Citrus Sinensis ID: 019419

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MKQHQELSKTNNMSHSTAATTTFRLRANSKTRESPKQEAGINGVSLSPELKARAKSVPADVKTNNISKSRRALILNKPKSAEGAVGSHKDDEVKVFGRSLNRPVVEQFARPRRQRIVDANPGKIEDGLMDKKKKEFEEKLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKIASLSSREQREAVGEYQSPKFKDVQKLIANKLEHSIVMTDAISETSINTPPSEPKIPIRNAAGVERKPQAYPSMPAPLPPPPPPRPPARAAATQKTPSFAQLYHSLTKQVEKKDLPSPVNQKRPAVSIAHSSIVGEIQNRSAHLLAVSIADIF
cccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHHccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHcccHHHHHHHHHcccc
ccccHHcccccccccccccccccEEEcccccccccccccccEEEEEcccccccccccccccccccccHccEEEEEccccccccccccccccHEEEEEEEccccEEEEEccccccccccccccHcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccEEHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHccccccccccccccccccHHHHHccHHHHHccHHHHHHHHHHHHcc
mkqhqelsktnnmshstaaTTTFRlransktrespkqeagingvslsPELKAraksvpadvktnnisKSRRALILnkpksaegavgshkddevkvfgrslnrpvveqfarprrqrivdanpgkiedglMDKKKKEFEEKLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKIASLSSREQReavgeyqspkfKDVQKLIANKLEHSIVMTDaisetsintppsepkipirnaagverkpqaypsmpaplpppppprpparaaatqktpSFAQLYHSLTKqvekkdlpspvnqkrpavsiaHSSIVGEIQNRSAHLLAVSIADIF
mkqhqelsktnnmshstaatttfrlransktrespkqeagingvslspelkaraksvpadvktnnisksrralilnkpksaegavgshkddevkvfgrslnrpvveqfarprrqrivdanpgkiedglmdKKKKEFEEKLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKiaslssreqreavgeyqspkfkdVQKLIANKLEHSIVMTDAIsetsintppsepkipIRNAAGVERKPQAYPSMPAPLPPPPPPRPPARAAATQKTPSFAQLYHSLTKqvekkdlpspvnqkrpAVSIAHSSIVGEIQNRSAHLLAVSIADIF
MKQHQELSKTNNMSHSTAATTTFRLRANSKTRESPKQEAGINGVSLSPELKARAKSVPADVKTNNISKSRRALILNKPKSAEGAVGSHKDDEVKVFGRSLNRPVVEQFARPRRQRIVDANPGKIEDGLMDkkkkefeekLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKIASLSSREQREAVGEYQSPKFKDVQKLIANKLEHSIVMTDAISETSINTPPSEPKIPIRNAAGVERKpqaypsmpaplpppppprpparaaaTQKTPSFAQLYHSLTKQVEKKDLPSPVNQKRPAVSIAHSSIVGEIQNRSAHLLAVSIADIF
************************************************************************************************************************************************NLVKDLQSEVFALKAEFVKA************************************************QKLIANKLEHSIVM**********************************************************************************************IVGEIQNRSAHLLAVSI****
**********************************************************************************************************************************************************************************************************************************************************************************************FAQLYHS************************HSSIVGEIQNRSAHLLAVSIADIF
***************STAATTTFRLR***************NGVSLSPELKARAKSVPADVKTNNISKSRRALILNKP************DEVKVFGRSLNRPVVEQFARPRRQRIVDANPGKIEDGLMDKKKKEFEEKLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKIASLS***********QSPKFKDVQKLIANKLEHSIVMTDAISETSINTPPSEPKIPIRNAAGVERKPQAYPSMPAPLP****************TPSFAQLYHSLTKQVEKKDLPSPVNQKRPAVSIAHSSIVGEIQNRSAHLLAVSIADIF
*********************************S*****GING*S************PADV**NNISKSRRALILNKPKS******SHKDDEVKVFGRSLNRPVVEQFAR********************KKKKEFEEKLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKIASLS**********YQSPKFKDVQKLIANKLEHSIVMTD********************************SMPAPLPPPPPPRPPARAAA*QKTPSFAQLYH**TK**********************SSIVGEIQNRSAHLLAVSIADIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQHQELSKTNNMSHSTAATTTFRLRANSKTRESPKQEAGINGVSLSPELKARAKSVPADVKTNNISKSRRALILNKPKSAEGAVGSHKDDEVKVFGRSLNRPVVEQFARPRRQRIVDANPGKIEDGLMDKKxxxxxxxxxxxxxxxxxxxxxVFAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEQREAVGEYQSPKFKDVQKLIANKLEHSIVMTDAISETSINTPPSEPKIPIRNAAGVERKPQAYPSMPAPLPPPPPPRPPARAAATQKTPSFAQLYHSLTKQVEKKDLPSPVNQKRPAVSIAHSSIVGEIQNRSAHLLAVSIADIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
359477354 551 PREDICTED: uncharacterized protein LOC10 0.838 0.519 0.536 1e-57
297736821 572 unnamed protein product [Vitis vinifera] 0.838 0.5 0.536 1e-57
147865784348 hypothetical protein VITISV_020816 [Viti 0.812 0.795 0.538 3e-57
356558493 576 PREDICTED: uncharacterized protein LOC10 0.947 0.560 0.447 5e-47
356532863 562 PREDICTED: uncharacterized protein LOC10 0.956 0.580 0.458 2e-43
255556608 532 conserved hypothetical protein [Ricinus 0.862 0.552 0.493 3e-43
357479207 574 Protein CHUP1 [Medicago truncatula] gi|3 0.914 0.543 0.437 1e-42
356545814 565 PREDICTED: uncharacterized protein LOC10 0.873 0.527 0.442 6e-42
356565529 567 PREDICTED: uncharacterized protein LOC10 0.829 0.499 0.393 7e-37
297847080 567 hypothetical protein ARALYDRAFT_473964 [ 0.876 0.527 0.396 2e-36
>gi|359477354|ref|XP_002275219.2| PREDICTED: uncharacterized protein LOC100256278 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 163/304 (53%), Positives = 200/304 (65%), Gaps = 18/304 (5%)

Query: 41  INGVSL-SPELKARAKSVPADVKTNNISKSRRALILNKPKSAEGAVGSHK---DDEVKVF 96
           +NGVS  SP  + RA+S P  ++ NN  K+RR+L+LNKPKS + A+GS K    +EVKV 
Sbjct: 40  LNGVSSPSPAPRPRARSGP--LEMNNSHKARRSLLLNKPKSGDHALGSQKPRDAEEVKVM 97

Query: 97  GRSLNRPVVEQFARPRRQRIVDANPGKIEDGLMDKKKKEFEEKLMLSENLVKDLQSEVFA 156
           GRS NRPVV+Q A PRR       P   E    D K KE +EKL L +NL+ +LQSEV  
Sbjct: 98  GRSRNRPVVDQLA-PRR-------PS--EGPEPDDKTKELQEKLDLRQNLINNLQSEVLG 147

Query: 157 LKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKIASLSSREQREAVGEYQSPKFKDVQKLI 216
           LKAE  KAQS N EL+  N KL EDL AA AKI +L+SR+Q E+V EYQSPKFKD+QKLI
Sbjct: 148 LKAELDKAQSFNLELQSLNAKLTEDLAAALAKITALTSRQQEESVTEYQSPKFKDIQKLI 207

Query: 217 ANKLEHSIVMTDAISETSINTPPSEPKIPIRNAAGVERKPQAYPSMPAPLPPPPPPRPPA 276
           ANKLEH  +  +A +E S    PS   +P R    ++ + +  P    P PP PPP+PPA
Sbjct: 208 ANKLEHPKIKQEASNEASTVQAPSAASVP-RVPRAMDSQRKVPPCPAPPPPPLPPPQPPA 266

Query: 277 RAAATQKTPSFAQLYHSLTKQVEKKDLPSPVNQKRPAVSIAHSSIVGEIQNRSAHLLAVS 336
           RAAAT+K P+  + YHSLTK V K+D     N  +  VS AHSSIVGEIQNRSAH LA+ 
Sbjct: 267 RAAATRKAPTLVEFYHSLTKGVGKRDFAQSGNHNKLVVSSAHSSIVGEIQNRSAHQLAIK 326

Query: 337 IADI 340
            ADI
Sbjct: 327 -ADI 329

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297736821|emb|CBI26022.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865784|emb|CAN81150.1| hypothetical protein VITISV_020816 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356558493|ref|XP_003547541.1| PREDICTED: uncharacterized protein LOC100820086 [Glycine max] Back     alignment and taxonomy information
>gi|356532863|ref|XP_003534989.1| PREDICTED: uncharacterized protein LOC100809254 [Glycine max] Back     alignment and taxonomy information
>gi|255556608|ref|XP_002519338.1| conserved hypothetical protein [Ricinus communis] gi|223541653|gb|EEF43202.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357479207|ref|XP_003609889.1| Protein CHUP1 [Medicago truncatula] gi|355510944|gb|AES92086.1| Protein CHUP1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356545814|ref|XP_003541329.1| PREDICTED: uncharacterized protein LOC100798183 [Glycine max] Back     alignment and taxonomy information
>gi|356565529|ref|XP_003550992.1| PREDICTED: uncharacterized protein LOC100820135 [Glycine max] Back     alignment and taxonomy information
>gi|297847080|ref|XP_002891421.1| hypothetical protein ARALYDRAFT_473964 [Arabidopsis lyrata subsp. lyrata] gi|297337263|gb|EFH67680.1| hypothetical protein ARALYDRAFT_473964 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
TAIR|locus:2007755 558 AT1G48280 "AT1G48280" [Arabido 0.615 0.376 0.397 3.4e-37
TAIR|locus:2102385 1004 CHUP1 "CHLOROPLAST UNUSUAL POS 0.167 0.056 0.389 0.00051
TAIR|locus:2007755 AT1G48280 "AT1G48280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 3.4e-37, Sum P(2) = 3.4e-37
 Identities = 93/234 (39%), Positives = 131/234 (55%)

Query:    16 STAATTTFRLRA-NSKTRESPKQEA-GINGVSLSPELKARAKSVPADVKTNNISKSRRAL 73
             ST +TT  R+RA NS      K  A   NG++       + KS   DVK N+ +K RR++
Sbjct:     5 STTSTTPSRVRAANSHYSVISKPRAQDDNGLT-----GGKPKSSGYDVK-NDPAK-RRSI 57

Query:    74 ILNKPKSAEGAVGSHKDDEVKVFGRSLNRP-VVEQFARPRR------QRIVDANPGKIED 126
             +L + KSAE  +            RS+NRP VVEQF  PRR      +  V A     ED
Sbjct:    58 LLKRAKSAEEEMAVLAPQRA----RSVNRPAVVEQFGCPRRPISRKSEETVMATAAA-ED 112

Query:   127 GLMDXXXXXXXXXLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAE 186
                          L+++E+L+KDLQ +V  LK E  +A++ N ELE  N+KL +DLV+AE
Sbjct:   113 EKRKRMEELEEK-LVVNESLIKDLQLQVLNLKTELEEARNSNVELELNNRKLSQDLVSAE 171

Query:   187 AKIASLSSREQREAVGEYQSPKFKDVQKLIANKLEHSIVMTDAISETSINTPPS 240
             AKI+SLSS ++     E+Q+ +FKD+Q+LIA+KLE   V  +   E+S  +PPS
Sbjct:   172 AKISSLSSNDK--PAKEHQNSRFKDIQRLIASKLEQPKVKKEVAVESSRLSPPS 223
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2102385 CHUP1 "CHLOROPLAST UNUSUAL POSITIONING 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.4
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.33
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.03
COG3883265 Uncharacterized protein conserved in bacteria [Fun 95.4
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 95.12
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.06
PRK11637 428 AmiB activator; Provisional 95.05
PRK10884206 SH3 domain-containing protein; Provisional 94.67
COG3883265 Uncharacterized protein conserved in bacteria [Fun 94.41
PRK13169110 DNA replication intiation control protein YabA; Re 94.31
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 94.21
COG4026290 Uncharacterized protein containing TOPRIM domain, 94.05
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.95
PRK1542279 septal ring assembly protein ZapB; Provisional 93.88
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 93.83
PRK10884206 SH3 domain-containing protein; Provisional 93.56
KOG4603201 consensus TBP-1 interacting protein [Signal transd 93.2
PRK11637 428 AmiB activator; Provisional 92.81
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 92.65
PRK09039343 hypothetical protein; Validated 92.44
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 92.32
KOG1923 830 consensus Rac1 GTPase effector FRL [Signal transdu 92.01
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 91.63
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 91.61
COG307479 Uncharacterized protein conserved in bacteria [Fun 91.4
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 91.14
PF13851201 GAS: Growth-arrest specific micro-tubule binding 90.31
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 90.22
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 90.2
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 89.41
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 89.26
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 89.03
PRK0440675 hypothetical protein; Provisional 88.88
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 88.8
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 88.72
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 88.68
PF04859131 DUF641: Plant protein of unknown function (DUF641) 88.53
smart0033865 BRLZ basic region leucin zipper. 88.47
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 88.12
COG2433652 Uncharacterized conserved protein [Function unknow 87.97
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 87.71
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 87.55
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 87.29
smart0033865 BRLZ basic region leucin zipper. 86.84
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 86.68
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 86.57
PRK10803263 tol-pal system protein YbgF; Provisional 86.47
PRK00888105 ftsB cell division protein FtsB; Reviewed 86.41
PF0500879 V-SNARE: Vesicle transport v-SNARE protein N-termi 86.27
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 86.06
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 85.75
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 85.58
COG4026290 Uncharacterized protein containing TOPRIM domain, 85.54
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 85.49
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 85.11
COG4942 420 Membrane-bound metallopeptidase [Cell division and 85.08
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 85.04
PHA0173294 proline-rich protein 84.97
PF14282106 FlxA: FlxA-like protein 84.63
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 84.51
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 83.99
KOG1962216 consensus B-cell receptor-associated protein and r 83.84
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 83.66
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 83.47
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 83.2
PRK09039343 hypothetical protein; Validated 83.15
KOG1962216 consensus B-cell receptor-associated protein and r 83.06
PRK13169110 DNA replication intiation control protein YabA; Re 82.75
COG4467114 Regulator of replication initiation timing [Replic 82.71
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 82.61
PHA02562562 46 endonuclease subunit; Provisional 82.52
TIGR0244965 conserved hypothetical protein TIGR02449. Members 82.51
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 82.27
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 82.24
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 82.24
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 82.18
PF00038312 Filament: Intermediate filament protein; InterPro: 82.08
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 82.06
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 81.94
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 81.93
COG5185 622 HEC1 Protein involved in chromosome segregation, i 81.87
PRK0211973 hypothetical protein; Provisional 81.76
PF1154476 Spc42p: Spindle pole body component Spc42p; InterP 81.35
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 81.33
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 81.23
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 80.7
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 80.65
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 80.31
PRK0029568 hypothetical protein; Provisional 80.3
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 80.24
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 80.17
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 80.12
PHA03211 461 serine/threonine kinase US3; Provisional 80.12
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information 
Probab=97.40  E-value=0.00062  Score=73.91  Aligned_cols=22  Identities=32%  Similarity=0.250  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhccc
Q 019419          173 KQNKKLVEDLVAAEAKIASLSS  194 (341)
Q Consensus       173 kENkELqqQLa~aEaEI~sL~~  194 (341)
                      .|.+++..++.-++++..+|.+
T Consensus       495 ael~k~e~Ki~~l~ae~~al~s  516 (1102)
T KOG1924|consen  495 AELQKHEEKIKLLEAEKQALSS  516 (1102)
T ss_pred             HHHHHhhhhcccCchhhhhccC
Confidence            3333333444444444444443

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PF04859 DUF641: Plant protein of unknown function (DUF641); InterPro: IPR006943 This conserved region is found in a number of plant proteins of unknown function Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PHA01732 proline-rich protein Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.35
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.34
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.28
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 93.79
3bas_A89 Myosin heavy chain, striated muscle/general contro 93.63
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 93.22
2q6q_A74 Spindle POLE BODY component SPC42; SPC42P, budding 92.65
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 91.88
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 90.28
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 90.17
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 90.09
2v4h_A110 NF-kappa-B essential modulator; transcription, met 89.86
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 89.59
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 89.02
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 88.9
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 88.87
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 88.84
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 88.32
3htk_A60 Structural maintenance of chromosomes protein 5; S 87.92
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 87.88
3cve_A72 Homer protein homolog 1; coiled coil, alternative 87.79
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 87.32
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 86.94
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 86.89
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 86.75
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 86.71
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 86.67
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 86.66
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 86.45
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 86.43
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 86.3
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.25
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 86.24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 86.24
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 86.08
4emc_A190 Monopolin complex subunit CSM1; RWD domain, kineto 85.88
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 85.83
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 85.81
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 85.69
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 85.04
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 85.0
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 84.85
4h22_A103 Leucine-rich repeat flightless-interacting protei; 84.68
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 84.28
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 84.08
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 84.06
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 83.06
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 82.68
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 82.68
3u06_A 412 Protein claret segregational; motor domain, stalk 82.58
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 82.21
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 81.46
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 81.41
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 81.39
1lwu_C 323 Fibrinogen gamma chain; heterotrimer, protein-pept 81.26
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 80.86
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 80.81
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 80.6
3cve_A72 Homer protein homolog 1; coiled coil, alternative 80.56
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 80.55
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 80.51
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 80.42
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 80.35
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 80.35
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 80.26
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 80.22
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
Probab=95.35  E-value=0.1  Score=44.65  Aligned_cols=61  Identities=18%  Similarity=0.166  Sum_probs=33.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Q 019419          133 KKEFEEKLMLSENLVKDLQSEVFALKAEFVKAQSLNAELEKQNKKLVEDLVAAEAKIASLS  193 (341)
Q Consensus       133 ~kel~EKLEesE~LikeLQsEL~ALkkELekLqerNeELEkENkELqqQLa~aEaEI~sL~  193 (341)
                      +-+++++++..+..+.++..++..|+.++..++..++++++++.+|+.++..++.++..|.
T Consensus        70 l~k~~~~~~~L~~~l~~~~kE~~~lK~el~~~~~k~e~~~~e~~~l~~~~~~l~~~~~~le  130 (138)
T 3hnw_A           70 YFKAKKMADSLSLDIENKDKEIYDLKHELIAAQIKAESSAKEIKELKSEINKYQKNIVKLE  130 (138)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444555555555555555555555555555555555555555555555555555555444
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Back     alignment and structure
>1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d1k4ta172 Eukaryotic DNA topoisomerase I, dispensable insert 83.49
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 82.63
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 82.56
>d1k4ta1 a.2.8.1 (A:641-712) Eukaryotic DNA topoisomerase I, dispensable insert domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Eukaryotic DNA topoisomerase I, dispensable insert domain
family: Eukaryotic DNA topoisomerase I, dispensable insert domain
domain: Eukaryotic DNA topoisomerase I, dispensable insert domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=83.49  E-value=6.5  Score=28.92  Aligned_cols=33  Identities=15%  Similarity=0.221  Sum_probs=28.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 019419          130 DKKKKEFEEKLMLSENLVKDLQSEVFALKAEFV  162 (341)
Q Consensus       130 ~~~~kel~EKLEesE~LikeLQsEL~ALkkELe  162 (341)
                      ++.+..|+++++.-...+.+.+.++..+..+..
T Consensus         1 eKsMenLq~KI~~Kk~qi~~a~~e~K~ak~d~k   33 (72)
T d1k4ta1           1 EKSMMNLQTKIDAKKEQLADARRDLKSAKADAK   33 (72)
T ss_dssp             GGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            367899999999999999999999988887655
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure