIVQIGST-GEEGLRDGSFEDATFNRPQGLA-YNAKKNLLYVADTENHALREID  652 (1057)
T ss_pred             EECCCCeEEEEECCCCeEEEEeCCCCEEEEEccC-CCcCCCCCchhccccCCCcEEE-EeCCCCEEEEEeCCCceEEEEe
Confidence            354 588999999999999999999 55556542 3467788888889999999999 67665 4999999999999999


Q ss_pred             CCCCe-eeeccc-----------------CCCCcceEEEeccceeEEEEeeccccc
Q 019135           78 LNQDD-CEYQYN-----------------SISPTDILMVVGAVLVGYVTCMLQQGF  115 (345)
Q Consensus        78 ~dG~~-~t~~~~-----------------~~~p~gI~~~~~a~~lgYvs~~~~~~~  115 (345)
                      +.+.. .++.+.                 ...|.+++++-- .+..||+..++++|
T Consensus       653 ~~~~~V~tlag~G~~g~~~~gg~~~~~~~ln~P~gVa~dp~-~g~LyVad~~~~~I  707 (1057)
T PLN02919        653 FVNETVRTLAGNGTKGSDYQGGKKGTSQVLNSPWDVCFEPV-NEKVYIAMAGQHQI  707 (1057)
T ss_pred             cCCCEEEEEeccCcccCCCCCChhhhHhhcCCCeEEEEecC-CCeEEEEECCCCeE
Confidence            87654 333211                 135677776642 34788888887776

>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4659 consensus Uncharacterized conserved protein (Rhs family) [Function unknown] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 2e-18
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 7e-06
3kya_A496 Putative phosphatase; structural genomics, joint c 3e-16
3kya_A496 Putative phosphatase; structural genomics, joint c 2e-06
3kya_A496 Putative phosphatase; structural genomics, joint c 3e-06
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 1e-15
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 3e-10
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 6e-05
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 1e-04
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
 Score = 84.8 bits (209), Expect = 2e-18
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 2   DDKGNLYVADTLNLAIRKIGDAG-VTTIAG-GKSNVAGFRDG-PSEDAKFSNDFDVVYVR 58
            D+ + Y  D  N  IR +   G VTT AG G +  +G+ DG   ++A+F++   +VY  
Sbjct: 349 SDEYDFYFCDRENHCIRILTPQGRVTTFAGRGSNGTSGYNDGDLRQEARFNHPEGIVYDE 408

Query: 59  PTCSLLVIDRGNAALRQISLNQ 80
                 + DR N  +R+I   +
Sbjct: 409 ERECFFIGDRENRRIRKIGYEE 430
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
3kya_A496 Putative phosphatase; structural genomics, joint c 99.59
3kya_A496 Putative phosphatase; structural genomics, joint c 99.58
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.47
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.47
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.46
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.45
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.41
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.36
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.15
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.97
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.87
3v65_B386 Low-density lipoprotein receptor-related protein; 98.85
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.84
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.78
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.76
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.75
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.74
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.73
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.72
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.7
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.7
3v65_B386 Low-density lipoprotein receptor-related protein; 98.69
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.66
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.65
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.64
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.61
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.58
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.51
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.5
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.49
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.49
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.46
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.44
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.41
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.41
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.41
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.39
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.38
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.32
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.3
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.22
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.17
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.02
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.0
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.97
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.8
2qe8_A343 Uncharacterized protein; structural genomics, join 97.8
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.79
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.78
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.76
2qe8_A343 Uncharacterized protein; structural genomics, join 97.7
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.52
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.49
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.45
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.42
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.29
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.28
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.24
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.16
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.13
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.11
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.11
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.02
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.95
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.87
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.68
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.39
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.24
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.08
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.95
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.92
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.9
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.77
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.75
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.4
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.35
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 95.33
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 95.06
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.77
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 94.52
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.39
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.26
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.24
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 93.73
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 93.33
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.27
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.74
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.6
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.25
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 92.19
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.16
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 91.74
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.43
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 91.4
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 91.28
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 91.12
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 91.1
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 90.82
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 90.76
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 90.59
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 90.42
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 90.4
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 90.11
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 89.87
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 89.12
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 88.48
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 88.0
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 87.34
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 87.1
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 87.08
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 85.8
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 85.79
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 85.69
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 84.91
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 83.92
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 81.77
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
Probab=99.59  E-value=9.4e-16  Score=155.34  Aligned_cols=84  Identities=29%  Similarity=0.395  Sum_probs=69.9

Q ss_pred             CCCCEEEEeCCCCEEEEEcCCc-eEEEecCCCC-------CCCCCCC-CcCccccCCCcccEEECCC-CcEEEEeCCCCE
Q 019135            3 DKGNLYVADTLNLAIRKIGDAG-VTTIAGGKSN-------VAGFRDG-PSEDAKFSNDFDVVYVRPT-CSLLVIDRGNAA   72 (345)
Q Consensus         3 ~~GnIYVADt~NhrIRkId~dG-VsTiAGg~~g-------~~G~~DG-~a~~A~Fn~P~gIA~VDsd-G~LYVADtgNhr   72 (345)
                      .+|+|||||+.|||||+|+++| ++|+||....       ..|+.|| ++..|+|+.|.+|| +|++ |+|||+|++|||
T Consensus       389 ~~g~lyVaD~~N~rIr~i~~~G~v~TiaG~g~~~~~~~~~~~G~~dG~~~~~a~f~~P~gIa-vd~~~g~lyVaD~~N~r  467 (496)
T 3kya_A          389 EEYDFYFVDRLNFCVRKVTPEGIVSTYAGRGASTSLADGNQWGTDDGDLREVARFRDVSGLV-YDDVKEMFYVHDQVGHT  467 (496)
T ss_dssp             CCEEEEEEEGGGTEEEEECTTCBEEEEEESCTTHHHHHSCSCCCCCEETTTTCCCSSEEEEE-EETTTTEEEEEETTTTE
T ss_pred             CCCeEEEEECCCCEEEEEeCCCCEEEEecccccccccCccccccCCCCchhhhhcCCCcEEE-EECCCCEEEEEeCCCCE
Confidence            5789999999999999999999 8999985210       1377788 78899999999999 7875 999999999999


Q ss_pred             EEEEeCCCCeeeecc
Q 019135           73 LRQISLNQDDCEYQY   87 (345)
Q Consensus        73 IRKis~dG~~~t~~~   87 (345)
                      ||+|++++.+|..+.
T Consensus       468 Irki~~~~~~~~~~~  482 (496)
T 3kya_A          468 IRTISMEQEENVAGD  482 (496)
T ss_dssp             EEEEEECCCC-----
T ss_pred             EEEEECCCCcccccC
Confidence            999999999987654
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.15
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.09
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.03
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.02
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.44
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.43
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.42
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.24
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.23
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.16
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.15
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.06
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.78
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.64
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.12
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.06
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 94.93
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 94.53
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 94.26
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 93.08
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 92.27
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 89.18
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 88.51
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 86.94
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 84.5
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 82.73
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 82.0
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 81.83
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 80.97
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 80.67
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Brain tumor cg10719-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.15  E-value=1e-10  Score=103.50  Aligned_cols=99  Identities=12%  Similarity=0.160  Sum_probs=76.2

Q ss_pred             CCCCCCEEEEeCCCCEEEEEcCCc-eEEEecCCCCCCCCCCCCcCccccCCCcccEEECCCCcEEEEeCC-CCEEEEEeC
Q 019135            1 MDDKGNLYVADTLNLAIRKIGDAG-VTTIAGGKSNVAGFRDGPSEDAKFSNDFDVVYVRPTCSLLVIDRG-NAALRQISL   78 (345)
Q Consensus         1 VD~~GnIYVADt~NhrIRkId~dG-VsTiAGg~~g~~G~~DG~a~~A~Fn~P~gIA~VDsdG~LYVADtg-NhrIRKis~   78 (345)
                      +|++|+|||+|..+++|++++.+| ....+|+             .+.|+.|.+|| +|++|+|||||.. |+||++|++
T Consensus       164 ~d~~g~i~v~d~~~~~V~~~d~~G~~~~~~g~-------------~g~~~~P~gia-vD~~G~i~Vad~~~~~~v~~f~~  229 (279)
T d1q7fa_         164 VNDKQEIFISDNRAHCVKVFNYEGQYLRQIGG-------------EGITNYPIGVG-INSNGEILIADNHNNFNLTIFTQ  229 (279)
T ss_dssp             ECSSSEEEEEEGGGTEEEEEETTCCEEEEESC-------------TTTSCSEEEEE-ECTTCCEEEEECSSSCEEEEECT
T ss_pred             eccceeEEeeeccccceeeeecCCceeeeecc-------------cccccCCcccc-cccCCeEEEEECCCCcEEEEECC
Confidence            478999999999999999999999 4444443             14688999999 8999999999975 568999999


Q ss_pred             CCCee-eeccc--CCCCcceEEEeccceeEEEEeecccccc
Q 019135           79 NQDDC-EYQYN--SISPTDILMVVGAVLVGYVTCMLQQGFG  116 (345)
Q Consensus        79 dG~~~-t~~~~--~~~p~gI~~~~~a~~lgYvs~~~~~~~g  116 (345)
                      +|++. +....  ...|.+|+++..  +..||++ .+++|-
T Consensus       230 ~G~~~~~~~~~~~~~~p~~vav~~d--G~l~V~~-~n~~v~  267 (279)
T d1q7fa_         230 DGQLISALESKVKHAQCFDVALMDD--GSVVLAS-KDYRLY  267 (279)
T ss_dssp             TSCEEEEEEESSCCSCEEEEEEETT--TEEEEEE-TTTEEE
T ss_pred             CCCEEEEEeCCCCCCCEeEEEEeCC--CcEEEEe-CCCeEE
Confidence            99964 33322  346788887643  3568887 466653
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure