Citrus Sinensis ID: 019461
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| 224122662 | 465 | predicted protein [Populus trichocarpa] | 0.982 | 0.718 | 0.697 | 1e-134 | |
| 296084808 | 1150 | unnamed protein product [Vitis vinifera] | 0.964 | 0.285 | 0.675 | 1e-127 | |
| 225463230 | 462 | PREDICTED: E3 ubiquitin-protein ligase C | 0.964 | 0.709 | 0.675 | 1e-125 | |
| 363814404 | 466 | uncharacterized protein LOC100805618 [Gl | 0.967 | 0.706 | 0.592 | 1e-112 | |
| 449457329 | 435 | PREDICTED: E3 ubiquitin-protein ligase C | 0.891 | 0.696 | 0.653 | 1e-111 | |
| 357520273 | 471 | E3 ubiquitin-protein ligase CHFR [Medica | 0.961 | 0.694 | 0.604 | 1e-110 | |
| 5668816 | 473 | F16N3.15 [Arabidopsis thaliana] | 0.985 | 0.708 | 0.565 | 1e-107 | |
| 42562591 | 466 | RING/U-box domain-containing protein [Ar | 0.985 | 0.718 | 0.565 | 1e-107 | |
| 110737448 | 466 | hypothetical protein [Arabidopsis thalia | 0.985 | 0.718 | 0.562 | 1e-106 | |
| 297846980 | 469 | zinc finger family protein [Arabidopsis | 0.985 | 0.714 | 0.546 | 1e-105 |
| >gi|224122662|ref|XP_002330437.1| predicted protein [Populus trichocarpa] gi|222871849|gb|EEF08980.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 485 bits (1249), Expect = e-134, Method: Compositional matrix adjust.
Identities = 238/341 (69%), Positives = 278/341 (81%), Gaps = 7/341 (2%)
Query: 3 EVGECSASKPSR---EIWAKLEPSDSRFADVDISSNEVVICSEITSSSSDKHEWCKITRN 59
E GECS+ S E WAKL PSDSR++DV+I SNE+VICSEITS+S +KHEWCKITRN
Sbjct: 2 EFGECSSGSNSSSSNEAWAKLVPSDSRYSDVEIRSNEMVICSEITSTSLEKHEWCKITRN 61
Query: 60 SDLHSAKMQNKSSNAILVDDTMVQNEEVVDIKCGTEIIPGPDREVYLNFRFKVVPVQESS 119
SD SA MQNKS N ILVD+ VQNE+ V I CG+EIIPGP RE YL++RFK++P +ES
Sbjct: 62 SDQSSAMMQNKSLNTILVDEATVQNEDDVVINCGSEIIPGPAREGYLSYRFKLMP-RESF 120
Query: 120 NQQLEISIDIEHAKCCICLNIWHDVVTVAPCLHNFCNGCFSEWLRRSQEKRSTVLCPHCR 179
+ L++SID EHAKC ICLN+WHDVVTVAPCLHNFCNGCFSEWLRRSQE+ ++VLCP CR
Sbjct: 121 TRWLKVSIDAEHAKCSICLNVWHDVVTVAPCLHNFCNGCFSEWLRRSQERHASVLCPQCR 180
Query: 180 AVVQFVGRNHYLHNIEQSILQAHSSLRRSDEEVALLDSYAYIKSNLVIRNGKKHRRKRAH 239
AVVQFVGRNH+LH+IE+ +LQA SSL++SDEE+ LLDSYA IKSNL+I+ GKKHRRKR H
Sbjct: 181 AVVQFVGRNHFLHSIEEDVLQADSSLKQSDEEIILLDSYASIKSNLIIQTGKKHRRKRPH 240
Query: 240 SPIDEESDSIELPCPQCGTEINGFHCNQTTVHLQCQGCGGMMPSRND-SVPQH--CLGCD 296
S +D E++ + PCPQCGTE +GFHCNQ T+HLQCQ CGGMMPSR D VPQH CLGCD
Sbjct: 241 SILDAENEVADFPCPQCGTEYSGFHCNQNTIHLQCQACGGMMPSRADIGVPQHCMCLGCD 300
Query: 297 RAFCGAYWHAQMVARSDSQPMCSHETFKPISERTSLGFHFL 337
R FCGAYWHAQ V+RSD+ +CSHE FKPISE FL
Sbjct: 301 RVFCGAYWHAQGVSRSDTHSICSHENFKPISEHAVSRIPFL 341
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296084808|emb|CBI27690.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225463230|ref|XP_002268418.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|363814404|ref|NP_001242840.1| uncharacterized protein LOC100805618 [Glycine max] gi|255645319|gb|ACU23156.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449457329|ref|XP_004146401.1| PREDICTED: E3 ubiquitin-protein ligase CHFR-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357520273|ref|XP_003630425.1| E3 ubiquitin-protein ligase CHFR [Medicago truncatula] gi|355524447|gb|AET04901.1| E3 ubiquitin-protein ligase CHFR [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|5668816|gb|AAD46042.1|AC007519_27 F16N3.15 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42562591|ref|NP_175188.3| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|40823234|gb|AAR92268.1| At1g47570 [Arabidopsis thaliana] gi|46518399|gb|AAS99681.1| At1g47570 [Arabidopsis thaliana] gi|332194066|gb|AEE32187.1| RING/U-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|110737448|dbj|BAF00668.1| hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297846980|ref|XP_002891371.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297337213|gb|EFH67630.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| TAIR|locus:2015318 | 466 | AT1G47570 [Arabidopsis thalian | 0.985 | 0.718 | 0.565 | 3.2e-104 | |
| UNIPROTKB|Q6P256 | 626 | chfr "E3 ubiquitin-protein lig | 0.355 | 0.193 | 0.318 | 2.1e-17 | |
| UNIPROTKB|Q5FWP4 | 625 | chfr "E3 ubiquitin-protein lig | 0.355 | 0.193 | 0.318 | 6.8e-17 | |
| UNIPROTKB|F5GWT6 | 349 | CHFR "E3 ubiquitin-protein lig | 0.355 | 0.346 | 0.326 | 7.5e-17 | |
| UNIPROTKB|Q5RF77 | 571 | CHFR "E3 ubiquitin-protein lig | 0.355 | 0.211 | 0.326 | 3.1e-16 | |
| ZFIN|ZDB-GENE-030131-3522 | 637 | chfr "checkpoint with forkhead | 0.311 | 0.166 | 0.302 | 3.3e-16 | |
| UNIPROTKB|Q96EP1 | 664 | CHFR "E3 ubiquitin-protein lig | 0.355 | 0.182 | 0.326 | 1.8e-15 | |
| RGD|1306360 | 663 | Chfr "checkpoint with forkhead | 0.688 | 0.352 | 0.267 | 2.8e-15 | |
| UNIPROTKB|F1LN16 | 664 | Chfr "Protein Chfr" [Rattus no | 0.688 | 0.352 | 0.267 | 2.8e-15 | |
| UNIPROTKB|E1BBP0 | 663 | CHFR "Uncharacterized protein" | 0.320 | 0.164 | 0.368 | 2.9e-15 |
| TAIR|locus:2015318 AT1G47570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1032 (368.3 bits), Expect = 3.2e-104, P = 3.2e-104
Identities = 191/338 (56%), Positives = 239/338 (70%)
Query: 2 AEVGECSASKPSRE-IWAKLEPSDSRFADVDISSNEVVICSEITSSSSDKHEWCKITRNS 60
AE G+ S SKPS + WAKL P D+RF+D++I N++VICSEI SS +KHEWC+IT+N
Sbjct: 5 AETGQSSGSKPSDDDAWAKLVPLDTRFSDIEIRCNDMVICSEIKPSSLEKHEWCRITKNL 64
Query: 61 DLHSAKMQNKSSNAILVDDTMVQNEEVVDIKCGTEIIPGPDREVYLNFRFKVVPVQESSN 120
SA + NKSS+AILVD +V + VDI G+EI+PGP+ + YL +RF ++P ES
Sbjct: 65 GQSSATIHNKSSDAILVDKAVVPKDGAVDIISGSEIVPGPEEQGYLQYRFTIMPAPESRT 124
Query: 121 QQLEISIDIEHAKCCICLNIWHDVVTVAPCLHNFCNGCFSEWLRRSQEKRSTVLCPHCRA 180
Q L+ISID EHAKC ICLNIWHDVVT APCLHNFCNGCFSEW+RRS+EK VLCP CR
Sbjct: 125 QLLQISIDPEHAKCSICLNIWHDVVTAAPCLHNFCNGCFSEWMRRSEEKHKHVLCPQCRT 184
Query: 181 VVQFVGRNHYLHNIEQSILQAHSSLRRSDEEVALLDSYAYIKSNLVIRNGKKHRRKRAHS 240
VQ+VG+NH+L NI++ IL+ ++LRR E++A+LDS A I+SNL+I K+ RR +
Sbjct: 185 TVQYVGKNHFLKNIQEEILKVDAALRRPAEDIAVLDSSASIQSNLII-GSKRKRRLNMPA 243
Query: 241 PIDEESDSIELPCPQCGTEINGFHCNQTTVHLQCQGCGGMMPSR-NDSVPQHCLGCDRAF 299
P EE DS+ L CPQC I G+ C HLQC C GMMP R N VP HC GCDR F
Sbjct: 244 PTHEERDSLRLQCPQCVANIGGYRCEHHGAHLQCHLCQGMMPFRANLQVPLHCKGCDRPF 303
Query: 300 CGAYWHAQMVARSDSQPMCSHETFKPISERTSLGFHFL 337
CGAYW ++ V + S P+C ETF+PISERT F+
Sbjct: 304 CGAYWSSENVTQGVSGPVCVRETFRPISERTITRIPFI 341
|
|
| UNIPROTKB|Q6P256 chfr "E3 ubiquitin-protein ligase CHFR" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5FWP4 chfr "E3 ubiquitin-protein ligase CHFR" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GWT6 CHFR "E3 ubiquitin-protein ligase CHFR" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RF77 CHFR "E3 ubiquitin-protein ligase CHFR" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3522 chfr "checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96EP1 CHFR "E3 ubiquitin-protein ligase CHFR" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1306360 Chfr "checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LN16 Chfr "Protein Chfr" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BBP0 CHFR "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 1e-07 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-05 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 1e-05 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 4e-05 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 9e-05 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 0.003 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Score = 47.4 bits (113), Expect = 1e-07
Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
Query: 133 KCCICLNIWHDVVTVAPCLHNFCNGCFSEWLRRSQEKRSTVLCPHCRAVV 182
+C ICL + + V + PC H FC C +WL+ + CP CR +
Sbjct: 1 ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNT-----CPLCRTPI 45
|
Length = 45 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| PF00498 | 68 | FHA: FHA domain; InterPro: IPR000253 The forkhead- | 99.45 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.33 | |
| cd00060 | 102 | FHA Forkhead associated domain (FHA); found in euk | 99.15 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.11 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.08 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.07 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 99.06 | |
| TIGR03354 | 396 | VI_FHA type VI secretion system FHA domain protein | 99.06 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.98 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.96 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.91 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.9 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 98.89 | |
| COG1716 | 191 | FOG: FHA domain [Signal transduction mechanisms] | 98.87 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.86 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.86 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.84 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.82 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.73 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.71 | |
| COG3456 | 430 | Predicted component of the type VI protein secreti | 98.71 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.68 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.67 | |
| smart00240 | 52 | FHA Forkhead associated domain. Found in eukaryoti | 98.64 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 98.61 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.6 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.58 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.58 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.45 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.44 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.43 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 98.38 | |
| KOG1882 | 293 | consensus Transcriptional regulator SNIP1, contain | 98.38 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.31 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.13 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.99 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.98 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.98 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.81 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.74 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.72 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.7 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.63 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.53 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.49 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.47 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.47 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.35 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.22 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.22 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.18 | |
| KOG1881 | 793 | consensus Anion exchanger adaptor protein Kanadapt | 97.17 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.16 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.15 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.0 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.75 | |
| KOG0245 | 1221 | consensus Kinesin-like protein [Cytoskeleton] | 96.73 | |
| KOG2293 | 547 | consensus Daxx-interacting protein MSP58/p78, cont | 96.61 | |
| KOG1880 | 337 | consensus Nuclear inhibitor of phosphatase-1 [Gene | 96.58 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.52 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.49 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.41 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.21 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.93 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.88 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.59 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.48 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.43 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.35 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.25 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.07 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 94.55 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 94.26 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 94.1 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 93.97 | |
| KOG1892 | 1629 | consensus Actin filament-binding protein Afadin [C | 93.67 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.39 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 93.24 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 93.01 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.73 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 92.52 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 92.51 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.48 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 92.25 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 92.13 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 92.06 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 91.78 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.6 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 91.27 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 91.05 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 90.62 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 89.82 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 89.54 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 89.29 | |
| TIGR02500 | 410 | type_III_yscD type III secretion apparatus protein | 89.12 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.97 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 88.68 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 87.14 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 86.64 | |
| PHA03096 | 284 | p28-like protein; Provisional | 85.53 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 83.55 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.58 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 82.34 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 82.29 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.49 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 81.23 | |
| KOG3842 | 429 | consensus Adaptor protein Pellino [Signal transduc | 81.02 | |
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 80.06 |
| >PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins | Back alignment and domain information |
|---|
Probab=99.45 E-value=2.1e-13 Score=100.39 Aligned_cols=62 Identities=24% Similarity=0.266 Sum_probs=54.6
Q ss_pred eEEec----ccccCC-ccccceEEEEEeCCCCeEEEEec-cCCceEeccEecCCCceeeccCCCeeccC
Q 019461 37 VVICS----EITSSS-SDKHEWCKITRNSDLHSAKMQNK-SSNAILVDDTMVQNEEVVDIKCGTEIIPG 99 (340)
Q Consensus 37 ~~iGr----~~~~~~-~vS~~H~~i~~~~~~~~~~i~D~-StNgt~vng~~i~~~~~~~l~~gd~I~lg 99 (340)
++||| ++.+.+ .||+.||.|.++.+ ..|+|+|+ |+|||||||+++..+..+.|.+||+|.+|
T Consensus 1 ~~iGR~~~~di~l~~~~iSr~Ha~i~~~~~-~~~~i~d~~s~ngt~vng~~l~~~~~~~L~~gd~i~~G 68 (68)
T PF00498_consen 1 VTIGRSPDCDIVLPDPSISRRHARISFDDD-GQFYIEDLGSTNGTFVNGQRLGPGEPVPLKDGDIIRFG 68 (68)
T ss_dssp EEEESSTTSSEEETSTTSSTTSEEEEEETT-EEEEEEESSSSS-EEETTEEESSTSEEEE-TTEEEEET
T ss_pred CEEcCCCCCCEEECCHheeeeeeEEEEece-eeEEEEeCCCCCcEEECCEEcCCCCEEECCCCCEEEcC
Confidence 57999 588888 99999999999977 25999998 89999999999999999999999999876
|
It displays specificity for phosphothreonine-containing epitopes but will also recognise phosphotyrosine with relatively high affinity. It spans approximately 80-100 amino acid residues folded into an 11-stranded beta sandwich, which sometimes contain small helical insertions between the loops connecting the strands []. To date, genes encoding FHA-containing proteins have been identified in eubacterial and eukaryotic but not archaeal genomes. The domain is present in a diverse range of proteins, such as kinases, phosphatases, kinesins, transcription factors, RNA-binding proteins and metabolic enzymes which partake in many different cellular processes - DNA repair, signal transduction, vesicular transport and protein degradation are just a few examples.; GO: 0005515 protein binding; PDB: 1LGQ_B 1LGP_A 2CSW_A 2PIE_A 3FM8_A 3MDB_B 3GQS_B 1UHT_A 1WLN_A 3POA_A .... |
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03354 VI_FHA type VI secretion system FHA domain protein | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >COG1716 FOG: FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00240 FHA Forkhead associated domain | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0245 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2293 consensus Daxx-interacting protein MSP58/p78, contains FHA domain [Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1880 consensus Nuclear inhibitor of phosphatase-1 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| 2xoc_A | 261 | E3 ubiquitin-protein ligase CHFR; zinc-binding, po | 2e-14 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 2e-11 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 2e-11 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-11 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 2e-10 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-10 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 3e-10 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 5e-10 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 7e-10 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 1e-09 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 8e-09 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 1e-08 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 2e-08 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 2e-08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 2e-08 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 3e-08 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 3e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 5e-08 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 7e-08 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 9e-08 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 1e-07 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 2e-07 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 5e-07 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 1e-06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 1e-06 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 3e-06 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 4e-06 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 4e-06 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 4e-06 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 5e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 1e-05 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 4e-05 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 4e-05 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 4e-05 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 6e-05 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 7e-05 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 9e-05 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 1e-04 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 1e-04 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 3e-04 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 5e-04 |
| >2xoc_A E3 ubiquitin-protein ligase CHFR; zinc-binding, poly(ADP-ribose) mitosis, antephase checkpoint, cell cycle; HET: PGE ADP ADE; 1.89A {Homo sapiens} PDB: 2xoy_A* 2xoz_A* 2xp0_A Length = 261 | Back alignment and structure |
|---|
Score = 71.3 bits (174), Expect = 2e-14
Identities = 29/144 (20%), Positives = 45/144 (31%), Gaps = 22/144 (15%)
Query: 211 EVALLDSYAY-IKSNLVIRNGKKHRRKRAHSPIDEESDSIELPCPQ-----------CGT 258
E++ +DS + I V+ R++A P + E PQ T
Sbjct: 7 ELSDVDSESSDISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTT 66
Query: 259 EINGFHCNQTTVHLQCQGCGGMMPSR-------NDSVPQHCLGCDRAFCGAYWHAQMVAR 311
+ + C H C C MP R PQ C C + FC YW R
Sbjct: 67 AVQDYVCPLQGSHALCTCCFQPMPDRRVEREQDPRVAPQQCAVCLQPFCHLYWGCT---R 123
Query: 312 SDSQPMCSHETFKPISERTSLGFH 335
+ + + ++ G
Sbjct: 124 TGCYGCLAPFCELNLGDKCLDGVL 147
|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| 1gxc_A | 149 | CHK2, CDS1, serine/threonine-protein kinase CHK2; | 99.8 | |
| 1lgp_A | 116 | Cell cycle checkpoint protein CHFR; FHA, tungstate | 99.75 | |
| 1g6g_A | 127 | Protein kinase RAD53; beta-sandwich, phosphopeptid | 99.7 | |
| 2jqj_A | 151 | DNA damage response protein kinase DUN1; protein/p | 99.69 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 99.62 | |
| 1uht_A | 118 | Expressed protein; FHA domain, beta-sandwich, anti | 99.61 | |
| 4h87_A | 130 | Kanadaptin; FHA domain of PF00498, mRNA processing | 99.61 | |
| 1dmz_A | 158 | Protein (protein kinase SPK1); beta-sandwich, anti | 99.59 | |
| 2pie_A | 138 | E3 ubiquitin-protein ligase RNF8; FHA domain, comp | 99.58 | |
| 1qu5_A | 182 | Protein kinase SPK1; FHA, RAD53, transferase; NMR | 99.58 | |
| 1g3g_A | 164 | Protien kinase SPK1; FHA domain, RAD53, phosphopep | 99.58 | |
| 3hx1_A | 131 | SLR1951 protein; P74513_SYNY3, adenylate cyclase-l | 99.58 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.55 | |
| 2jpe_A | 140 | Nuclear inhibitor of protein phosphatase 1; FHA do | 99.53 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 99.53 | |
| 1mzk_A | 139 | Kinase associated protein phosphatase; beta sandwi | 99.53 | |
| 2csw_A | 145 | Ubiquitin ligase protein RNF8; 11-stranded beta sa | 99.53 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.52 | |
| 2xt9_B | 115 | Putative signal transduction protein GARA; lyase-s | 99.51 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 99.49 | |
| 2kb3_A | 143 | Oxoglutarate dehydrogenase inhibitor; forkhead-ass | 99.48 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 99.48 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.48 | |
| 1r21_A | 128 | Antigen KI-67; beta sandwich, cell cycle; NMR {Hom | 99.47 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.46 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.45 | |
| 2kfu_A | 162 | RV1827 PThr 22; FHA domain, phosphorylation, intra | 99.45 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.45 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.44 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.44 | |
| 3gqs_A | 106 | Adenylate cyclase-like protein; FHA domain, struct | 99.44 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.44 | |
| 2brf_A | 110 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.43 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.43 | |
| 1yj5_C | 143 | 5' polynucleotide kinase-3' phosphatase FHA domai; | 99.43 | |
| 3els_A | 158 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.4 | |
| 3kt9_A | 102 | Aprataxin; FHA domain, beta sandwich, beta sheet, | 99.39 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.39 | |
| 1ujx_A | 119 | Polynucleotide kinase 3'-phosphatase; DNA repair, | 99.39 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.38 | |
| 3elv_A | 205 | PRE-mRNA leakage protein 1; intrinsically unstruct | 99.37 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 99.37 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.36 | |
| 2xoc_A | 261 | E3 ubiquitin-protein ligase CHFR; zinc-binding, po | 99.36 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.35 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.33 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 99.33 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.32 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 99.31 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.3 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.3 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.29 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.29 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.28 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.28 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.27 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.26 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.24 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.23 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.22 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.22 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.22 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.2 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.16 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.15 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.15 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.13 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.11 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.11 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.09 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.08 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.08 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.07 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.07 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.03 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.03 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.03 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.01 | |
| 3huf_A | 325 | DNA repair and telomere maintenance protein NBS1; | 99.01 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.0 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.99 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.97 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.97 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.93 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.93 | |
| 3uv0_A | 102 | Mutator 2, isoform B; FHA, protein binding, dimeri | 98.92 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.92 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.89 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.82 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.82 | |
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 98.8 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.75 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.74 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.71 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.7 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.65 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.62 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.59 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.55 | |
| 4a0e_A | 123 | YSCD, type III secretion protein; transport protei | 98.46 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.44 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.43 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.4 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.35 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.3 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.76 | |
| 1wv3_A | 238 | Similar to DNA segregation ATPase and related prot | 97.71 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.68 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.46 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 97.42 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.89 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 96.45 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 92.91 | |
| 1fre_A | 42 | Nuclear factor XNF7; zinc-binding protein, BBOX, d | 87.91 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 86.32 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 85.37 | |
| 2d8u_A | 64 | Ubiquitin ligase TRIM63; tripartite motif-containi | 85.11 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 83.43 | |
| 3ddt_A | 48 | E3 ubiquitin-protein ligase TRIM63; zinc-binding m | 80.1 |
| >1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
Probab=99.80 E-value=1.2e-19 Score=153.44 Aligned_cols=104 Identities=18% Similarity=0.226 Sum_probs=85.8
Q ss_pred CCCccccEEEEeCCCCCceeEeeCCceEEec----ccccCC-c---------cccceEEEEEeCCC---CeEEEEeccCC
Q 019461 11 KPSREIWAKLEPSDSRFADVDISSNEVVICS----EITSSS-S---------DKHEWCKITRNSDL---HSAKMQNKSSN 73 (340)
Q Consensus 11 ~~~~~~~~~L~~~~~~~~~~~l~~~~~~iGr----~~~~~~-~---------vS~~H~~i~~~~~~---~~~~i~D~StN 73 (340)
++.+..||+|+++.+..+.+.|.++.++||| ++.+++ . |||.||+|.++.+. ..|+|+|+|+|
T Consensus 24 ~~~~~~w~~L~~~~~~~~~i~L~~~~~~IGR~~~~di~l~d~~~~~~~~~~~VSr~Ha~I~~~~~~~~~~~~~i~D~StN 103 (149)
T 1gxc_A 24 EPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGN 103 (149)
T ss_dssp -----CCEEEEECSTTCCCEEECSSEEEEESSTTCSEECCCGGGGGSSGGGGSCTTCEEEEEEECTTSSEEEEEEECCSS
T ss_pred CCCCCeeEEEEEcCCCCceEEECCCCEEecCCCCCCEEECCccccccccCCcCchhheEEEEECCCCceeEEEEEECCCC
Confidence 4455689999999988899999999999999 677776 3 99999999998652 25999999999
Q ss_pred ceEeccEecCCCceeeccCCCeeccCCCCcceecccccccccc
Q 019461 74 AILVDDTMVQNEEVVDIKCGTEIIPGPDREVYLNFRFKVVPVQ 116 (340)
Q Consensus 74 gt~vng~~i~~~~~~~l~~gd~I~lg~~~~~~~~y~f~i~s~~ 116 (340)
||||||++|.+++.+.|.+||+|.+|.. ....|.|..+...
T Consensus 104 GT~VNg~~i~~~~~~~L~~GD~I~lG~~--~~~~f~f~d~~~~ 144 (149)
T 1gxc_A 104 GTFVNTELVGKGKRRPLNNNSEIALSLS--RNKVFVFFDLTVD 144 (149)
T ss_dssp CEEETTEECCTTCEEECCTTEEEEESST--TCEEEEEEETTCC
T ss_pred CeEECCEECCCCCeEECCCCCEEEECCC--CCeEEEEEECCcc
Confidence 9999999999999999999999999984 3566777655543
|
| >1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A | Back alignment and structure |
|---|
| >1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B | Back alignment and structure |
|---|
| >1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* | Back alignment and structure |
|---|
| >2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* | Back alignment and structure |
|---|
| >3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A | Back alignment and structure |
|---|
| >2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2xoc_A E3 ubiquitin-protein ligase CHFR; zinc-binding, poly(ADP-ribose) mitosis, antephase checkpoint, cell cycle; HET: PGE ADP ADE; 1.89A {Homo sapiens} PDB: 2xoy_A* 2xoz_A* 2xp0_A | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >3ddt_A E3 ubiquitin-protein ligase TRIM63; zinc-binding motif, ring-like fold, coiled coil, cytoplasm, metal-binding, muscle protein, nucleus; 1.90A {Homo sapiens} SCOP: g.43.1.1 PDB: 3q1d_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 340 | ||||
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 3e-08 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 7e-08 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-07 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 7e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 3e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 4e-05 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 5e-05 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 6e-05 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 6e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.002 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 0.002 |
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Immediate early protein, IEEHV species: Equine herpesvirus 1 [TaxId: 10326]
Score = 48.0 bits (114), Expect = 3e-08
Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 6/53 (11%)
Query: 133 KCCICLNIWHDVVTVAPCLHNFCNGCFSEWLRRSQEKRSTVLCPHCRAVVQFV 185
+C ICL + PCLH FC C + W+R++ CP C+ V+ V
Sbjct: 7 RCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPT------CPLCKVPVESV 53
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| d1gxca_ | 116 | Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1lgpa_ | 113 | Cell cycle checkpoint protein Chfr {Human (Homo sa | 99.77 | |
| d2brfa1 | 101 | Polynucleotide kinase 3'-phosphatase {Human (Homo | 99.6 | |
| d1dmza_ | 158 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.6 | |
| d2ff4a3 | 99 | Probable regulatory protein EmbR, C-terminal domai | 99.58 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.58 | |
| d2piea1 | 127 | Ubiquitin ligase protein RNF8 {Human (Homo sapiens | 99.55 | |
| d1uhta_ | 118 | FHA domain containing protein At4G14490 {Thale cre | 99.55 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.54 | |
| d1g6ga_ | 127 | Phosphotyrosine binding domain of Rad53 {Baker's y | 99.53 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.49 | |
| d1mzka_ | 122 | Kinase associated protein phosphatase {Thale cress | 99.49 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.42 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.39 | |
| d2affa1 | 98 | Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.32 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 99.31 | |
| d1wlna1 | 107 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 99.29 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.18 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.17 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.13 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.07 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.04 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.95 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.73 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.61 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.56 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.03 | |
| d1frea_ | 39 | Nuclear factor XNF7 {African clawed frog (Xenopus | 94.15 | |
| d2dq5a1 | 47 | Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | 90.8 | |
| d2dida1 | 40 | Tripartite motif-containing protein 39 {Human (Hom | 89.32 | |
| d2d8ua1 | 51 | Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax | 88.95 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 87.37 | |
| d2djaa1 | 71 | Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | 84.35 |
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SMAD/FHA domain superfamily: SMAD/FHA domain family: FHA domain domain: Chk2 kinase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81 E-value=5.8e-20 Score=147.03 Aligned_cols=96 Identities=19% Similarity=0.233 Sum_probs=81.2
Q ss_pred ccEEEEeCCCCCceeEeeCCceEEec----ccccCC----------ccccceEEEEEeCCC---CeEEEEeccCCceEec
Q 019461 16 IWAKLEPSDSRFADVDISSNEVVICS----EITSSS----------SDKHEWCKITRNSDL---HSAKMQNKSSNAILVD 78 (340)
Q Consensus 16 ~~~~L~~~~~~~~~~~l~~~~~~iGr----~~~~~~----------~vS~~H~~i~~~~~~---~~~~i~D~StNgt~vn 78 (340)
+||||+|+...++.+.|.+++++||| ++.+++ .|||.||+|.++.+. ..++|.|+|+||||||
T Consensus 1 PwgrL~~~~~~~~~~~L~~~~~~iGR~~~cdi~l~~~~~~~~~~~~~ISr~H~~I~~~~~~~~~~~~~i~d~S~NGT~vN 80 (116)
T d1gxca_ 1 PWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVN 80 (116)
T ss_dssp CCEEEEECSTTCCCEEECSSEEEEESSTTCSEECCCGGGGGSSGGGGSCTTCEEEEEEECTTSSEEEEEEECCSSCEEET
T ss_pred CeEEEEecCCCCceEEeCCCCEEeeeCCCCCeEecCCccccccccceEecceEEEEEecccCCCCEEEEECCCccCceEC
Confidence 69999999999999999999999999 566654 499999999987432 3488999999999999
Q ss_pred cEecCCCceeeccCCCeeccCCCCcceeccccccc
Q 019461 79 DTMVQNEEVVDIKCGTEIIPGPDREVYLNFRFKVV 113 (340)
Q Consensus 79 g~~i~~~~~~~l~~gd~I~lg~~~~~~~~y~f~i~ 113 (340)
|++|++++.+.|++||+|.+|... ...|.|..+
T Consensus 81 ~~~i~~~~~~~L~~gD~I~ig~~~--~~~f~f~d~ 113 (116)
T d1gxca_ 81 TELVGKGKRRPLNNNSEIALSLSR--NKVFVFFDL 113 (116)
T ss_dssp TEECCTTCEEECCTTEEEEESSTT--CEEEEEEET
T ss_pred CEEcCCCCEEECCCCCEEEECCCE--eEEEEEEEc
Confidence 999999999999999999999753 334555544
|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|