Citrus Sinensis ID: 019498

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI
cHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccEEEcccccHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccEEEccccccccccHHHHHccccccccccEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccc
cHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccccEEEccccHccHEEEccccHHHHHHHHHcccccccccccccEEEccccccccccccHHHHHcHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEccccEEcccHHHHcccccHHHcccccccccEEEcHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHccccccc
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAaiknddfvvpqyrepgvllwRGFSMQEFAnqcfgnkadygkgrqmpihygsnkhnyftVSSTIATQLPHAVGAAYALkmdrkdacavtyfgdggtsegdfHAALnfsavteaPVIFIcrnngwaistpisdqfrsdgavvkgrAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYrvghhttsddstkyrpvdeiewwrttqdpvTRFRKWIesngwwngdieSELRSSVRKQILHALQEaekaekppisdlftdvydvspsnlrEQEHSLRETIKkhpqdypsnvpi
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTpisdqfrsdgAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGhhttsddstkyrpvdeiewwrttqdpvtrfRKWIESNGWWNGDIESELRSSVRKQILHALQeaekaekppisdlFTDVYDVSPSNLREQEHSLretikkhpqdypsnvpi
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEainiasaaaiKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI
*****VTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESEL*******IL*****************F***********************************
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQD*P*****
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRV**********KYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKH**********
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query340 2.2.26 [Sep-21-2011]
Q54M22441 2-oxoisovalerate dehydrog yes no 0.991 0.764 0.514 1e-106
O45924431 2-oxoisovalerate dehydrog yes no 0.982 0.774 0.529 1e-106
A5A6H9445 2-oxoisovalerate dehydrog yes no 0.985 0.752 0.507 1e-102
Q8HXY4445 2-oxoisovalerate dehydrog N/A no 0.985 0.752 0.504 1e-102
P12694445 2-oxoisovalerate dehydrog yes no 0.985 0.752 0.501 1e-101
P11960441 2-oxoisovalerate dehydrog yes no 0.985 0.759 0.501 1e-101
P50136442 2-oxoisovalerate dehydrog yes no 0.985 0.757 0.498 1e-101
P11178455 2-oxoisovalerate dehydrog yes no 0.985 0.736 0.501 1e-100
Q72GU1367 2-oxoisovalerate dehydrog yes no 0.955 0.885 0.416 2e-64
Q5SLR4367 2-oxoisovalerate dehydrog yes no 0.955 0.885 0.416 2e-63
>sp|Q54M22|ODBA_DICDI 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=bkdA PE=3 SV=1 Back     alignment and function desciption
 Score =  384 bits (986), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 174/338 (51%), Positives = 237/338 (70%), Gaps = 1/338 (0%)

Query: 1   MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVL 60
           MY  M+TL  MD+I Y+ QRQGRISFY+T+ GEEAI+I SAAA++  D +  QYRE GV 
Sbjct: 93  MYTTMLTLNVMDSILYDVQRQGRISFYMTSFGEEAIHIGSAAALEMSDTIFAQYRETGVF 152

Query: 61  LWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK 120
           +WRGF++ +  NQC  N+ D GKGRQMP+H+GS K N  T+SS + TQLP AVG++YA K
Sbjct: 153 MWRGFTINDIINQCCTNEHDLGKGRQMPMHFGSRKINLQTISSPLTTQLPQAVGSSYAQK 212

Query: 121 MDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGA 180
           +  +  C + YFG+G  SEGDFHAA+NF+A    P IF CRNN WAISTP  +Q++ DG 
Sbjct: 213 LAGEKNCTIVYFGEGAASEGDFHAAMNFAAALSTPTIFFCRNNKWAISTPSKEQYKGDGI 272

Query: 181 VVKG-RAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDST 239
             +G   YG+++IRVDGND  A+Y+    AR++A+ E  P+LIEA+TYRVGHH+TSDDS+
Sbjct: 273 AGRGPNGYGMKTIRVDGNDIWAVYNVTKLARKIAVEEQVPVLIEAMTYRVGHHSTSDDSS 332

Query: 240 KYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKP 299
           +YR V+EI  W+  ++P++R R ++   GWW+   E E  ++ R  +  +L  AEK  KP
Sbjct: 333 RYRTVEEINAWKEGKNPISRLRNYMNHKGWWSDAQEKETIANARTTVRESLVNAEKQYKP 392

Query: 300 PISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSN 337
            I+++FTDVYD    NL EQ+  L E +K +P +YP N
Sbjct: 393 SINEIFTDVYDKPTPNLIEQQKELIEHLKLYPDEYPLN 430
The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Dictyostelium discoideum (taxid: 44689)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 4
>sp|O45924|ODBA_CAEEL 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=Y39E4A.3 PE=1 SV=2 Back     alignment and function description
>sp|A5A6H9|ODBA_PANTR 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Pan troglodytes GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|Q8HXY4|ODBA_MACFA 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Macaca fascicularis GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|P12694|ODBA_HUMAN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens GN=BCKDHA PE=1 SV=2 Back     alignment and function description
>sp|P11960|ODBA_RAT 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial (Fragment) OS=Rattus norvegicus GN=Bckdha PE=1 SV=1 Back     alignment and function description
>sp|P50136|ODBA_MOUSE 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Mus musculus GN=Bckdha PE=1 SV=1 Back     alignment and function description
>sp|P11178|ODBA_BOVIN 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Bos taurus GN=BCKDHA PE=2 SV=1 Back     alignment and function description
>sp|Q72GU1|ODBA_THET2 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C1757 PE=3 SV=1 Back     alignment and function description
>sp|Q5SLR4|ODBA_THET8 2-oxoisovalerate dehydrogenase subunit alpha OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0229 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
449507480 481 PREDICTED: 2-oxoisovalerate dehydrogenas 1.0 0.706 0.791 1e-167
449461865 481 PREDICTED: 2-oxoisovalerate dehydrogenas 1.0 0.706 0.791 1e-167
222616745 512 hypothetical protein OsJ_35450 [Oryza sa 1.0 0.664 0.794 1e-166
218186540 479 hypothetical protein OsI_37710 [Oryza sa 1.0 0.709 0.794 1e-166
108862263 487 2-oxoisovalerate dehydrogenase alpha sub 1.0 0.698 0.794 1e-166
115487674 486 Os12g0183100 [Oryza sativa Japonica Grou 1.0 0.699 0.794 1e-166
224083452378 predicted protein [Populus trichocarpa] 1.0 0.899 0.808 1e-166
255558474380 2-oxoisovalerate dehydrogenase, putative 0.997 0.892 0.787 1e-166
212275011 488 uncharacterized protein LOC100191513 [Ze 1.0 0.696 0.779 1e-166
357464693 449 2-oxoisovalerate dehydrogenase subunit a 1.0 0.757 0.785 1e-165
>gi|449507480|ref|XP_004163044.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  595 bits (1534), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 269/340 (79%), Positives = 310/340 (91%)

Query: 1   MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVL 60
           +Y+DMVTLQTMDTIFYEAQRQGRISFY+T+ GEEAIN+ASAAA+  DD +VPQYRE GVL
Sbjct: 142 IYHDMVTLQTMDTIFYEAQRQGRISFYVTSLGEEAINVASAAALSLDDLIVPQYREAGVL 201

Query: 61  LWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK 120
           +WRGF+++EFA+QCFGNK DY KGRQMP+HYGS +HNYFTV+STIA+Q+PHAVGAAY++K
Sbjct: 202 IWRGFTLKEFASQCFGNKYDYCKGRQMPVHYGSKRHNYFTVASTIASQIPHAVGAAYSMK 261

Query: 121 MDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGA 180
           MD+KDACAVTYFGDGGTSEGDFHAALNF+AV EAPVIFICRNNGWAISTPISDQFRSDG 
Sbjct: 262 MDKKDACAVTYFGDGGTSEGDFHAALNFAAVLEAPVIFICRNNGWAISTPISDQFRSDGV 321

Query: 181 VVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTK 240
           VVKG+AYGVRSIRVDGNDALA+Y+AV AAREMAI E RPILIEALTYR GHHTTSDDST+
Sbjct: 322 VVKGQAYGVRSIRVDGNDALAVYNAVRAAREMAIQEQRPILIEALTYRAGHHTTSDDSTR 381

Query: 241 YRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPP 300
           YRP +E+EWWR   DPV+RFRKWIESNGWW+ + E+ELRS +RKQ+L  +Q AE++EKPP
Sbjct: 382 YRPAEEMEWWRVAMDPVSRFRKWIESNGWWSNEAEAELRSRLRKQLLEEIQLAERSEKPP 441

Query: 301 ISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI 340
           ++D FTDVYDV PSNL+EQE  LR+TIK HPQDYPSN P+
Sbjct: 442 VADAFTDVYDVPPSNLQEQEKWLRKTIKTHPQDYPSNFPL 481

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449461865|ref|XP_004148662.1| PREDICTED: 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|222616745|gb|EEE52877.1| hypothetical protein OsJ_35450 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218186540|gb|EEC68967.1| hypothetical protein OsI_37710 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|108862263|gb|ABA95968.2| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi|108862264|gb|ABA95969.2| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115487674|ref|NP_001066324.1| Os12g0183100 [Oryza sativa Japonica Group] gi|77553175|gb|ABA95971.1| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi|108862262|gb|ABA95970.2| 2-oxoisovalerate dehydrogenase alpha subunit, mitochondrial precursor, putative, expressed [Oryza sativa Japonica Group] gi|113648831|dbj|BAF29343.1| Os12g0183100 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|224083452|ref|XP_002307033.1| predicted protein [Populus trichocarpa] gi|222856482|gb|EEE94029.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558474|ref|XP_002520262.1| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis] gi|223540481|gb|EEF42048.1| 2-oxoisovalerate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|212275011|ref|NP_001130417.1| uncharacterized protein LOC100191513 [Zea mays] gi|194689064|gb|ACF78616.1| unknown [Zea mays] gi|194690354|gb|ACF79261.1| unknown [Zea mays] gi|194690522|gb|ACF79345.1| unknown [Zea mays] gi|194703080|gb|ACF85624.1| unknown [Zea mays] gi|413916413|gb|AFW56345.1| hypothetical protein ZEAMMB73_816012 [Zea mays] Back     alignment and taxonomy information
>gi|357464693|ref|XP_003602628.1| 2-oxoisovalerate dehydrogenase subunit alpha [Medicago truncatula] gi|355491676|gb|AES72879.1| 2-oxoisovalerate dehydrogenase subunit alpha [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
TAIR|locus:2184702472 AT5G09300 "AT5G09300" [Arabido 1.0 0.720 0.747 6.8e-143
TAIR|locus:2027072472 AT1G21400 "AT1G21400" [Arabido 0.985 0.709 0.716 5.2e-136
WB|WBGene00012713432 Y39E4A.3 [Caenorhabditis elega 0.982 0.773 0.517 8.7e-95
UNIPROTKB|F1RHA0411 LOC100738911 "Uncharacterized 0.982 0.812 0.494 7e-93
UNIPROTKB|I3LNR4447 LOC100738911 "Uncharacterized 0.982 0.747 0.494 7e-93
DICTYBASE|DDB_G0286335441 bkdA "branched-chain alpha-ket 0.991 0.764 0.494 9e-93
UNIPROTKB|E2RPW4530 B3GNT8 "Uncharacterized protei 0.982 0.630 0.491 9e-93
UNIPROTKB|F1PI86480 B3GNT8 "Uncharacterized protei 0.982 0.695 0.491 9e-93
UNIPROTKB|F5H5P2479 BCKDHA "Uncharacterized protei 0.985 0.699 0.489 1.1e-92
UNIPROTKB|P12694445 BCKDHA "2-oxoisovalerate dehyd 0.985 0.752 0.489 1.1e-92
TAIR|locus:2184702 AT5G09300 "AT5G09300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1397 (496.8 bits), Expect = 6.8e-143, P = 6.8e-143
 Identities = 254/340 (74%), Positives = 291/340 (85%)

Query:     1 MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEXXXXXXXXXXKNDDFVVPQYREPGVL 60
             +Y+DMVTLQ MD IFYEAQRQGR+SFY T  GEE             D + PQYREPGVL
Sbjct:   133 IYSDMVTLQIMDNIFYEAQRQGRLSFYATAIGEEAINIASAAALTPQDVIFPQYREPGVL 192

Query:    61 LWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK 120
             LWRGF++QEFANQCFGNK+DYGKGRQMP+HYGSNK NYFTVS+TIATQLP+AVGAAY+LK
Sbjct:   193 LWRGFTLQEFANQCFGNKSDYGKGRQMPVHYGSNKLNYFTVSATIATQLPNAVGAAYSLK 252

Query:   121 MDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGA 180
             MD+KDACAVTYFGDGGTSEGDFHAALN +AV EAPV+FICRNNGWAISTP SDQFRSDG 
Sbjct:   253 MDKKDACAVTYFGDGGTSEGDFHAALNIAAVMEAPVLFICRNNGWAISTPTSDQFRSDGV 312

Query:   181 VVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTK 240
             VVKGRAYG+RSIRVDGNDALA+YSAVH AREMAI E RPILIEALTYRVGHH+TSDDST+
Sbjct:   313 VVKGRAYGIRSIRVDGNDALAMYSAVHTAREMAIREQRPILIEALTYRVGHHSTSDDSTR 372

Query:   241 YRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPP 300
             YR   EIEWW   ++P++RFR WIESNGWW+   ES+LRS ++K++L AL+ AEK EKP 
Sbjct:   373 YRSAGEIEWWNKARNPLSRFRTWIESNGWWSDKTESDLRSRIKKEMLEALRVAEKTEKPN 432

Query:   301 ISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSNVPI 340
             + ++F+DVYDV PSNLREQE  +R+TI  HPQDYPS+VP+
Sbjct:   433 LQNMFSDVYDVPPSNLREQELLVRQTINSHPQDYPSDVPL 472
GO:0003863 "3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA
TAIR|locus:2027072 AT1G21400 "AT1G21400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00012713 Y39E4A.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHA0 LOC100738911 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNR4 LOC100738911 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286335 bkdA "branched-chain alpha-keto acid dehydrogenase E1 alpha chain" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPW4 B3GNT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI86 B3GNT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F5H5P2 BCKDHA "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P12694 BCKDHA "2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O45924ODBA_CAEEL1, ., 2, ., 4, ., 40.52970.98230.7749yesno
P11960ODBA_RAT1, ., 2, ., 4, ., 40.50140.98520.7596yesno
Q5HQ76ODPA_STAEQ1, ., 2, ., 4, ., 10.39140.92350.8486yesno
Q5SLR4ODBA_THET81, ., 2, ., 4, ., 40.41640.95580.8855yesno
Q72GU1ODBA_THET21, ., 2, ., 4, ., 40.41640.95580.8855yesno
Q54M22ODBA_DICDI1, ., 2, ., 4, ., 40.51470.99110.7641yesno
P35485ODPA_ACHLA1, ., 2, ., 4, ., 10.33950.90880.8956yesno
P60090ODPA_STAAW1, ., 2, ., 4, ., 10.40060.92350.8486yesno
Q6GAC1ODPA_STAAS1, ., 2, ., 4, ., 10.40060.92350.8486yesno
P12694ODBA_HUMAN1, ., 2, ., 4, ., 40.50140.98520.7528yesno
Q5HGZ1ODPA_STAAC1, ., 2, ., 4, ., 10.40060.92350.8486yesno
O06161BKDA_MYCTU1, ., 2, ., 4, ., 40.37040.92940.8610yesno
P11178ODBA_BOVIN1, ., 2, ., 4, ., 40.50140.98520.7362yesno
A5A6H9ODBA_PANTR1, ., 2, ., 4, ., 40.50740.98520.7528yesno
Q6GHZ2ODPA_STAAR1, ., 2, ., 4, ., 10.39750.92350.8486yesno
Q4MTG0ODPA_BACCE1, ., 2, ., 4, ., 10.37800.92050.8436yesno
P60089ODPA_STAAM1, ., 2, ., 4, ., 10.40060.92350.8486yesno
P47516ODPA_MYCGE1, ., 2, ., 4, ., 10.31250.91170.8659yesno
Q8CPN3ODPA_STAES1, ., 2, ., 4, ., 10.39140.92350.8486yesno
P21881ODPA_BACSU1, ., 2, ., 4, ., 10.39110.89410.8194yesno
Q820A6ODPA_STAAN1, ., 2, ., 4, ., 10.40060.92350.8486yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.40.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
cd02000293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosph 1e-144
COG1071358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogena 1e-125
TIGR03181341 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E 1e-119
pfam00676303 pfam00676, E1_dh, Dehydrogenase E1 component 1e-111
TIGR03182315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E 1e-69
PLN02269362 PLN02269, PLN02269, Pyruvate dehydrogenase E1 comp 1e-43
CHL00149341 CHL00149, odpA, pyruvate dehydrogenase E1 componen 2e-40
PLN02374433 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl 5e-34
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 2e-11
cd02012255 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) fami 2e-10
PRK05899 586 PRK05899, PRK05899, transketolase; Reviewed 8e-08
COG3959243 COG3959, COG3959, Transketolase, N-terminal subuni 2e-06
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 6e-05
COG0021 663 COG0021, TktA, Transketolase [Carbohydrate transpo 4e-04
cd02007195 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) fam 0.002
>gnl|CDD|238958 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information 
 Score =  407 bits (1049), Expect = e-144
 Identities = 124/294 (42%), Positives = 178/294 (60%), Gaps = 2/294 (0%)

Query: 1   MYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKNDDFVVPQYREPGV 59
           +Y  MV ++  D    E  RQG+I  FY  + G+EA+ +  AAA++  D+V P YR+ G 
Sbjct: 1   LYRTMVLIRRFDERLLELYRQGKIGGFYHLSIGQEAVAVGVAAALRPGDWVFPTYRDHGH 60

Query: 60  LLWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYAL 119
            L RG  ++E   + FG +    KGR   +H G  + N+F  +  +  Q+P A GAA AL
Sbjct: 61  ALARGVDLKEMLAELFGKETGPCKGRGGSMHIGDKEKNFFGGNGIVGGQVPLAAGAALAL 120

Query: 120 KMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDG 179
           K   +D  AV +FGDG T+EGDFH ALNF+A+ + PVIF+C NNG+AISTP S Q     
Sbjct: 121 KYRGEDRVAVCFFGDGATNEGDFHEALNFAALWKLPVIFVCENNGYAISTPTSRQTAGTS 180

Query: 180 AVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDST 239
              +  AYG+  IRVDGND LA+Y A   A E A   G P LIEA+TYR+G H+TSDD +
Sbjct: 181 IADRAAAYGIPGIRVDGNDVLAVYEAAKEAVERARAGGGPTLIEAVTYRLGGHSTSDDPS 240

Query: 240 KYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEA 293
           +YR  +E+E W+  +DP+ R RK++   G    +  + + + V+ ++  A++ A
Sbjct: 241 RYRTKEEVEEWK-KRDPILRLRKYLIEAGILTEEELAAIEAEVKAEVEEAVEFA 293

PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine). Length = 293
>gnl|CDD|223997 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|213783 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|201386 pfam00676, E1_dh, Dehydrogenase E1 component Back     alignment and domain information
>gnl|CDD|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|215152 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>gnl|CDD|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215213 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|238970 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>gnl|CDD|235639 PRK05899, PRK05899, transketolase; Reviewed Back     alignment and domain information
>gnl|CDD|226468 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|223100 COG0021, TktA, Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238965 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 340
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 100.0
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 100.0
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 100.0
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 100.0
KOG0225394 consensus Pyruvate dehydrogenase E1, alpha subunit 100.0
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 100.0
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 100.0
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 100.0
KOG1182432 consensus Branched chain alpha-keto acid dehydroge 100.0
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 100.0
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 100.0
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 100.0
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 100.0
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 100.0
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.97
PRK12754 663 transketolase; Reviewed 99.96
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 99.96
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 99.96
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 99.96
PRK05899 624 transketolase; Reviewed 99.96
PTZ00089 661 transketolase; Provisional 99.96
PRK12753 663 transketolase; Reviewed 99.96
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 99.95
KOG0450 1017 consensus 2-oxoglutarate dehydrogenase, E1 subunit 99.95
PLN02790 654 transketolase 99.95
KOG0451 913 consensus Predicted 2-oxoglutarate dehydrogenase, 99.94
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.94
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 99.94
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydro 99.94
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 99.93
COG0021 663 TktA Transketolase [Carbohydrate transport and met 99.92
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 99.92
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 99.92
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 99.92
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.91
KOG0523 632 consensus Transketolase [Carbohydrate transport an 99.9
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 99.9
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 99.9
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 99.89
PRK05261 785 putative phosphoketolase; Provisional 99.84
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.82
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.82
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.81
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.81
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.8
PRK06163202 hypothetical protein; Provisional 99.8
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.79
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.79
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.78
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.77
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 99.77
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 99.77
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.77
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.77
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.77
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.76
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.76
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.75
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.73
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.73
PRK07524535 hypothetical protein; Provisional 99.73
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.72
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 99.71
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 99.71
PRK07586514 hypothetical protein; Validated 99.7
PRK12474518 hypothetical protein; Provisional 99.7
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 99.7
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.69
PRK08327569 acetolactate synthase catalytic subunit; Validated 99.69
PRK06154565 hypothetical protein; Provisional 99.69
PRK07092530 benzoylformate decarboxylase; Reviewed 99.69
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 99.68
PRK11269591 glyoxylate carboligase; Provisional 99.68
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 99.68
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.68
PRK08266542 hypothetical protein; Provisional 99.68
PRK06546578 pyruvate dehydrogenase; Provisional 99.67
PRK08199557 thiamine pyrophosphate protein; Validated 99.67
PRK05858542 hypothetical protein; Provisional 99.67
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 99.67
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 99.66
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.66
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 99.66
PRK09124574 pyruvate dehydrogenase; Provisional 99.66
PRK07064544 hypothetical protein; Provisional 99.66
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 99.66
PRK06112578 acetolactate synthase catalytic subunit; Validated 99.65
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 99.65
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 99.65
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 99.65
PLN02573578 pyruvate decarboxylase 99.65
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 99.65
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 99.64
PRK08611576 pyruvate oxidase; Provisional 99.64
PRK06457549 pyruvate dehydrogenase; Provisional 99.64
PRK08617552 acetolactate synthase; Reviewed 99.64
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 99.64
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 99.64
CHL00099585 ilvB acetohydroxyacid synthase large subunit 99.63
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 99.63
PRK08322547 acetolactate synthase; Reviewed 99.63
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 99.63
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.63
PRK08273597 thiamine pyrophosphate protein; Provisional 99.63
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 99.63
PRK08155564 acetolactate synthase catalytic subunit; Validated 99.63
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 99.62
PLN02470585 acetolactate synthase 99.62
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 99.62
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.62
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 99.62
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 99.61
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.61
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 99.61
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 99.6
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 99.59
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 99.59
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 99.58
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.56
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.56
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 99.54
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.53
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.52
COG2609 887 AceE Pyruvate dehydrogenase complex, dehydrogenase 99.48
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.45
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 99.38
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.37
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 99.34
KOG1185571 consensus Thiamine pyrophosphate-requiring enzyme 99.33
KOG4166675 consensus Thiamine pyrophosphate-requiring enzyme 99.3
PF09364379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 99.26
COG3960592 Glyoxylate carboligase [General function predictio 99.15
KOG1184561 consensus Thiamine pyrophosphate-requiring enzyme 99.09
COG3962617 Acetolactate synthase [Amino acid transport and me 99.07
COG3957 793 Phosphoketolase [Carbohydrate transport and metabo 98.67
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 98.58
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 98.07
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 98.06
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 97.61
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.23
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 97.2
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 97.1
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 97.03
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 96.99
TIGR021761165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 96.97
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 96.95
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 96.91
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 96.76
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 96.7
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 96.61
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 95.77
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 95.48
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 95.41
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 95.4
PRK08611 576 pyruvate oxidase; Provisional 95.18
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 95.0
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 95.0
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 94.96
PRK08366 390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 94.89
PRK07524 535 hypothetical protein; Provisional 94.77
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 94.55
PRK06457 549 pyruvate dehydrogenase; Provisional 94.53
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 94.5
PRK07064 544 hypothetical protein; Provisional 94.45
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 94.35
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 94.32
PRK11269 591 glyoxylate carboligase; Provisional 94.29
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 94.27
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 94.26
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 94.24
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 94.22
PRK08266 542 hypothetical protein; Provisional 94.12
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 94.06
PRK06112 578 acetolactate synthase catalytic subunit; Validated 94.02
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 93.94
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 93.94
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 93.86
PRK07586 514 hypothetical protein; Validated 93.84
PRK08322 547 acetolactate synthase; Reviewed 93.72
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 93.71
PLN02470 585 acetolactate synthase 93.71
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 93.68
TIGR03394 535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 93.57
PRK08155 564 acetolactate synthase catalytic subunit; Validated 93.53
PRK12474 518 hypothetical protein; Provisional 93.53
PRK08273 597 thiamine pyrophosphate protein; Provisional 93.49
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 93.4
PRK08199 557 thiamine pyrophosphate protein; Validated 93.39
PRK09622 407 porA pyruvate flavodoxin oxidoreductase subunit al 93.33
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 93.3
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 93.29
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 93.1
PRK08367 394 porA pyruvate ferredoxin oxidoreductase subunit al 93.09
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 93.0
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 92.92
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 92.8
PRK05858 542 hypothetical protein; Provisional 92.78
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 92.68
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 92.6
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 92.6
PRK08327 569 acetolactate synthase catalytic subunit; Validated 92.56
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 92.46
PRK08617 552 acetolactate synthase; Reviewed 92.38
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 92.28
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 92.26
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 92.2
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 92.15
PRK09124 574 pyruvate dehydrogenase; Provisional 92.11
cd01460266 vWA_midasin VWA_Midasin: Midasin is a member of th 92.1
PLN02573 578 pyruvate decarboxylase 92.08
PRK06154 565 hypothetical protein; Provisional 91.81
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 91.74
TIGR00204617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 91.72
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 91.24
PRK07092 530 benzoylformate decarboxylase; Reviewed 91.15
TIGR00173 432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 90.74
PRK06546 578 pyruvate dehydrogenase; Provisional 90.5
TIGR00232653 tktlase_bact transketolase, bacterial and yeast. T 90.29
PRK05444580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 89.44
PTZ00089661 transketolase; Provisional 89.35
PRK12571641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 89.06
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 88.95
PLN02234641 1-deoxy-D-xylulose-5-phosphate synthase 88.32
PLN02225701 1-deoxy-D-xylulose-5-phosphate synthase 88.18
KOG4166 675 consensus Thiamine pyrophosphate-requiring enzyme 88.02
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and relate 87.89
PLN02582677 1-deoxy-D-xylulose-5-phosphate synthase 87.81
PRK05899624 transketolase; Reviewed 87.25
PLN02683356 pyruvate dehydrogenase E1 component subunit beta 86.64
PLN02790654 transketolase 86.55
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 85.2
PRK09212327 pyruvate dehydrogenase subunit beta; Validated 84.96
COG0021663 TktA Transketolase [Carbohydrate transport and met 84.4
COG4032172 Predicted thiamine-pyrophosphate-binding protein [ 84.2
PRK12753663 transketolase; Reviewed 84.15
PTZ00182355 3-methyl-2-oxobutanate dehydrogenase; Provisional 82.71
TIGR03393 539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 82.14
PRK12754663 transketolase; Reviewed 81.35
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-88  Score=642.60  Aligned_cols=323  Identities=40%  Similarity=0.683  Sum_probs=311.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHcCCcc-ccccCCchHHHHHHHHHccCCC-cEEEccCccHHHHHHcCCCHHHHHHHhhcCC
Q 019498            1 MYNDMVTLQTMDTIFYEAQRQGRIS-FYLTTSGEEAINIASAAAIKND-DFVVPQYREPGVLLWRGFSMQEFANQCFGNK   78 (340)
Q Consensus         1 ~y~~M~~~R~~e~~~~~~~~~g~~~-~~~~~~G~Ea~~~~~~~al~~~-D~~~~~yR~~~~~l~~G~~~~~~~~~~~~~~   78 (340)
                      +|++|+++|.||+++..++|+|+++ |+|++.||||+++|++.+|++. ||++|+||+|+++|++|+++.++|++++|+.
T Consensus        32 ~y~~M~l~R~fd~k~~~l~r~G~i~gf~~~~~GqEA~~vg~~~aL~~~~D~i~~~YR~h~~~l~~G~~~~~~~a~~~G~~  111 (358)
T COG1071          32 LYRLMLLIRRFDEKMLQLQRQGKIGGFYHLYIGQEAVQVGAAAALRPGEDWIFPTYRDHGHLLARGVPLKEIMAELLGKA  111 (358)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCcccCcCCcccHHHHHHHHHHhcCCCCCEeecccCccccceecCCCHHHHHHHHhccc
Confidence            5999999999999999999999996 9999999999999999999965 9999999999999999999999999999999


Q ss_pred             CCCCCCCccccccCCCCCCccccCccccchhhHHHHHHHHhhhcCCCC-eEEEEECCcccCcchHHHHHHHHHhCCCCEE
Q 019498           79 ADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDA-CAVTYFGDGGTSEGDFHAALNFSAVTEAPVI  157 (340)
Q Consensus        79 ~~~~~G~~~~~h~~~~~~~~~~~~g~lG~~lp~A~G~A~a~k~~~~~~-~vv~~~GDG~~~~G~~~Eal~~A~~~~Lpvi  157 (340)
                      +|+|+|+++++|++++..++++.++++|.|+|.|+|+|+|.|+++.+. +++|++|||+++||.|||+||+|+.|+||||
T Consensus       112 ~g~~kGr~~~~h~~~~~~~~~~~~~iVg~Q~~~AaG~A~a~k~~~~~~~Va~~~~GDGat~qG~FhEalN~A~v~klPvv  191 (358)
T COG1071         112 TGPCKGRGGSMHYSDKEKGFLGGSGIVGTQIPLAAGAALALKYRGTKDGVAVAFFGDGATNQGDFHEALNFAAVWKLPVV  191 (358)
T ss_pred             cCCCCCCCCcccccccccccCCCCceecccccHHHHHHHHHHHhCCCCcEEEEEecCCccccchHHHHHHHHHHhcCCEE
Confidence            999999999999998889999999999999999999999999999555 9999999999999999999999999999999


Q ss_pred             EEEEeCCccccccccCccCccchhhhhhhcCceEEEEcCCCHHHHHHHHHHHHHHhHccCCCEEEEEEEecCCCCCCCCC
Q 019498          158 FICRNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDD  237 (340)
Q Consensus       158 ~vv~nN~~~~~~~~~~~~~~~~~~~~a~a~G~~~~~VdG~d~~~v~~a~~~a~~~~r~~~~P~lIe~~t~R~~gHs~~dd  237 (340)
                      |||+||+|+||++...+...+.++.++.+||+|+++|||+|+.+|++++++|++++|+++||+|||+.|||++|||++||
T Consensus       192 f~ieNN~yAiSvp~~~q~~~~~~~~ra~aygipgv~VDG~D~~avy~~~~~A~e~AR~g~GPtLIE~~tYR~~~HS~sDd  271 (358)
T COG1071         192 FVIENNQYAISVPRSRQTAAEIIAARAAAYGIPGVRVDGNDVLAVYEAAKEAVERARAGEGPTLIEAVTYRYGGHSTSDD  271 (358)
T ss_pred             EEEecCCceeecchhhcccchhHHhhhhccCCCeEEECCcCHHHHHHHHHHHHHHHHcCCCCEEEEEEEeecCCCCCCCC
Confidence            99999999999888777766667779999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCChHHHHHHHhCCChHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhCCCCCccccccccccCCCccHH
Q 019498          238 STKYRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLR  317 (340)
Q Consensus       238 ~~~Yr~~~e~~~~~~~~dpi~~~~~~L~~~g~~~~~~~~~~~~~~~~~~~~a~~~a~~~~~p~~~~~~~~v~~~~~~~~~  317 (340)
                      |..||+++|++.|+ ++|||.+++++|++.|++|++++++++++++++|++++++|+++|.|+++++|+|||++.|+.+.
T Consensus       272 ~~~YRskeE~~~~~-~~DPi~r~~~~L~~~g~~see~~~~i~~e~~~~V~ea~e~a~~~p~P~~~~~~~~Vy~~~~~~l~  350 (358)
T COG1071         272 PSKYRSKEEVEEWK-KRDPIVRLRKYLIEAGILSEEELEAIEAEAKAEVDEAVEFAEASPYPDVSELFEDVYAEGPPHLE  350 (358)
T ss_pred             ccccCCHHHHHHHh-ccChHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHhCCCCChhHhhhcccccCChhHH
Confidence            99999999999998 59999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHH
Q 019498          318 EQEHSLR  324 (340)
Q Consensus       318 ~~~~~l~  324 (340)
                      +|++.+.
T Consensus       351 ~q~~~~~  357 (358)
T COG1071         351 EQREELE  357 (358)
T ss_pred             HHHHhhc
Confidence            9987654

>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>KOG1182 consensus Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>KOG0450 consensus 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>KOG0451 consensus Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PLN02683 pyruvate dehydrogenase E1 component subunit beta Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4032 Predicted thiamine-pyrophosphate-binding protein [General function prediction only] Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
2j9f_A400 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 1e-100
1dtw_A400 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 5e-99
1x7y_A400 Crystal Structure Of The Human Mitochondrial Branch 7e-99
1x80_A400 Crystal Structure Of The Human Mitochondrial Branch 8e-99
2bff_A400 Reactivity Modulation Of Human Branched-Chain Alpha 9e-99
1x7w_A400 Crystal Structure Of The Human Mitochondrial Branch 9e-99
1x7x_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-98
1x7z_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-98
1olu_A400 Roles Of His291-Alpha And His146-Beta' In The Reduc 7e-98
1v16_A400 Crosstalk Between Cofactor Binding And The Phosphor 2e-97
1v11_A400 Crosstalk Between Cofactor Binding And The Phosphor 4e-97
2bfc_A400 Reactivity Modulation Of Human Branched-Chain Alpha 4e-97
2bfe_A400 Reactivity Modulation Of Human Branched-Chain Alpha 7e-97
2bfb_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-96
1v1m_A400 Crosstalk Between Cofactor Binding And The Phosphor 1e-96
2bfd_A400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-96
1um9_A367 Branched-chain 2-oxo Acid Dehydrogenase (e1) From T 2e-61
1w85_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1 7e-56
3duf_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 8e-56
1w88_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1( 2e-55
3dva_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 4e-55
2bp7_A410 New Crystal Form Of The Pseudomonas Putida Branched 3e-50
1qs0_A407 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 3e-47
3exe_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-27
3exf_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-27
3exh_C382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 5e-27
2ozl_A365 Human Pyruvate Dehydrogenase S264e Variant Length = 5e-27
3exi_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 6e-27
1ni4_A365 Human Pyruvate Dehydrogenase Length = 365 4e-25
>pdb|2J9F|A Chain A, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 400 Back     alignment and structure 
Iteration: 1

 Score =  360 bits (924), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 165/335 (49%), Positives = 224/335 (66%)
Query: 1   MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEXXXXXXXXXXKNDDFVVPQYREPGVL 60
           +Y  M  L TMD I YE+QRQGRISFY+T  GEE           N D V  QYRE GVL
Sbjct: 60  LYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVL 119
Query: 61  LWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK 120
           ++R + ++ F  QC+GN +D GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K
Sbjct: 120 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAK 179
Query: 121 MDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGA 180
               +   + YFG+G  SEGD HA  NF+A  E P+IF CRNNG+AISTP S+Q+R DG 
Sbjct: 180 RANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 239
Query: 181 VVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTK 240
             +G  YG+ SIRVDGND  A+Y+A   AR  A+ E +P LIEA+TYR+GHH+TSDDS+ 
Sbjct: 240 AARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSA 299
Query: 241 YRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPP 300
           YRPVDE+ +W     P++R R ++ S GWW+ + E   R   R++++ A ++AE+  KP 
Sbjct: 300 YRPVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPN 359
Query: 301 ISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYP 335
            + LF+DVY   P+ LR+Q+ SL   ++ + + YP
Sbjct: 360 PNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYP 394
>pdb|1DTW|A Chain A, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7Y|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X80|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BFF|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1X7W|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7X|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7Z|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1OLU|A Chain A, Roles Of His291-Alpha And His146-Beta' In The Reductive Acylation Reaction Catalyzed By Human Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1V16|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|1V11|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|2BFC|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFE|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFB|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1V1M|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|2BFD|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1UM9|A Chain A, Branched-chain 2-oxo Acid Dehydrogenase (e1) From Thermus Thermophilus Hb8 In Apo-form Length = 367 Back     alignment and structure
>pdb|1W85|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|3DUF|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|1W88|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1(D180n, E183q) Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|3DVA|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|2BP7|A Chain A, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 410 Back     alignment and structure
>pdb|1QS0|A Chain A, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 407 Back     alignment and structure
>pdb|3EXE|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXH|C Chain C, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|2OZL|A Chain A, Human Pyruvate Dehydrogenase S264e Variant Length = 365 Back     alignment and structure
>pdb|3EXI|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex With The Subunit-Binding Domain (Sbd) Of E2p, But Sbd Cannot Be Modeled Into The Electron Density Length = 382 Back     alignment and structure
>pdb|1NI4|A Chain A, Human Pyruvate Dehydrogenase Length = 365 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 0.0
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 1e-176
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 1e-169
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 1e-167
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 2e-77
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 4e-09
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 6e-07
3l84_A 632 Transketolase; TKT, structural genomics, center fo 2e-04
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Length = 400 Back     alignment and structure
 Score =  515 bits (1328), Expect = 0.0
 Identities = 165/337 (48%), Positives = 229/337 (67%)

Query: 1   MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVL 60
           +Y  M  L TMD I YE+QRQGRISFY+T  GEE  ++ SAAA+ N D V  Q RE GVL
Sbjct: 60  LYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVL 119

Query: 61  LWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK 120
           ++R + ++ F  QC+GN +D GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K
Sbjct: 120 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAK 179

Query: 121 MDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGA 180
               +   + YFG+G  SEGD HA  NF+A  E P+IF CRNNG+AISTP S+Q+R DG 
Sbjct: 180 RANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 239

Query: 181 VVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTK 240
             +G  YG+ SIRVDGND  A+Y+A   AR  A+ E +P LIEA+TYR+GH +TSDDS+ 
Sbjct: 240 AARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHASTSDDSSA 299

Query: 241 YRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPP 300
           +R VDE+ +W     P++R R ++ S GWW+ + E   R   R++++ A ++AE+  KP 
Sbjct: 300 FRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPN 359

Query: 301 ISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSN 337
            + LF+DVY   P+ LR+Q+ SL   ++ + + YP +
Sbjct: 360 PNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLD 396
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Length = 367 Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Length = 407 Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Length = 368 Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Length = 365 Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Length = 616 Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Length = 845 Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Length = 632 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 100.0
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 100.0
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 100.0
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 100.0
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 100.0
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 100.0
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 100.0
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 100.0
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 100.0
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 100.0
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 99.97
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 99.97
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 99.97
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 99.97
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 99.97
3uk1_A 711 Transketolase; structural genomics, seattle struct 99.97
3l84_A 632 Transketolase; TKT, structural genomics, center fo 99.96
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 99.96
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 99.96
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 99.96
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.96
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 99.94
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 99.91
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 99.8
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 99.73
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 99.72
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 99.7
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 99.7
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 99.7
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 99.69
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 99.69
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 99.69
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 99.69
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 99.67
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 99.67
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 99.67
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 99.67
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 99.67
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 99.67
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 99.66
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 99.66
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 99.65
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.59
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 99.58
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.55
2c42_A1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 99.06
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 94.84
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 94.78
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 94.77
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 94.69
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 94.51
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 94.23
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 94.2
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 94.18
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 94.11
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 93.97
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 93.68
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 93.67
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 93.52
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 93.52
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 93.31
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 93.27
3mos_A616 Transketolase, TK; thiamin diphosphate TPP THDP en 93.17
2o1x_A629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 92.45
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 92.43
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calc 92.25
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 92.2
2e6k_A651 Transketolase; structural genomics, NPPSFA, nation 92.09
1qs0_B338 2-oxoisovalerate dehydrogenase beta-subunit; heter 92.01
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine py 91.93
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 91.78
3kom_A663 Transketolase; rossmann fold, csgid, transferase, 91.69
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 91.33
2ozl_B341 PDHE1-B, pyruvate dehydrogenase E1 component subun 91.3
1gpu_A680 Transketolase; transferase(ketone residues); HET: 91.11
3l84_A632 Transketolase; TKT, structural genomics, center fo 90.93
2vbf_A 570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 90.45
1r9j_A673 Transketolase; domains, EACH of the alpha/beta typ 90.08
2vk8_A 563 Pyruvate decarboxylase isozyme 1; asymmetric activ 90.0
1umd_B324 E1-beta, 2-OXO acid dehydrogenase beta subunit; al 89.93
1ik6_A369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 89.4
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, t 89.35
1w85_B324 Pyruvate dehydrogenase E1 component, beta subunit; 88.98
1ovm_A 552 Indole-3-pyruvate decarboxylase; thiamine diphosph 88.06
2bfd_B342 2-oxoisovalerate dehydrogenase beta subunit; oxido 87.54
3uk1_A711 Transketolase; structural genomics, seattle struct 86.61
3rim_A700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 84.88
3hww_A 556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 84.52
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 84.44
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
Probab=100.00  E-value=1.1e-76  Score=579.94  Aligned_cols=339  Identities=49%  Similarity=0.909  Sum_probs=307.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHcCCccccccCCchHHHHHHHHHccCCCcEEEccCccHHHHHHcCCCHHHHHHHhhcCCCC
Q 019498            1 MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD   80 (340)
Q Consensus         1 ~y~~M~~~R~~e~~~~~~~~~g~~~~~~~~~G~Ea~~~~~~~al~~~D~~~~~yR~~~~~l~~G~~~~~~~~~~~~~~~~   80 (340)
                      +|+.|+++|.||+++..+++||+++|++++.||||+++|++.+|++.|+++++||+|++++.+|+++.++|.+++++.++
T Consensus        60 ~y~~M~~~r~fe~~~~~~~~~gri~~~~~~~GqEa~~vg~~~al~~~D~v~~~yR~~~~~~~~G~~~~~~l~e~~g~~~g  139 (400)
T 2bfd_A           60 LYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISD  139 (400)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTSSSCCCCCTTCHHHHHHHHHTSCTTSEEECCSCCHHHHHHTTCCHHHHHHHHHTCTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCCcceeecCCChHHHHHHHHHhcCCCCEEEecCcCHHHHHHcCCCHHHHHHHhcCCCCC
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             CCCCCccccccCCCCCCccccCccccchhhHHHHHHHHhhhcCCCCeEEEEECCcccCcchHHHHHHHHHhCCCCEEEEE
Q 019498           81 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFIC  160 (340)
Q Consensus        81 ~~~G~~~~~h~~~~~~~~~~~~g~lG~~lp~A~G~A~a~k~~~~~~~vv~~~GDG~~~~G~~~Eal~~A~~~~Lpvi~vv  160 (340)
                      +++|+++++|+.....++..++|+||+++|+|+|+|+|.++.+++++|||++|||++++|.+||+|++|++|+||+||||
T Consensus       140 ~~~G~~~~~H~~~~~~~~~~~~g~lG~~lp~AvG~AlA~~~~~~~~~vv~~~GDGa~~~G~~~Eal~~A~~~~lpvi~vv  219 (400)
T 2bfd_A          140 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFC  219 (400)
T ss_dssp             TTTTCSCSSCCCBTTTTBCCCCSSTTTHHHHHHHHHHHHHHHTCCCCEEEEEETTGGGSHHHHHHHHHHHHTTCCEEEEE
T ss_pred             CCCCCCCCcCCcccccCccccCccccccccHHHHHHHhhhhhCCCCeEEEEECchhhhcChHHHHHHHHHHHCcCEEEEE
Confidence            88899999999887778888899999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCccccccccCccCccchhhhhhhcCceEEEEcCCCHHHHHHHHHHHHHHhHccCCCEEEEEEEecCCCCCCCCCCCC
Q 019498          161 RNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTK  240 (340)
Q Consensus       161 ~nN~~~~~~~~~~~~~~~~~~~~a~a~G~~~~~VdG~d~~~v~~a~~~a~~~~r~~~~P~lIe~~t~R~~gHs~~dd~~~  240 (340)
                      +||+|+++++.....+.++++++|++|||++++|||+|+++|++|+++|++++|++++|+|||++|||.+|||++|+|..
T Consensus       220 ~NN~~~i~~~~~~~~~~~d~~~~a~a~G~~~~~VdG~D~~av~~a~~~A~~~ar~~~~P~lIe~~tyR~~gHs~~D~~~~  299 (400)
T 2bfd_A          220 RNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHASTSDDSSA  299 (400)
T ss_dssp             EECSEETTEEGGGTCSSSTTGGGTGGGTCEEEEEETTCHHHHHHHHHHHHHHHHHHTCCEEEEEECCCCC--CC------
T ss_pred             ECCceeeeecccccCCCCCHHHHHHHcCCcEEEEeCCCHHHHHHHHHHHHHHHHhCCCCEEEEEEeeeeCCCCCCCCCcc
Confidence            99999999988877777899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHhCCChHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhCCCCCccccccccccCCCccHHHHH
Q 019498          241 YRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQE  320 (340)
Q Consensus       241 Yr~~~e~~~~~~~~dpi~~~~~~L~~~g~~~~~~~~~~~~~~~~~~~~a~~~a~~~~~p~~~~~~~~v~~~~~~~~~~~~  320 (340)
                      ||+++|++.|++..|||.+++++|++.|++|++++++++++++++|++++++|++.|.|+++++|++||++.++.+.+|+
T Consensus       300 Yr~~~e~~~~~~~~dPl~~~~~~L~~~g~~~~~~~~~i~~~~~~~v~~a~~~a~~~~~p~~~~~~~~vy~~~~~~l~~q~  379 (400)
T 2bfd_A          300 FRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQ  379 (400)
T ss_dssp             -------------CCHHHHHHHHHTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHSCBCCGGGGSTTSSSSCCHHHHHHH
T ss_pred             CCCHHHHHHHHhcCCHHHHHHHHHHHCCCCChHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHhhccCCHHHHHHH
Confidence            99999999998545899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCCCCCC
Q 019498          321 HSLRETIKKHPQDYPSNVP  339 (340)
Q Consensus       321 ~~l~~~~~~~p~~~~~~~~  339 (340)
                      +.|.+.+.++|++|+++.|
T Consensus       380 ~~~~~~~~~~~~~~~~~~~  398 (400)
T 2bfd_A          380 ESLARHLQTYGEHYPLDHF  398 (400)
T ss_dssp             HHHHHHHHHHGGGSCGGGB
T ss_pred             HHHHHHHHhCCCcCCcccc
Confidence            9999999999999998764
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 340
d2bfda1395 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid 3e-80
d1qs0a_407 c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B 3e-70
d1w85a_365 c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, Pd 6e-69
d2ozla1361 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate de 9e-68
d1umda_362 c.36.1.11 (A:) Branched-chain alpha-keto acid dehy 8e-67
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Length = 395 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: Branched-chain alpha-keto acid dehydrogenase, PP module
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  248 bits (633), Expect = 3e-80
 Identities = 165/337 (48%), Positives = 229/337 (67%)

Query: 1   MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVL 60
           +Y  M  L TMD I YE+QRQGRISFY+T  GEE  ++ SAAA+ N D V  Q RE GVL
Sbjct: 55  LYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVL 114

Query: 61  LWRGFSMQEFANQCFGNKADYGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALK 120
           ++R + ++ F  QC+GN +D GKGRQMP+HYG  + ++ T+SS +ATQ+P AVGAAYA K
Sbjct: 115 MYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAK 174

Query: 121 MDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFICRNNGWAISTPISDQFRSDGA 180
               +   + YFG+G  SEGD HA  NF+A  E P+IF CRNNG+AISTP S+Q+R DG 
Sbjct: 175 RANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGI 234

Query: 181 VVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTK 240
             +G  YG+ SIRVDGND  A+Y+A   AR  A+ E +P LIEA+TYR+GH +TSDDS+ 
Sbjct: 235 AARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHASTSDDSSA 294

Query: 241 YRPVDEIEWWRTTQDPVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPP 300
           +R VDE+ +W     P++R R ++ S GWW+ + E   R   R++++ A ++AE+  KP 
Sbjct: 295 FRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPN 354

Query: 301 ISDLFTDVYDVSPSNLREQEHSLRETIKKHPQDYPSN 337
            + LF+DVY   P+ LR+Q+ SL   ++ + + YP +
Sbjct: 355 PNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLD 391
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Length = 407 Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Length = 365 Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Length = 361 Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 99.94
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 99.94
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 99.94
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 99.92
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.85
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.82
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 99.81
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 99.8
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.8
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.78
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.75
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.75
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.75
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.73
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.72
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.71
d2c42a2447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 98.23
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 96.54
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 96.52
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 96.39
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 96.22
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 96.17
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 96.05
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 95.84
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 95.72
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 95.71
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 95.28
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 95.18
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 93.3
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 92.13
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 91.9
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 91.43
d2ozlb1192 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 88.2
d1qs0b1204 2-oxoisovalerate dehydrogenase (E1B), Pyr module { 86.85
d1itza2192 Transketolase (TK), Pyr module {Maize (Zea mays) [ 86.44
d1ik6a1191 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 84.18
d2bfdb1203 Branched-chain alpha-keto acid dehydrogenase, Pyr 83.82
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: Branched-chain alpha-keto acid dehydrogenase, PP module
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.7e-86  Score=643.55  Aligned_cols=338  Identities=49%  Similarity=0.917  Sum_probs=310.8

Q ss_pred             CHHHHHHHHHHHHHHHHHHHcCCccccccCCchHHHHHHHHHccCCCcEEEccCccHHHHHHcCCCHHHHHHHhhcCCCC
Q 019498            1 MYNDMVTLQTMDTIFYEAQRQGRISFYLTTSGEEAINIASAAAIKNDDFVVPQYREPGVLLWRGFSMQEFANQCFGNKAD   80 (340)
Q Consensus         1 ~y~~M~~~R~~e~~~~~~~~~g~~~~~~~~~G~Ea~~~~~~~al~~~D~~~~~yR~~~~~l~~G~~~~~~~~~~~~~~~~   80 (340)
                      +||+|+++|.||+++..+++||++++++++.||||+++|++.+|+++||++++||+|+++|++|++++++|++++|+.++
T Consensus        55 ~Yr~M~~~R~~e~~~~~l~~~G~i~~~~~~~GqEA~~vg~~~al~~~D~~~~~yR~h~~~la~G~~~~~~~ael~g~~~g  134 (395)
T d2bfda1          55 LYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISD  134 (395)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTSSSCCCCCTTCHHHHHHHHHTSCTTSEEECCSCCHHHHHHTTCCHHHHHHHHHTCTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCcccccCCCChHHHHHHHHHHcCCCCeeccccchhHhhhhhhCCHHHHHHHHhhcccC
Confidence            59999999999999999999999998889999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccccccCCCCCCccccCccccchhhHHHHHHHHhhhcCCCCeEEEEECCcccCcchHHHHHHHHHhCCCCEEEEE
Q 019498           81 YGKGRQMPIHYGSNKHNYFTVSSTIATQLPHAVGAAYALKMDRKDACAVTYFGDGGTSEGDFHAALNFSAVTEAPVIFIC  160 (340)
Q Consensus        81 ~~~G~~~~~h~~~~~~~~~~~~g~lG~~lp~A~G~A~a~k~~~~~~~vv~~~GDG~~~~G~~~Eal~~A~~~~Lpvi~vv  160 (340)
                      +|+|+++++|++++..++++.++++|.++|+|+|+|+|.|+++.+++++|++|||++++|.|||+||+|+.|+|||||||
T Consensus       135 ~~~Grggs~H~~~~~~~~~~~~~ivg~~~p~A~G~A~a~k~~~~~~v~v~~~GDGa~~eG~f~EalN~A~~~~lPvlfv~  214 (395)
T d2bfda1         135 LGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFC  214 (395)
T ss_dssp             TTTTCSCSSCCCBTTTTBCCCCSSTTTHHHHHHHHHHHHHHHTCCCCEEEEEETTGGGSHHHHHHHHHHHHTTCCEEEEE
T ss_pred             ccccccccccccccccccccccccccccccHHHHHHHHhhhcCcccccccccCCCCccchhHHHHHHHHhhcCCceEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCccccccccCccCccchhhhhhhcCceEEEEcCCCHHHHHHHHHHHHHHhHccCCCEEEEEEEecCCCCCCCCCCCC
Q 019498          161 RNNGWAISTPISDQFRSDGAVVKGRAYGVRSIRVDGNDALAIYSAVHAAREMAIGEGRPILIEALTYRVGHHTTSDDSTK  240 (340)
Q Consensus       161 ~nN~~~~~~~~~~~~~~~~~~~~a~a~G~~~~~VdG~d~~~v~~a~~~a~~~~r~~~~P~lIe~~t~R~~gHs~~dd~~~  240 (340)
                      +||+|+++++...++...++++++++||+++++|||+|+.+|++++++|++++|+++||+|||++|||+++|+.+||+..
T Consensus       215 eNN~yaist~~~~~~~~~~i~~ra~~~gi~~~~vDG~Dv~aV~~a~~~A~~~~R~g~gP~lIE~~TyR~~~Hs~~DD~~~  294 (395)
T d2bfda1         215 RNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHASTSDDSSA  294 (395)
T ss_dssp             EECSEETTEEGGGTCSSSTTGGGTGGGTCEEEEEETTCHHHHHHHHHHHHHHHHHHTCCEEEEEECCCCC--CC------
T ss_pred             EecccccccccchhhcchhHHHhhhccccceeEEecCcHHHHHHHHHHhhhhhhccCCceEEEEeeecCCCCCCcCCccc
Confidence            99999999999999888899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChHHHHHHHhCCC-hHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhCCCCCccccccccccCCCccHHHH
Q 019498          241 YRPVDEIEWWRTTQD-PVTRFRKWIESNGWWNGDIESELRSSVRKQILHALQEAEKAEKPPISDLFTDVYDVSPSNLREQ  319 (340)
Q Consensus       241 Yr~~~e~~~~~~~~d-pi~~~~~~L~~~g~~~~~~~~~~~~~~~~~~~~a~~~a~~~~~p~~~~~~~~v~~~~~~~~~~~  319 (340)
                      ||+++|++.|++ +| ||.+++++|+++|++|++++++|+++++++|++|+++|+++|.|+++++|+|||++.|+++.+|
T Consensus       295 YR~~~Ei~~w~k-~DdPi~~~~~~Li~~g~~s~ee~~~i~~e~~~eV~~A~~~A~~~p~P~~~~l~~~VYae~p~~l~eq  373 (395)
T d2bfda1         295 FRSVDEVNYWDK-QDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQ  373 (395)
T ss_dssp             --------------CCHHHHHHHHHTTTTCCCHHHHHHHHHHHHHHHHHHHHHHHHSCBCCGGGGSTTSSSSCCHHHHHH
T ss_pred             ccCHHHHHHHHh-cCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHhhcccCCCHHHHHH
Confidence            999999999984 65 9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhCCCCCCCCCC
Q 019498          320 EHSLRETIKKHPQDYPSNVP  339 (340)
Q Consensus       320 ~~~l~~~~~~~p~~~~~~~~  339 (340)
                      ++.+++.+.++|+.||+..|
T Consensus       374 ~~~~~~~~~~~~e~~~~~~~  393 (395)
T d2bfda1         374 QESLARHLQTYGEHYPLDHF  393 (395)
T ss_dssp             HHHHHHHHHHHGGGSCGGGB
T ss_pred             HHHHHHHHHhCcccCChhhh
Confidence            99999999999999998765
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2bfdb1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure