Citrus Sinensis ID: 019250


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MGNCFTTATTITTTTATTAAAFTSKKSTAEIAPYDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLRVGSESVSGSRQTLLDFVESKFPEPSLNNIGDADDGDEVSPRVVRMMRMQHGSLRWHLARMVRWAEDLAKRKGKKAGDPTVGSPKMEFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQKHCKEHFEEEERDLLPLVEATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKNNLSPNFV
cccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccc
ccccccccccccccccccccccccccccEEEccccccccccccccEEEEEcccccHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccc
mgncfttattittttattaaaftskkstaeiapydcvvkvnkptpsvrlcgspnsILTAYVRFALLYksisprfipcdnpifesevptvlrvgsesvsgsrQTLLDFveskfpepslnnigdaddgdevsPRVVRMMRMQHGSLRWHLARMVRWAEDLAKrkgkkagdptvgspkmeFKKFASTYSQLLELLLEHAQMeervvfpglekddrglckaaneehardlpimngikedikatgvldcgspaYHEALRNLSVRLKSLQKHCKEHFEEEerdllplveatelSTEQQKRTLAQCVSVMQGTHSRLFNfflegltpeeaMQYLDLTTYAVIKNNLSPNFV
mgncfttattittttattaaaftskkstaeiapydcvVKVNKPtpsvrlcgspnsILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLRVGSESVSGSRQTLLDFVESKfpepslnnigdaddgdeVSPRVVRMMRMqhgslrwhlaRMVRWAEDLAKrkgkkagdptvgspkmEFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAAneehardlpimnGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQKHCKEHFEeeerdllplvEATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKnnlspnfv
MGNCfttattittttattaaaftskkstaEIAPYDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLRVGSESVSGSRQTLLDFVESKFPEPSLNNIGDADDGDEVSPRVVRMMRMQHGSLRWHLARMVRWAEDLAKRKGKKAGDPTVGSPKMEFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQKHCKEHFEEEERDLLPLVEATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKNNLSPNFV
******************************IAPYDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLRV******************************************RMMRMQHGSLRWHLARMVRWAEDL********************KKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQKHCK**********L*LV************TLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKN*******
*********************************YDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDN*I*ESEVPTVLRVGSESVSGSRQTLLDFVESKFP*****************PRVVRMMRMQHGSLRWHLARMVRWAED*******************EFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGV**C**PAYHEALRNLSVRLKSLQKHCKEHFEEEERDLLPLVEAT****EQQ*RTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKN***P***
MGNCFTTATTITTTTATTAAAFTSKKSTAEIAPYDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLR**********QTLLDFVESKFPEPSLNNIGDADDGDEVSPRVVRMMRMQHGSLRWHLARMVRWAEDL*************GSPKMEFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQKHCKEHFEEEERDLLPLVEATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKNNLSPNFV
***************************TAEIAPYDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLRVGSESVSGSRQTLLDFVESKFPEPSLNNIG****GDEVSPRVVRMMRMQHGSLRWHLARMVRWAEDLAKRK*******TVGSPKMEFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQKHCKEHFEEEERDLLPLVEATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKNNLS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNCFTTATTITTTTATTAAAFTSKKSTAEIAPYDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLRVGSESVSGSRQTLLDFVESKFPEPSLNNIGDADDGDEVSPRVVRMMRMQHGSLRWHLARMVRWAEDLAKRKGKKAGDPTVGSPKMEFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEAxxxxxxxxxxxxxxxxxxxxxEERDLLPLVEATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDLTTYAVIKNNLSPNFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
225464180327 PREDICTED: uncharacterized protein LOC10 0.886 0.932 0.601 1e-100
449494145341 PREDICTED: uncharacterized LOC101208874 0.895 0.903 0.572 3e-98
224110152309 predicted protein [Populus trichocarpa] 0.845 0.941 0.584 2e-97
18410034350 uncharacterized protein [Arabidopsis tha 0.886 0.871 0.525 7e-97
6822075363 hypothetical protein [Arabidopsis thalia 0.886 0.840 0.525 8e-97
356575508330 PREDICTED: uncharacterized protein LOC10 0.898 0.936 0.552 1e-96
224097608310 predicted protein [Populus trichocarpa] 0.843 0.935 0.578 2e-95
356536348327 PREDICTED: uncharacterized protein LOC10 0.895 0.941 0.546 2e-94
297820166353 hypothetical protein ARALYDRAFT_485826 [ 0.877 0.855 0.519 6e-94
449446289332 PREDICTED: uncharacterized protein LOC10 0.869 0.900 0.553 3e-91
>gi|225464180|ref|XP_002271335.1| PREDICTED: uncharacterized protein LOC100267160 [Vitis vinifera] gi|147779879|emb|CAN65843.1| hypothetical protein VITISV_027370 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 229/314 (72%), Gaps = 9/314 (2%)

Query: 25  KKSTAEIAPYDCVVKVNKPTPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFES 84
           KKSTAEIAP  C    + P P V L GSP   LT+Y+RFAL +K +S R +  + PI   
Sbjct: 9   KKSTAEIAP--CEFVKDSP-PVVILYGSPAVPLTSYIRFALHHKCVSVRMVSAETPILGP 65

Query: 85  EVPTVLRVGSESVSGSRQTLLDFVESKFPEPSLNNIGDADDGDEVSPRVVRMMRMQHGSL 144
           +   VL+ GS++VSGSR+TL+ ++ES+FP P L  +    D DE +P +V   R+QH S+
Sbjct: 66  DT-LVLQCGSDTVSGSRETLMRYIESRFPRPPLV-MSRGGDCDETTPLIVTATRLQHRSM 123

Query: 145 RWHLARMVRWAEDLAKRKGKKAGDPTVGSPKMEFKKFASTYSQLLELLLEHAQMEERVVF 204
            WH+ RMVRWAEDLA R G+ A DPTVGSP+ME KKF  +Y  LLEL+LEHAQMEER+VF
Sbjct: 124 TWHIERMVRWAEDLAARGGRGAVDPTVGSPRMEVKKFGRSYGHLLELMLEHAQMEERIVF 183

Query: 205 PGLEKDDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQ 264
           P LE+ DRGL KAAN++HARDLPIMNGIKEDIK+  VLD G+PAY EAL NL  RLKSLQ
Sbjct: 184 PILERADRGLSKAANDDHARDLPIMNGIKEDIKSIVVLDSGTPAYQEALSNLFTRLKSLQ 243

Query: 265 KHCKEHFEEEERDLLPLVEATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAM 324
           +HCKEHF+ EERDLLPL+EA ELS +Q +R L QC   MQGTHS LF FF+EGL P +AM
Sbjct: 244 EHCKEHFDGEERDLLPLMEAAELSKQQHERLLEQCWDAMQGTHSHLFRFFIEGLPPHDAM 303

Query: 325 QYLDLTTYAVIKNN 338
            YL L    +IK N
Sbjct: 304 SYLGL----IIKCN 313




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449494145|ref|XP_004159462.1| PREDICTED: uncharacterized LOC101208874 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224110152|ref|XP_002315430.1| predicted protein [Populus trichocarpa] gi|222864470|gb|EEF01601.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18410034|ref|NP_566997.1| uncharacterized protein [Arabidopsis thaliana] gi|20260600|gb|AAM13198.1| unknown protein [Arabidopsis thaliana] gi|31711834|gb|AAP68273.1| At3g54290 [Arabidopsis thaliana] gi|332645688|gb|AEE79209.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6822075|emb|CAB71003.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356575508|ref|XP_003555882.1| PREDICTED: uncharacterized protein LOC100807364 [Glycine max] Back     alignment and taxonomy information
>gi|224097608|ref|XP_002311008.1| predicted protein [Populus trichocarpa] gi|222850828|gb|EEE88375.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356536348|ref|XP_003536701.1| PREDICTED: uncharacterized protein LOC100779341 [Glycine max] Back     alignment and taxonomy information
>gi|297820166|ref|XP_002877966.1| hypothetical protein ARALYDRAFT_485826 [Arabidopsis lyrata subsp. lyrata] gi|297323804|gb|EFH54225.1| hypothetical protein ARALYDRAFT_485826 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449446289|ref|XP_004140904.1| PREDICTED: uncharacterized protein LOC101208874 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
TAIR|locus:2080325350 AT3G54290 "AT3G54290" [Arabido 0.808 0.794 0.588 1.7e-88
TAIR|locus:2080325 AT3G54290 "AT3G54290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 856 (306.4 bits), Expect = 1.7e-88, Sum P(2) = 1.7e-88
 Identities = 169/287 (58%), Positives = 220/287 (76%)

Query:    44 TPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCDNPIFESEVPTVLRVGSESVSGSRQT 103
             T +VRL G PNS++T+Y+RFALL+K +  RF+P      E + PT+ +VGSE+VSGSR+ 
Sbjct:    52 TATVRLYGPPNSLVTSYLRFALLHKKVPLRFVPS-----EDQKPTI-QVGSETVSGSREV 105

Query:   104 LLDFVESKFPEPSLNNIGDADDG-DEVSPRVVRMMRMQHGSLRWHLARMVRWAEDLAKRK 162
             LL ++E KFPEP L       +G DE +P +V+M+ +QH S+ WH+ RM+RW+EDLA R 
Sbjct:   106 LLRYIEDKFPEPRLMIWKFNLEGFDEATPLIVKMIWLQHRSMLWHMERMLRWSEDLAARG 165

Query:   163 GKKAGDPTVGSPKMEFKKFASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCKAANEEH 222
             GKKA DP+VG+PKME +KFA +Y+ L EL+LEHAQMEER++FP LE  DRG+CK+ANEEH
Sbjct:   166 GKKAVDPSVGTPKMEIRKFAKSYTHLQELMLEHAQMEERILFPVLESVDRGMCKSANEEH 225

Query:   223 ARDLPIMNGIKEDIKATGVLDCGSPAYHEALRNLSVRLKSLQKHCKEHFEEEERDLLPLV 282
              R+LP+MNGIKEDIK+ GVLD G  +  EAL +L+ R KSLQ  CK HFEEEE+DLLP+V
Sbjct:   226 GRELPMMNGIKEDIKSIGVLDSGICS--EALFSLASRFKSLQMMCKTHFEEEEKDLLPMV 283

Query:   283 EATELSTEQQKRTLAQCVSVMQGTHSRLFNFFLEGLTPEEAMQYLDL 329
             EA E+  E+QK+ + Q + VM GTHS  F+F LEGLTP+EAMQY+DL
Sbjct:   284 EAAEMGKEKQKKLMNQSLEVMSGTHSNSFDFLLEGLTPQEAMQYIDL 330


GO:0003674 "molecular_function" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0006661 "phosphatidylinositol biosynthetic process" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
cd12108130 cd12108, Hr-like, Hemerythrin-like domain 5e-19
pfam01814129 pfam01814, Hemerythrin, Hemerythrin HHE cation bin 7e-11
>gnl|CDD|213983 cd12108, Hr-like, Hemerythrin-like domain Back     alignment and domain information
 Score = 81.7 bits (202), Expect = 5e-19
 Identities = 34/147 (23%), Positives = 60/147 (40%), Gaps = 20/147 (13%)

Query: 136 MMRMQHGSLRWHLARMVRWAEDLAKRKGKKAGDPTVGSPKMEFKKFASTYSQLLELLLEH 195
           +++++H ++R  L R+ R A  LA      A            +  A  +  L   L  H
Sbjct: 2   LLKLEHRAIRRELGRLARLAGALAAGGPDDA------------RALAERFRFLATELHHH 49

Query: 196 AQMEERVVFPGLEK--DDRGLCKAANEEHARDLPIMNGIKEDIKATGVLDCGSPAYHEAL 253
              EE ++FP L +      +  A   EHA    ++  ++  + A            E  
Sbjct: 50  HTAEEELLFPALRERVPLAAVLDALEAEHAEIDELLARLEALLPA------LLAGDAEDA 103

Query: 254 RNLSVRLKSLQKHCKEHFEEEERDLLP 280
             L+  L++L+   +EH +EEE +L P
Sbjct: 104 EELAAALEALRTALREHLDEEEEELFP 130


Hemerythrin (Hr) like domains have the same four alpha helix bundle and a similar, but slightly different active site structure than hemerythrin. They are non-heme diiron binding proteins mainly found in bacteria and eukaryotes. Like Hr, they may be involved in oxygen transport or like human FBXL5 (F-box and leucine-rich repeat protein 5), a member of this group, play a role in cellular iron homeostasis. Length = 130

>gnl|CDD|216718 pfam01814, Hemerythrin, Hemerythrin HHE cation binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
KOG0868217 consensus Glutathione S-transferase [Posttranslati 99.93
KOG0406231 consensus Glutathione S-transferase [Posttranslati 99.9
PRK09481211 sspA stringent starvation protein A; Provisional 99.86
PRK15113214 glutathione S-transferase; Provisional 99.81
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.78
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.77
PLN02473214 glutathione S-transferase 99.77
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.76
PRK10357202 putative glutathione S-transferase; Provisional 99.74
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.69
PRK10542201 glutathionine S-transferase; Provisional 99.69
PLN02378213 glutathione S-transferase DHAR1 99.68
PLN02395215 glutathione S-transferase 99.66
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.65
PRK11752264 putative S-transferase; Provisional 99.65
PLN02817265 glutathione dehydrogenase (ascorbate) 99.64
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.64
PRK10387210 glutaredoxin 2; Provisional 99.64
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.63
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.63
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.62
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.62
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.61
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.59
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.59
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.58
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.57
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.57
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.56
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.54
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.54
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.53
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.52
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.52
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.52
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.51
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.5
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.5
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.5
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.48
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.47
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.47
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.46
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.45
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.45
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 99.38
KOG0867226 consensus Glutathione S-transferase [Posttranslati 99.37
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 99.34
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.33
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 99.3
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 99.22
PTZ00057205 glutathione s-transferase; Provisional 99.21
KOG4420325 consensus Uncharacterized conserved protein (Gangl 99.12
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 98.89
PF01814133 Hemerythrin: Hemerythrin HHE cation binding domain 98.85
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 98.82
PLN02907 722 glutamate-tRNA ligase 98.81
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 98.62
PRK1063883 glutaredoxin 3; Provisional 98.58
PRK1032981 glutaredoxin-like protein; Provisional 98.48
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 98.4
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 98.39
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.33
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 98.23
TIGR03652216 FeS_repair_RIC iron-sulfur cluster repair di-iron 98.22
PRK10992220 iron-sulfur cluster repair di-iron protein; Provis 98.21
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.19
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.17
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.16
KOG1695206 consensus Glutathione S-transferase [Posttranslati 98.14
KOG3029370 consensus Glutathione S-transferase-related protei 98.06
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.05
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.03
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 97.99
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.75
PRK1120085 grxA glutaredoxin 1; Provisional 97.74
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 97.63
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 97.5
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.47
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 97.41
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 97.19
PRK13276224 cell wall biosynthesis protein ScdA; Provisional 97.14
PHA03050108 glutaredoxin; Provisional 97.04
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 97.03
PF1056872 Tom37: Outer mitochondrial membrane transport comp 97.01
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 96.93
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 96.9
KOG4244281 consensus Failed axon connections (fax) protein/gl 96.53
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 96.04
PRK01655131 spxA transcriptional regulator Spx; Reviewed 96.01
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 95.88
PRK12759410 bifunctional gluaredoxin/ribonucleoside-diphosphat 95.81
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 95.72
COG2846221 Regulator of cell morphogenesis and NO signaling [ 95.66
PRK12559131 transcriptional regulator Spx; Provisional 95.14
PRK13344132 spxA transcriptional regulator Spx; Reviewed 95.06
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 95.02
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 94.57
COG3945189 Uncharacterized conserved protein [Function unknow 94.38
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 94.1
PRK10824115 glutaredoxin-4; Provisional 94.09
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 93.54
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 93.45
PRK10853118 putative reductase; Provisional 93.09
KOG2903319 consensus Predicted glutathione S-transferase [Pos 92.9
PTZ00062204 glutaredoxin; Provisional 92.56
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 92.19
KOG1752104 consensus Glutaredoxin and related proteins [Postt 91.47
COG1393117 ArsC Arsenate reductase and related proteins, glut 91.28
PRK10026141 arsenate reductase; Provisional 91.07
PF01814133 Hemerythrin: Hemerythrin HHE cation binding domain 88.63
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 88.56
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 88.42
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 87.56
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 87.34
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 87.06
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 86.45
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 85.8
COG5592171 Uncharacterized conserved protein [Function unknow 84.76
PRK10992220 iron-sulfur cluster repair di-iron protein; Provis 83.22
PF10799127 YliH: Biofilm formation protein (YliH/bssR); Inter 81.38
PRK13276224 cell wall biosynthesis protein ScdA; Provisional 81.16
TIGR03652216 FeS_repair_RIC iron-sulfur cluster repair di-iron 81.07
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.93  E-value=6.9e-27  Score=210.65  Aligned_cols=116  Identities=20%  Similarity=0.281  Sum_probs=103.2

Q ss_pred             cEEEeCCCCChHHHHHHHHHHhCCCCCeEeecC--C------CCC----CCCCCcEEEeCCeeeeccHHHHHHHHHhhCC
Q 019250           46 SVRLCGSPNSILTAYVRFALLYKSISPRFIPCD--N------PIF----ESEVPTVLRVGSESVSGSRQTLLDFVESKFP  113 (344)
Q Consensus        46 ~m~LY~~~~sP~s~RVRiaL~eKgI~ye~v~vd--~------p~~----P~GkVPvL~~~d~~l~eS~~aI~eYLDe~fP  113 (344)
                      ..+|||++.|.|||||||||+.|||+||++++|  +      ..|    |+++||+|++||.+|.||. ||++||||+||
T Consensus         5 KpiLYSYWrSSCswRVRiALaLK~iDYey~PvnLlk~~~q~~~ef~~iNPm~kVP~L~i~g~tl~eS~-AII~YLeEt~P   83 (217)
T KOG0868|consen    5 KPILYSYWRSSCSWRVRIALALKGIDYEYKPVNLLKEEDQSDSEFKEINPMEKVPTLVIDGLTLTESL-AIIEYLEETYP   83 (217)
T ss_pred             cchhhhhhcccchHHHHHHHHHcCCCcceeehhhhcchhhhhhHHhhcCchhhCCeEEECCEEeehHH-HHHHHHHhcCC
Confidence            569999999999999999999999999999998  1      133    9999999999999999995 99999999999


Q ss_pred             CCCCCCCCC--CCCCCCccccee-eeeccccchHHHHHHHH-----HHHHHHHHHhc
Q 019250          114 EPSLNNIGD--ADDGDEVSPRVV-RMMRMQHGSLRWHLARM-----VRWAEDLAKRK  162 (344)
Q Consensus       114 ~p~L~P~d~--a~~~~~~~~~i~-~i~~~q~rs~~~~~e~l-----~~w~~~l~~rg  162 (344)
                      +|||+|.|+  +++.++++..|+ +++++||.++..+++..     ..|++.++++|
T Consensus        84 ~ppLLP~d~~KRA~~r~i~~~i~sgIQPlQNl~vl~~l~ek~~~~~~~W~q~~ItkG  140 (217)
T KOG0868|consen   84 DPPLLPKDPHKRAKARAISLLIASGIQPLQNLSVLKMLNEKEPGYGDQWAQHFITKG  140 (217)
T ss_pred             CCCCCCcCHHHHHHHHHHHHHHHhCCCcchhhHHHHHhcccccchhhHHHHHHHHHh
Confidence            999999997  566678888887 69999999999998544     57999998776



>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>PF01814 Hemerythrin: Hemerythrin HHE cation binding domain; InterPro: IPR012312 The haemerythrin family is composed of haemerythrin proteins found in invertebrates, and a broader collection of bacterial and archaeal homologues Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>TIGR03652 FeS_repair_RIC iron-sulfur cluster repair di-iron protein Back     alignment and domain information
>PRK10992 iron-sulfur cluster repair di-iron protein; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK13276 cell wall biosynthesis protein ScdA; Provisional Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>COG2846 Regulator of cell morphogenesis and NO signaling [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>COG3945 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>PF01814 Hemerythrin: Hemerythrin HHE cation binding domain; InterPro: IPR012312 The haemerythrin family is composed of haemerythrin proteins found in invertebrates, and a broader collection of bacterial and archaeal homologues Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>COG5592 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10992 iron-sulfur cluster repair di-iron protein; Provisional Back     alignment and domain information
>PF10799 YliH: Biofilm formation protein (YliH/bssR); InterPro: IPR020359 This entry represents Biofilm regulator, BssR (from the gene also known as yliH) Back     alignment and domain information
>PRK13276 cell wall biosynthesis protein ScdA; Provisional Back     alignment and domain information
>TIGR03652 FeS_repair_RIC iron-sulfur cluster repair di-iron protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
3cax_A 369 Uncharacterized protein PF0695; structural genomic 4e-05
3u9j_A160 F-BOX/LRR-repeat protein 5; ubiquitin ligase E3, i 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 51.8 bits (123), Expect = 2e-07
 Identities = 56/323 (17%), Positives = 101/323 (31%), Gaps = 95/323 (29%)

Query: 67  YKSISPRFIP-------CDN------PIFES-EVPTVLRVGSESVSGSRQTLLDFVESKF 112
           YK I   F         C +       I    E+  ++      VSG+ + L   + SK 
Sbjct: 18  YKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDA-VSGTLR-LFWTLLSK- 74

Query: 113 PEPSLNNIGDADDGDEVSPR-VVRMMRMQHGSLRWHLARMVRWAEDLAKRKGKKAG---- 167
                         +E+  + V  ++R+ +  L      M     +  +           
Sbjct: 75  -------------QEEMVQKFVEEVLRINYKFL------MSPIKTEQRQPSMMTRMYIEQ 115

Query: 168 -DPTVGSPKMEFKKF----ASTYSQLLELLLEHAQMEERVVFPGLEKDDRGLCK---AAN 219
            D      ++ F K+       Y +L + LLE  +  + V+  G+     G  K   A  
Sbjct: 116 RDRLYNDNQV-FAKYNVSRLQPYLKLRQALLE-LRPAKNVLIDGV----LGSGKTWVAL- 168

Query: 220 EEHARDLPI---MNG------IKEDIKATGVL----------DCGSPAYHEALRNLSVRL 260
            +      +   M+       +K       VL          D    +  +   N+ +R+
Sbjct: 169 -DVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRI 227

Query: 261 KSLQKHCKEHFEEE--ERDLLPL--------VEA------TELSTEQQKRTLAQCVSVMQ 304
            S+Q   +   + +  E  LL L          A        L+T  + + +   +S   
Sbjct: 228 HSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTT--RFKQVTDFLSAAT 285

Query: 305 GTHSRLFNFFLEGLTPEEAMQYL 327
            TH  L +     LTP+E    L
Sbjct: 286 TTHISL-DHHSMTLTPDEVKSLL 307


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Length = 369 Back     alignment and structure
>3u9j_A F-BOX/LRR-repeat protein 5; ubiquitin ligase E3, iron sensor, protein binding; 1.60A {Homo sapiens} PDB: 3u9m_A 3v5x_A 3v5y_A 3v5z_A Length = 160 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.9
4glt_A225 Glutathione S-transferase-like protein; structural 99.88
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.86
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.83
3lyk_A216 Stringent starvation protein A homolog; structural 99.81
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.81
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.8
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.8
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.8
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.8
4dej_A231 Glutathione S-transferase related protein; transfe 99.79
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.79
3lxz_A229 Glutathione S-transferase family protein; structur 99.79
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.79
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.79
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.78
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.78
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.78
3lyp_A215 Stringent starvation protein A; structural genomic 99.78
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.78
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.78
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.77
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.77
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.77
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.76
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.76
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.76
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.76
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.76
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.76
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.76
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.75
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.75
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.75
3n5o_A235 Glutathione transferase; seattle structural genomi 99.75
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.75
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.74
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.74
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.74
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.74
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.74
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.73
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.73
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.73
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.73
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.73
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.73
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.73
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.73
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.72
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.72
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.72
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.72
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.72
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.72
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.72
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.72
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.71
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.71
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.71
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.71
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.71
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.71
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.71
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.7
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.7
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.7
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.7
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.69
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.69
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.69
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.69
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.69
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.69
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.68
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.68
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.68
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.68
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.67
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.67
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.67
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.67
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.67
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.66
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.66
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.66
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.65
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.65
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.65
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.65
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.63
4exj_A238 Uncharacterized protein; transferase-like protein, 99.63
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.63
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.63
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.63
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.62
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.62
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.62
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.61
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.59
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.57
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.56
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.55
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.54
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.53
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.51
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.5
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.4
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.29
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.27
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.19
2p0n_A172 Hypothetical protein NMB1532; structural genomics, 99.01
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 98.89
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 98.88
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 98.77
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.6
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.44
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.35
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.3
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.24
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.22
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 98.2
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 98.19
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.13
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 97.93
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.93
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 97.85
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.82
3cax_A 369 Uncharacterized protein PF0695; structural genomic 97.75
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 97.67
1kte_A105 Thioltransferase; redox-active center, electron tr 97.66
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 97.65
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 97.58
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.58
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 97.53
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 97.51
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 97.47
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 97.45
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 97.45
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 97.42
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.37
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 97.35
1z3e_A132 Regulatory protein SPX; bacterial transcription re 97.33
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 97.29
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 97.19
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 97.19
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 96.79
3l78_A120 Regulatory protein SPX; transcription, transcripti 96.6
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 96.48
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 96.46
3gkx_A120 Putative ARSC family related protein; ARSC family 96.14
3fz4_A120 Putative arsenate reductase; APC61768, structural 96.14
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 96.1
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 95.97
3rdw_A121 Putative arsenate reductase; structural genomics, 95.93
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 95.92
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 95.9
1ttz_A87 Conserved hypothetical protein; structural genomic 95.77
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 95.61
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 95.55
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 95.18
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 94.47
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 94.44
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 94.24
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 94.04
3u9j_A160 F-BOX/LRR-repeat protein 5; ubiquitin ligase E3, i 80.24
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
Probab=99.90  E-value=8e-25  Score=193.06  Aligned_cols=154  Identities=14%  Similarity=0.148  Sum_probs=104.0

Q ss_pred             CcEEEeCCCCChHHHHHHHHHHhCCCCCeEeecC---CC-CC----CCCCCcEEEeCCeeeeccHHHHHHHHHhhCCCCC
Q 019250           45 PSVRLCGSPNSILTAYVRFALLYKSISPRFIPCD---NP-IF----ESEVPTVLRVGSESVSGSRQTLLDFVESKFPEPS  116 (344)
Q Consensus        45 ~~m~LY~~~~sP~s~RVRiaL~eKgI~ye~v~vd---~p-~~----P~GkVPvL~~~d~~l~eS~~aI~eYLDe~fP~p~  116 (344)
                      .||+||+++.||||+|||++|++|||+||.+.+|   ++ ++    |.|+||||++||.+|+||. +|++||+++||++.
T Consensus         2 ~Mm~LY~~~~sP~~~rvr~~L~e~gi~~e~~~v~~~~~~~~~~~~nP~g~vPvL~~~~~~l~ES~-aI~~yL~~~~~~~~   80 (210)
T 4hoj_A            2 VMMTLYSGITCPFSHRCRFVLYEKGMDFEIKDIDIYNKPEDLAVMNPYNQVPVLVERDLVLHESN-IINEYIDERFPHPQ   80 (210)
T ss_dssp             --CEEEECTTCHHHHHHHHHHHHHTCCCEEEECCTTSCCHHHHHHCTTCCSCEEEETTEEEESHH-HHHHHHHHHSCSSC
T ss_pred             ceEEEecCCCChHHHHHHHHHHHcCCCCEEEEeCCCCCCHHHHHHCCCCCCcEEEECCEEEeccH-HHHHHHHHhccCCC
Confidence            3799999999999999999999999999999988   23 55    9999999999999999996 99999999999999


Q ss_pred             CCCCCCCCCCCCcccceeeeeccccchHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCchhhh-hhHHHHHHHHHHHHHHH
Q 019250          117 LNNIGDADDGDEVSPRVVRMMRMQHGSLRWHLARMVRWAEDLAKRKGKKAGDPTVGSPKMEF-KKFASTYSQLLELLLEH  195 (344)
Q Consensus       117 L~P~d~a~~~~~~~~~i~~i~~~q~rs~~~~~e~l~~w~~~l~~rg~~~~~~~~~~~~~~el-~e~~~~~~~L~~v~~~H  195 (344)
                      |+|.|+             ..+++.+.+...+..  .+...+........    .+....+. ++..+.+..|...+.. 
T Consensus        81 l~p~~~-------------~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~----~~~~~~~~~~~l~~~l~~le~~l~~-  140 (210)
T 4hoj_A           81 LMPGDP-------------VMRGRGRLVLYRMEK--ELFNHVQVLENPAA----ANKEQAKAREAIGNGLTMLSPSFSK-  140 (210)
T ss_dssp             SSCSSH-------------HHHHHHHHHHHHHHH--HTHHHHHHHHCTTS----CHHHHHHHHHHHHHHHHHHSCC----
T ss_pred             CCcccH-------------HHHHHHHHHHHHHHH--HHHHHHHHHhccch----hhhhHHHHHHhHHHHHHHHHHHhcc-
Confidence            999998             334434444444333  22222222211110    00011111 1111233333322222 


Q ss_pred             Hhhhhhhhcccccccchhhhhhhhhhhhhhhc
Q 019250          196 AQMEERVVFPGLEKDDRGLCKAANEEHARDLP  227 (344)
Q Consensus       196 s~aEE~v~yP~l~~~~~g~~~~~~~eH~~~l~  227 (344)
                              -|+|.++.++++|.++...++.+.
T Consensus       141 --------~~~l~G~~~t~ADi~~~~~l~~~~  164 (210)
T 4hoj_A          141 --------SKYILGEDFSMIDVALAPLLWRLD  164 (210)
T ss_dssp             --------CCBTTBSSCCHHHHHHHHHHHTTT
T ss_pred             --------CCccCCCcchhhHHHHHHHHHHHH
Confidence                    689999999999999888776543



>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>2p0n_A Hypothetical protein NMB1532; structural genomics, APC83866, unknown function, PSI-2, PROT structure initiative; HET: MSE; 1.41A {Neisseria meningitidis} Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3u9j_A F-BOX/LRR-repeat protein 5; ubiquitin ligase E3, iron sensor, protein binding; 1.60A {Homo sapiens} PDB: 3u9m_A 3v5x_A 3v5y_A 3v5z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.85
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.84
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.81
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.81
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.8
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.8
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.8
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.78
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.78
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.77
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.76
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.76
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.75
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.73
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.73
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.68
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.68
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.66
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.64
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.52
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.52
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.47
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.46
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.42
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.35
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.3
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.3
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.29
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 99.27
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.24
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.11
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.1
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 98.83
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 98.19
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.03
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.01
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.91
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.02
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 96.94
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 95.99
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 95.72
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 95.47
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 95.36
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 94.27
d1wjka_100 Thioredoxin-like structure containing protein C330 93.95
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 93.64
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 93.19
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 92.07
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 86.84
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 84.09
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 83.89
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 83.4
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 82.66
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Class tau GST
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.85  E-value=7.5e-22  Score=154.54  Aligned_cols=72  Identities=19%  Similarity=0.218  Sum_probs=65.7

Q ss_pred             CCcEEEeCCCCChHHHHHHHHHHhCCCCCeEeecC---CC-CC----CC-CCCcEEEeCCeeeeccHHHHHHHHHhhCCC
Q 019250           44 TPSVRLCGSPNSILTAYVRFALLYKSISPRFIPCD---NP-IF----ES-EVPTVLRVGSESVSGSRQTLLDFVESKFPE  114 (344)
Q Consensus        44 ~~~m~LY~~~~sP~s~RVRiaL~eKgI~ye~v~vd---~p-~~----P~-GkVPvL~~~d~~l~eS~~aI~eYLDe~fP~  114 (344)
                      ...|+|||++.|||++|||++|.+|||+|+.+.++   ++ ++    |. |+||||++||.+|+||. +|++|||++||+
T Consensus         3 ~~~l~Ly~~~~Sp~~~rvr~~L~~kgi~~e~~~v~~~~~~~~~~~~nP~~g~vP~L~~~g~~l~eS~-~I~~YL~e~~P~   81 (84)
T d1oyja2           3 EKELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESL-VILQYLDDAFPG   81 (84)
T ss_dssp             SCCEEEEECTTCHHHHHHHHHHHHHTCCCEEEECCTTSCCHHHHHHSTTTCCSCEEEETTEEEESHH-HHHHHHHHHCTT
T ss_pred             CCceEEEcCCCChHHHHHHHHHHHcCCCcEEEEEccCcCCHHHHhhCCCcCcccEEEECCceEEcHH-HHHHHHHHHCCC
Confidence            35799999999999999999999999999999887   23 44    85 99999999999999996 999999999999


Q ss_pred             CC
Q 019250          115 PS  116 (344)
Q Consensus       115 p~  116 (344)
                      ||
T Consensus        82 ~P   83 (84)
T d1oyja2          82 TP   83 (84)
T ss_dssp             SC
T ss_pred             CC
Confidence            86



>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure