Citrus Sinensis ID: 019550

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MGTEAVEILFENGFSKVCNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH
cccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEEEEEEEcccccEEEEEEcccccEEEEEcccEEEEcccccHHHHHcccccccccccccEEEEEccccHHHHHHHHccccccEEEEEEccHHHHHHHHHHcHHHHcccccccEEEEEcHHHHHHHHccccccEEEEccccccccccccccccHHHHHHHHccccccccEEEEccccccccccHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHccccHHHHHHHHccccccccccccccccccccccccc
ccccHHHHHEcccccccccccccccccccccEEEEEEcccccEEEEEEccEEEEEEEccccEEEEEEEcccEEEEEEccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHccccccEEEEEEccHHHHHHHHHHcHHHHcccccccEEEEEccHHHHHHHccccEEEEEEEcccccccccHHHHccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccEEEEEEEccccccccccccHHHHHHHcccccEcccHHHHHHHHHHHHHHHHHHHcccccEcccccEEEcccccEccccc
MGTEAVEILFENgfskvcndtdpningnlqdccwfeevIDDDLKWSFALNRVlhkgtsefqdIALLDTKRFGKVLVIDGKMQSAEVDEFIyheclihppllchqnpktvfimgGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNekfdvifgdladpveggpcyqlYTKSFYERIlkpklndngifvtqagpagifthKEVFSSIYNTIKQVFKHVVAYTahvpsfadtwgwvmasdqpfsinAEEIDNRIKSRINAELLYLngasflsstTMNKAVYLSLLNEthvyteedarfihghgvaynnsh
MGTEAVEILFENGFSKVCNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGtsefqdialldTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQeafcskklnlvVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH
MGTEAVEILFENGFSKVCNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH
*****VEILFENGFSKVCNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAY****
*******************************CCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIH**********
MGTEAVEILFENGFSKVCNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH
*****VE********************NLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAY****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTEAVEILFENGFSKVCNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCxxxxxxxxxxxxxxxxxxxxxFDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
Q9S7X6339 Thermospermine synthase A yes no 0.991 0.991 0.764 1e-156
Q975S5300 Probable spermidine synth yes no 0.802 0.906 0.410 3e-56
Q5SK28314 Spermidine synthase OS=Th yes no 0.834 0.901 0.396 6e-54
Q72K55314 Spermidine synthase OS=Th yes no 0.834 0.901 0.396 6e-54
Q4JAZ8302 Probable spermidine synth yes no 0.808 0.907 0.403 6e-53
Q9YE02314 Probable spermidine synth yes no 0.864 0.933 0.394 1e-52
Q9UXE4301 Probable spermidine synth yes no 0.817 0.920 0.407 2e-50
Q9HV34349 Spermidine synthase 2 OS= yes no 0.761 0.739 0.367 5e-47
Q2JQ57312 Spermidine synthase OS=Sy yes no 0.831 0.903 0.347 2e-46
C3NEA8301 Probable spermidine synth yes no 0.817 0.920 0.393 1e-45
>sp|Q9S7X6|ACL5_ARATH Thermospermine synthase ACAULIS5 OS=Arabidopsis thaliana GN=ACL5 PE=1 SV=1 Back     alignment and function desciption
 Score =  550 bits (1416), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 259/339 (76%), Positives = 293/339 (86%), Gaps = 3/339 (0%)

Query: 1   MGTEAVEILFENGFSKVCNDTDPN--INGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTS 58
           MG EAVE++F NGF ++   T P   ++ N QDC W+EE IDDDLKWSFALN VLH+GTS
Sbjct: 1   MG-EAVEVMFGNGFPEIHKATSPTQTLHSNQQDCHWYEETIDDDLKWSFALNSVLHQGTS 59

Query: 59  EFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGS 118
           E+QDIALLDTKRFGKVLVIDGKMQSAE DEFIYHECLIHP LL H NPKTVFIMGGGEGS
Sbjct: 60  EYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPNPKTVFIMGGGEGS 119

Query: 119 AAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEK 178
           AARE LKH ++EKVVMCDIDQEVVDFCRRFLTVN +AFC+KKL LV+ DAKAELEKR EK
Sbjct: 120 AAREILKHTTIEKVVMCDIDQEVVDFCRRFLTVNSDAFCNKKLELVIKDAKAELEKREEK 179

Query: 179 FDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIY 238
           FD+I GDLADPVEGGPCYQLYTKSFY+ ILKPKL+ NGIFVTQAGPAGIFTHKEVF+SIY
Sbjct: 180 FDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIFVTQAGPAGIFTHKEVFTSIY 239

Query: 239 NTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGAS 298
           NT+KQVFK+V AYTAHVPSFADTWGWVMASD  F +  +E+D RI+ R+N EL+YLN  S
Sbjct: 240 NTMKQVFKYVKAYTAHVPSFADTWGWVMASDHEFDVEVDEMDRRIEERVNGELMYLNAPS 299

Query: 299 FLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNN 337
           F+S+ T+NK + L+L  ET VY+EE+ARFIHGHGVAY +
Sbjct: 300 FVSAATLNKTISLALEKETEVYSEENARFIHGHGVAYRH 338
Required for correct xylem specification through regulation of the lifetime of the xylem elements. Prevents premature death of the xylem vessel elements.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 7EC: 9
>sp|Q975S5|SPEE_SULTO Probable spermidine synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=speE PE=3 SV=1 Back     alignment and function description
>sp|Q5SK28|SPEE_THET8 Spermidine synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=speE PE=1 SV=1 Back     alignment and function description
>sp|Q72K55|SPEE_THET2 Spermidine synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=speE PE=3 SV=1 Back     alignment and function description
>sp|Q4JAZ8|SPEE_SULAC Probable spermidine synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=speE PE=3 SV=1 Back     alignment and function description
>sp|Q9YE02|SPEE_AERPE Probable spermidine synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=speE PE=3 SV=2 Back     alignment and function description
>sp|Q9UXE4|SPEE_SULSO Probable spermidine synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=speE PE=3 SV=1 Back     alignment and function description
>sp|Q9HV34|SPEE2_PSEAE Spermidine synthase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=speE2 PE=3 SV=1 Back     alignment and function description
>sp|Q2JQ57|SPEE_SYNJB Spermidine synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=speE PE=3 SV=1 Back     alignment and function description
>sp|C3NEA8|SPEE_SULIY Probable spermidine synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=speE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
343887315339 spermidine synthase [Citrus unshiu] 1.0 1.0 0.994 0.0
380863128305 spermidine synthase, partial [Dimocarpus 0.899 1.0 0.911 1e-165
255550143339 Spermidine synthase, putative [Ricinus c 0.991 0.991 0.817 1e-163
225429646336 PREDICTED: thermospermine synthase ACAUL 0.988 0.997 0.828 1e-163
224088768339 predicted protein [Populus trichocarpa] 0.994 0.994 0.811 1e-161
297812137339 spermine synthase [Arabidopsis lyrata su 0.991 0.991 0.769 1e-155
18150168339 spermine synthase [Arabidopsis halleri s 0.991 0.991 0.766 1e-154
18150158339 spermine synthase [Arabidopsis thaliana] 0.991 0.991 0.764 1e-154
18419941339 Thermospermine synthase ACAULIS5 [Arabid 0.991 0.991 0.764 1e-154
356552394339 PREDICTED: thermospermine synthase ACAUL 0.988 0.988 0.764 1e-154
>gi|343887315|dbj|BAK61861.1| spermidine synthase [Citrus unshiu] Back     alignment and taxonomy information
 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/339 (99%), Positives = 337/339 (99%)

Query: 1   MGTEAVEILFENGFSKVCNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEF 60
           MGTEAVEILFENGFSKV NDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEF
Sbjct: 1   MGTEAVEILFENGFSKVSNDTDPNINGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEF 60

Query: 61  QDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAA 120
           QDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAA
Sbjct: 61  QDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAA 120

Query: 121 REALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFD 180
           REALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFD
Sbjct: 121 REALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFD 180

Query: 181 VIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNT 240
           VI GDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNT
Sbjct: 181 VIVGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNT 240

Query: 241 IKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFL 300
           IKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFL
Sbjct: 241 IKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGASFL 300

Query: 301 SSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH 339
           SSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH
Sbjct: 301 SSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNNSH 339

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|380863128|gb|AFF18857.1| spermidine synthase, partial [Dimocarpus longan] Back     alignment and taxonomy information
>gi|255550143|ref|XP_002516122.1| Spermidine synthase, putative [Ricinus communis] gi|223544608|gb|EEF46124.1| Spermidine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225429646|ref|XP_002281111.1| PREDICTED: thermospermine synthase ACAULIS5 [Vitis vinifera] gi|296081702|emb|CBI20707.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224088768|ref|XP_002308531.1| predicted protein [Populus trichocarpa] gi|222854507|gb|EEE92054.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297812137|ref|XP_002873952.1| spermine synthase [Arabidopsis lyrata subsp. lyrata] gi|297319789|gb|EFH50211.1| spermine synthase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18150168|dbj|BAB83654.1| spermine synthase [Arabidopsis halleri subsp. gemmifera] Back     alignment and taxonomy information
>gi|18150158|dbj|BAB83649.1| spermine synthase [Arabidopsis thaliana] gi|18150160|dbj|BAB83650.1| spermine synthase [Arabidopsis thaliana] gi|18150162|dbj|BAB83651.1| spermine synthase [Arabidopsis thaliana] gi|18150164|dbj|BAB83652.1| spermine synthase [Arabidopsis thaliana] gi|18150166|dbj|BAB83653.1| spermine synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18419941|ref|NP_568376.1| Thermospermine synthase ACAULIS5 [Arabidopsis thaliana] gi|75198278|sp|Q9S7X6.1|ACL5_ARATH RecName: Full=Thermospermine synthase ACAULIS5 gi|6013267|gb|AAF01311.1|AF184093_1 spermine synthase [Arabidopsis thaliana] gi|6013269|gb|AAF01312.1|AF184094_1 spermine synthase [Arabidopsis thaliana] gi|18150126|dbj|BAB83633.1| spermine synthase [Arabidopsis thaliana] gi|18150128|dbj|BAB83634.1| spermine synthase [Arabidopsis thaliana] gi|18150130|dbj|BAB83635.1| spermine synthase [Arabidopsis thaliana] gi|18150132|dbj|BAB83636.1| spermine synthase [Arabidopsis thaliana] gi|18150134|dbj|BAB83637.1| spermine synthase [Arabidopsis thaliana] gi|18150136|dbj|BAB83638.1| spermine synthase [Arabidopsis thaliana] gi|18150138|dbj|BAB83639.1| spermine synthase [Arabidopsis thaliana] gi|18150140|dbj|BAB83640.1| spermine synthase [Arabidopsis thaliana] gi|18150142|dbj|BAB83641.1| spermine synthase [Arabidopsis thaliana] gi|18150144|dbj|BAB83642.1| spermine synthase [Arabidopsis thaliana] gi|18150146|dbj|BAB83643.1| spermine synthase [Arabidopsis thaliana] gi|18150148|dbj|BAB83644.1| spermine synthase [Arabidopsis thaliana] gi|18150152|dbj|BAB83646.1| spermine synthase [Arabidopsis thaliana] gi|21593510|gb|AAM65477.1| spermine synthase (ACL5) [Arabidopsis thaliana] gi|22022544|gb|AAM83230.1| AT5g19530/T20D1_50 [Arabidopsis thaliana] gi|25090266|gb|AAN72265.1| At5g19530/T20D1_50 [Arabidopsis thaliana] gi|332005338|gb|AED92721.1| Thermospermine synthase ACAULIS5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356552394|ref|XP_003544553.1| PREDICTED: thermospermine synthase ACAULIS5-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
TAIR|locus:2180816339 ACL5 "ACAULIS 5" [Arabidopsis 0.991 0.991 0.764 2.3e-142
TIGR_CMR|BA_5619275 BA_5619 "spermidine synthase" 0.758 0.934 0.322 7.8e-39
UNIPROTKB|P09158288 speE "SpeE" [Escherichia coli 0.716 0.843 0.351 3e-37
DICTYBASE|DDB_G0268630284 spsA "Spermidine synthase" [Di 0.749 0.894 0.325 2.1e-36
FB|FBgn0037723299 SpdS "Spermidine Synthase" [Dr 0.710 0.806 0.357 1.9e-35
POMBASE|SPBC12C2.07c298 SPBC12C2.07c "spermidine synth 0.769 0.875 0.316 3.1e-35
TIGR_CMR|CHY_1240273 CHY_1240 "spermidine synthase" 0.648 0.805 0.324 5.1e-35
MGI|MGI:102690302 Srm "spermidine synthase" [Mus 0.755 0.847 0.329 5.1e-35
TIGR_CMR|CHY_1621277 CHY_1621 "spermidine synthase" 0.710 0.870 0.312 6.5e-35
RGD|620796302 Srm "spermidine synthase" [Rat 0.755 0.847 0.325 6.5e-35
TAIR|locus:2180816 ACL5 "ACAULIS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1392 (495.1 bits), Expect = 2.3e-142, P = 2.3e-142
 Identities = 259/339 (76%), Positives = 293/339 (86%)

Query:     1 MGTEAVEILFENGFSKVCNDTDPN--INGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTS 58
             MG EAVE++F NGF ++   T P   ++ N QDC W+EE IDDDLKWSFALN VLH+GTS
Sbjct:     1 MG-EAVEVMFGNGFPEIHKATSPTQTLHSNQQDCHWYEETIDDDLKWSFALNSVLHQGTS 59

Query:    59 EFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGS 118
             E+QDIALLDTKRFGKVLVIDGKMQSAE DEFIYHECLIHP LL H NPKTVFIMGGGEGS
Sbjct:    60 EYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPNPKTVFIMGGGEGS 119

Query:   119 AAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEK 178
             AARE LKH ++EKVVMCDIDQEVVDFCRRFLTVN +AFC+KKL LV+ DAKAELEKR EK
Sbjct:   120 AAREILKHTTIEKVVMCDIDQEVVDFCRRFLTVNSDAFCNKKLELVIKDAKAELEKREEK 179

Query:   179 FDVIFGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIY 238
             FD+I GDLADPVEGGPCYQLYTKSFY+ ILKPKL+ NGIFVTQAGPAGIFTHKEVF+SIY
Sbjct:   180 FDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIFVTQAGPAGIFTHKEVFTSIY 239

Query:   239 NTIKQVFKHVVAYTAHVPSFADTWGWVMASDQPFSINAEEIDNRIKSRINAELLYLNGAS 298
             NT+KQVFK+V AYTAHVPSFADTWGWVMASD  F +  +E+D RI+ R+N EL+YLN  S
Sbjct:   240 NTMKQVFKYVKAYTAHVPSFADTWGWVMASDHEFDVEVDEMDRRIEERVNGELMYLNAPS 299

Query:   299 FLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNN 337
             F+S+ T+NK + L+L  ET VY+EE+ARFIHGHGVAY +
Sbjct:   300 FVSAATLNKTISLALEKETEVYSEENARFIHGHGVAYRH 338
GO:0003824 "catalytic activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0016768 "spermine synthase activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=TAS
GO:0009926 "auxin polar transport" evidence=RCA;IMP
GO:0010087 "phloem or xylem histogenesis" evidence=IMP
GO:0010487 "thermospermine synthase activity" evidence=IDA
GO:0048759 "vessel member cell differentiation" evidence=IMP
GO:0000271 "polysaccharide biosynthetic process" evidence=RCA
GO:0007389 "pattern specification process" evidence=RCA
GO:0008361 "regulation of cell size" evidence=RCA
GO:0009825 "multidimensional cell growth" evidence=RCA
GO:0009932 "cell tip growth" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010015 "root morphogenesis" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0010817 "regulation of hormone levels" evidence=RCA
GO:0040007 "growth" evidence=RCA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=RCA
GO:0048765 "root hair cell differentiation" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
GO:0009826 "unidimensional cell growth" evidence=IGI
TIGR_CMR|BA_5619 BA_5619 "spermidine synthase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P09158 speE "SpeE" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0268630 spsA "Spermidine synthase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0037723 SpdS "Spermidine Synthase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPBC12C2.07c SPBC12C2.07c "spermidine synthase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1240 CHY_1240 "spermidine synthase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
MGI|MGI:102690 Srm "spermidine synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1621 CHY_1621 "spermidine synthase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
RGD|620796 Srm "spermidine synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5SK28SPEE_THET82, ., 5, ., 1, ., 1, 60.39650.83480.9012yesno
C3NHE1SPEE_SULIN2, ., 5, ., 1, ., 1, 60.39000.81710.9202yesno
Q9S7X6ACL5_ARATH2, ., 5, ., 1, ., 7, 90.76400.99110.9911yesno
Q975S5SPEE_SULTO2, ., 5, ., 1, ., 1, 60.41070.80230.9066yesno
C3MVE5SPEE_SULIM2, ., 5, ., 1, ., 1, 60.39360.81710.9202yesno
C3NEA8SPEE_SULIY2, ., 5, ., 1, ., 1, 60.39360.81710.9202yesno
A6T4R6SPEE_KLEP72, ., 5, ., 1, ., 1, 60.32520.82300.9755yesno
B5Y1R1SPEE_KLEP32, ., 5, ., 1, ., 1, 60.31830.82300.9755yesno
Q72K55SPEE_THET22, ., 5, ., 1, ., 1, 60.39650.83480.9012yesno
C4KHC0SPEE_SULIK2, ., 5, ., 1, ., 1, 60.39360.81710.9202yesno
Q4JAZ8SPEE_SULAC2, ., 5, ., 1, ., 1, 60.40350.80820.9072yesno
O66473SPEE1_AQUAE2, ., 5, ., 1, ., 1, 60.31200.80530.975yesno
Q2JQ57SPEE_SYNJB2, ., 5, ., 1, ., 1, 60.34760.83180.9038yesno
Q9YE02SPEE_AERPE2, ., 5, ., 1, ., 1, 60.39400.86430.9331yesno
Q9UXE4SPEE_SULSO2, ., 5, ., 1, ., 1, 60.40780.81710.9202yesno
C3MQ26SPEE_SULIL2, ., 5, ., 1, ., 1, 60.39360.81710.9202yesno
C3N5P4SPEE_SULIA2, ., 5, ., 1, ., 1, 60.39360.81710.9202yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.790.979
4th Layer2.5.1.16LOW CONFIDENCE prediction!
3rd Layer2.5.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032257001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (336 aa)
(Vitis vinifera)
Predicted Functional Partners:
SAMDC
SubName- Full=Putative uncharacterized protein (Chromosome chr14 scaffold_9, whole genome shotg [...] (360 aa)
     •• 0.922
pVvSAMDC
SubName- Full=Chromosome chr1 scaffold_22, whole genome shotgun sequence; (360 aa)
     •• 0.922
GSVIVG00019871001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (350 aa)
     •• 0.916
GSVIVG00017121001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (387 aa)
     •• 0.914
grip58
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (265 aa)
     •• 0.911
GSVIVG00016806001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (496 aa)
•    •• 0.906
GSVIVG00026899001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (474 aa)
     •  0.899
GSVIVG00016601001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (445 aa)
     •  0.899
ACS1
SubName- Full=Putative uncharacterized protein (Chromosome undetermined scaffold_1179, whole ge [...] (469 aa)
     •  0.899
GSVIVG00026399001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (348 aa)
•     • 0.541

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
PLN02823336 PLN02823, PLN02823, spermine synthase 0.0
PRK00811283 PRK00811, PRK00811, spermidine synthase; Provision 5e-88
COG0421282 COG0421, SpeE, Spermidine synthase [Amino acid tra 3e-73
TIGR00417271 TIGR00417, speE, spermidine synthase 5e-70
pfam01564240 pfam01564, Spermine_synth, Spermine/spermidine syn 5e-67
PRK03612521 PRK03612, PRK03612, spermidine synthase; Provision 4e-53
PLN02366308 PLN02366, PLN02366, spermidine synthase 1e-45
COG4262508 COG4262, COG4262, Predicted spermidine synthase wi 9e-43
PRK01581374 PRK01581, speE, spermidine synthase; Validated 4e-34
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 2e-06
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 3e-06
PRK00536262 PRK00536, speE, spermidine synthase; Provisional 1e-04
PRK04457262 PRK04457, PRK04457, spermidine synthase; Provision 0.002
>gnl|CDD|178418 PLN02823, PLN02823, spermine synthase Back     alignment and domain information 
 Score =  637 bits (1646), Expect = 0.0
 Identities = 243/336 (72%), Positives = 280/336 (83%), Gaps = 3/336 (0%)

Query: 5   AVEILFENGFSKVCNDTDPNING--NLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQD 62
           AVEI+  NG S +     P      N     W+EE I+DDL+WS+A+N VLH GTSEFQD
Sbjct: 1   AVEIVHGNGTSHITAVATPTAALASNYAKSLWYEEEIEDDLRWSYAVNSVLHTGTSEFQD 60

Query: 63  IALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAARE 122
           IAL+DTK FGKVL+IDGKMQSAE DEF+YHE L+HP LL H NPKTVFIMGGGEGS ARE
Sbjct: 61  IALVDTKPFGKVLIIDGKMQSAEADEFVYHESLVHPALLHHPNPKTVFIMGGGEGSTARE 120

Query: 123 ALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLNLVVNDAKAELEKRNEKFDVI 182
            L+HK++EKVVMCDIDQEVVDFCR+ LTVN+EAFC K+L L++NDA+AELEKR+EKFDVI
Sbjct: 121 VLRHKTVEKVVMCDIDQEVVDFCRKHLTVNREAFCDKRLELIINDARAELEKRDEKFDVI 180

Query: 183 FGDLADPVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIK 242
            GDLADPVEGGPCYQLYTKSFYERI+KPKLN  GIFVTQAGPAGI THKEVFSSIYNT++
Sbjct: 181 IGDLADPVEGGPCYQLYTKSFYERIVKPKLNPGGIFVTQAGPAGILTHKEVFSSIYNTLR 240

Query: 243 QVFKHVVAYTAHVPSFADTWGWVMASDQPFS-INAEEIDNRIKSRINAELLYLNGASFLS 301
           QVFK+VV YTAHVPSFADTWGWVMASD PF+ ++AEE+D+RIK RI+ EL YL+G +F S
Sbjct: 241 QVFKYVVPYTAHVPSFADTWGWVMASDHPFADLSAEELDSRIKERIDGELKYLDGETFSS 300

Query: 302 STTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYNN 337
           +  +NK V  +L NETHVYTEE+ARFIHGHG A   
Sbjct: 301 AFALNKTVRQALANETHVYTEENARFIHGHGTAAKA 336

Length = 336
>gnl|CDD|234843 PRK00811, PRK00811, spermidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|223498 COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|188048 TIGR00417, speE, spermidine synthase Back     alignment and domain information
>gnl|CDD|216573 pfam01564, Spermine_synth, Spermine/spermidine synthase Back     alignment and domain information
>gnl|CDD|235139 PRK03612, PRK03612, spermidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|215208 PLN02366, PLN02366, spermidine synthase Back     alignment and domain information
>gnl|CDD|226713 COG4262, COG4262, Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|234961 PRK01581, speE, spermidine synthase; Validated Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|134311 PRK00536, speE, spermidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|179854 PRK04457, PRK04457, spermidine synthase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
PLN02823336 spermine synthase 100.0
PRK00536262 speE spermidine synthase; Provisional 100.0
PLN02366308 spermidine synthase 100.0
PRK00811283 spermidine synthase; Provisional 100.0
COG0421282 SpeE Spermidine synthase [Amino acid transport and 100.0
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 100.0
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 100.0
PRK03612521 spermidine synthase; Provisional 100.0
PRK01581374 speE spermidine synthase; Validated 100.0
KOG1562337 consensus Spermidine synthase [Amino acid transpor 100.0
COG4262508 Predicted spermidine synthase with an N-terminal m 100.0
PRK04457262 spermidine synthase; Provisional 99.97
COG2521287 Predicted archaeal methyltransferase [General func 99.71
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.58
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.49
COG4123248 Predicted O-methyltransferase [General function pr 99.46
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.44
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.44
COG4122219 Predicted O-methyltransferase [General function pr 99.41
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.4
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.4
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.4
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.39
PLN02476278 O-methyltransferase 99.37
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.35
KOG2352482 consensus Predicted spermine/spermidine synthase [ 99.35
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.35
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.35
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.35
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.33
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.33
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.33
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.32
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.31
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.3
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.3
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.3
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.29
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.29
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.29
COG2890280 HemK Methylase of polypeptide chain release factor 99.27
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.26
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.26
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.26
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.25
PRK07402196 precorrin-6B methylase; Provisional 99.24
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.22
PLN02589247 caffeoyl-CoA O-methyltransferase 99.22
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.22
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.21
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.2
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.19
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.19
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.19
PRK14967223 putative methyltransferase; Provisional 99.19
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.18
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.18
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.17
PLN02672 1082 methionine S-methyltransferase 99.17
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.16
PLN03075296 nicotianamine synthase; Provisional 99.16
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.15
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.14
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.14
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.14
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.13
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.13
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.13
PRK14902444 16S rRNA methyltransferase B; Provisional 99.13
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.13
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.13
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.12
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.12
PLN02244340 tocopherol O-methyltransferase 99.11
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.1
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.09
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.09
PRK04266226 fibrillarin; Provisional 99.09
PLN02233261 ubiquinone biosynthesis methyltransferase 99.09
PRK11207197 tellurite resistance protein TehB; Provisional 99.08
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.08
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.08
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.07
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 99.07
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.07
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.06
PRK10901427 16S rRNA methyltransferase B; Provisional 99.06
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.05
TIGR00438188 rrmJ cell division protein FtsJ. 99.04
PRK14903431 16S rRNA methyltransferase B; Provisional 99.04
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.04
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.02
PHA03411279 putative methyltransferase; Provisional 99.02
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.02
PRK14904445 16S rRNA methyltransferase B; Provisional 99.02
PRK14968188 putative methyltransferase; Provisional 99.01
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.0
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.0
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.99
PRK14901434 16S rRNA methyltransferase B; Provisional 98.99
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.99
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.99
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.98
PHA03412241 putative methyltransferase; Provisional 98.97
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.97
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.96
PTZ00146293 fibrillarin; Provisional 98.95
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.94
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.94
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.93
PRK12335287 tellurite resistance protein TehB; Provisional 98.92
PLN02336475 phosphoethanolamine N-methyltransferase 98.91
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.91
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.91
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.91
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.91
PRK08317241 hypothetical protein; Provisional 98.91
PRK06922677 hypothetical protein; Provisional 98.91
PLN02490340 MPBQ/MSBQ methyltransferase 98.9
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.9
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.89
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.89
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.88
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.88
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.87
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.87
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.86
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.86
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.86
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.86
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.84
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.84
KOG1271227 consensus Methyltransferases [General function pre 98.82
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.82
TIGR00452314 methyltransferase, putative. Known examples to dat 98.82
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.82
KOG2899288 consensus Predicted methyltransferase [General fun 98.81
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.81
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.8
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.8
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.75
KOG2904328 consensus Predicted methyltransferase [General fun 98.74
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.74
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.73
TIGR03438301 probable methyltransferase. This model represents 98.72
PLN02336 475 phosphoethanolamine N-methyltransferase 98.72
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.7
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.7
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.69
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.68
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.68
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.67
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.64
KOG4300252 consensus Predicted methyltransferase [General fun 98.64
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.63
PRK05785226 hypothetical protein; Provisional 98.62
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.6
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.59
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.56
PRK06202232 hypothetical protein; Provisional 98.56
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.55
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.54
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.52
KOG3010261 consensus Methyltransferase [General function pred 98.52
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.51
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.48
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.46
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.46
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.46
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.44
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.43
COG2520341 Predicted methyltransferase [General function pred 98.42
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 98.42
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.35
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.35
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 98.32
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.31
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.28
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.26
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.26
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.24
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.22
COG1041347 Predicted DNA modification methylase [DNA replicat 98.22
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.2
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.19
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.19
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.18
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.12
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.11
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.1
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.1
PRK10742250 putative methyltransferase; Provisional 98.08
KOG1499346 consensus Protein arginine N-methyltransferase PRM 98.06
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 98.06
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.02
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.97
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.97
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.96
KOG2940325 consensus Predicted methyltransferase [General fun 97.96
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.94
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.93
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 97.93
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.92
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.85
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.85
KOG3420185 consensus Predicted RNA methylase [Translation, ri 97.83
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.83
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.82
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 97.81
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.8
KOG1709271 consensus Guanidinoacetate methyltransferase and r 97.79
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 97.78
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.77
PLN02232160 ubiquinone biosynthesis methyltransferase 97.71
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 97.68
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.68
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.67
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 97.67
COG4076252 Predicted RNA methylase [General function predicti 97.67
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.58
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.57
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.56
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.5
PRK04148134 hypothetical protein; Provisional 97.45
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.44
KOG2361264 consensus Predicted methyltransferase [General fun 97.36
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.26
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.25
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.21
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.13
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.12
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.1
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.06
KOG2730263 consensus Methylase [General function prediction o 97.05
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 97.03
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.02
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 96.97
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 96.92
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 96.91
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.87
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.78
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.65
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 96.65
KOG1562337 consensus Spermidine synthase [Amino acid transpor 96.59
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 96.53
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 96.52
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 96.42
COG2384226 Predicted SAM-dependent methyltransferase [General 96.39
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 96.33
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 96.24
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 96.24
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 96.14
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 96.1
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.03
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 96.0
COG4121252 Uncharacterized conserved protein [Function unknow 95.98
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 95.95
PF13679141 Methyltransf_32: Methyltransferase domain 95.91
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 95.91
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.89
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.87
COG0286489 HsdM Type I restriction-modification system methyl 95.74
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 95.74
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 95.71
KOG3201201 consensus Uncharacterized conserved protein [Funct 95.7
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 95.68
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 95.66
PTZ00357 1072 methyltransferase; Provisional 95.62
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 95.6
COG1568354 Predicted methyltransferases [General function pre 95.52
COG3897218 Predicted methyltransferase [General function pred 95.51
PRK11524284 putative methyltransferase; Provisional 95.33
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 95.3
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 95.28
PHA01634156 hypothetical protein 95.25
KOG3115249 consensus Methyltransferase-like protein [General 95.22
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.21
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 95.14
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 94.92
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 94.89
KOG3045325 consensus Predicted RNA methylase involved in rRNA 94.65
TIGR00675315 dcm DNA-methyltransferase (dcm). All proteins in t 94.58
PRK09880343 L-idonate 5-dehydrogenase; Provisional 94.57
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 94.51
KOG4058199 consensus Uncharacterized conserved protein [Funct 94.44
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 94.19
PRK07502307 cyclohexadienyl dehydrogenase; Validated 94.1
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 93.83
PF14314675 Methyltrans_Mon: Virus-capping methyltransferase 93.77
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 93.72
PRK13699227 putative methylase; Provisional 93.64
PRK10637 457 cysG siroheme synthase; Provisional 93.56
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 93.3
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 93.28
KOG1501 636 consensus Arginine N-methyltransferase [General fu 93.25
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 93.18
KOG0821326 consensus Predicted ribosomal RNA adenine dimethyl 93.04
KOG3987288 consensus Uncharacterized conserved protein DREV/C 93.03
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 92.77
KOG2078495 consensus tRNA modification enzyme [RNA processing 92.7
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 92.6
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 92.6
PF06460299 NSP13: Coronavirus NSP13; InterPro: IPR009461 This 92.52
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 92.44
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 92.42
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 92.38
KOG2198375 consensus tRNA cytosine-5-methylases and related e 92.38
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 92.36
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 92.27
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 92.26
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 92.19
PF12692160 Methyltransf_17: S-adenosyl-L-methionine methyltra 91.85
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 91.78
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.68
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 91.54
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 91.48
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.4
PLN02353 473 probable UDP-glucose 6-dehydrogenase 91.25
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 91.15
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 91.15
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 91.03
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 90.99
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.98
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.8
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 90.72
PF03269177 DUF268: Caenorhabditis protein of unknown function 90.37
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 90.32
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 90.22
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 90.19
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.18
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 90.17
PLN02740381 Alcohol dehydrogenase-like 90.16
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 90.07
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 89.89
COG2961279 ComJ Protein involved in catabolism of external DN 89.88
PRK11524284 putative methyltransferase; Provisional 89.87
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 89.79
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 89.63
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.53
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 89.4
PRK08328231 hypothetical protein; Provisional 89.25
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.21
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.07
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 88.9
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 88.89
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 88.81
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 88.74
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 88.65
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 88.56
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 88.51
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 88.42
PRK06719157 precorrin-2 dehydrogenase; Validated 88.24
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 88.23
COG0270328 Dcm Site-specific DNA methylase [DNA replication, 88.12
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 88.1
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 87.99
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 87.83
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 87.83
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 87.79
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 87.78
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 87.73
PRK03562621 glutathione-regulated potassium-efflux system prot 87.66
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 87.63
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 87.6
PRK07340304 ornithine cyclodeaminase; Validated 87.56
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 87.51
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 87.5
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 87.31
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 86.93
PRK15116268 sulfur acceptor protein CsdL; Provisional 86.84
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 86.76
PLN02827378 Alcohol dehydrogenase-like 86.74
PRK12549284 shikimate 5-dehydrogenase; Reviewed 86.69
PLN02494477 adenosylhomocysteinase 86.53
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 86.34
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 86.2
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 86.12
COG4017254 Uncharacterized protein conserved in archaea [Func 86.09
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 85.97
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 85.93
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 85.93
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.64
KOG1099294 consensus SAM-dependent methyltransferase/cell div 85.59
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 85.39
PRK06718202 precorrin-2 dehydrogenase; Reviewed 85.27
COG0569225 TrkA K+ transport systems, NAD-binding component [ 85.26
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 85.2
PRK09496453 trkA potassium transporter peripheral membrane com 85.17
PRK10458 467 DNA cytosine methylase; Provisional 85.16
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 85.13
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.09
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 85.06
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 84.95
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 84.92
KOG2671421 consensus Putative RNA methylase [Replication, rec 84.7
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 84.7
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 84.67
PRK13699227 putative methylase; Provisional 84.47
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 84.41
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 84.01
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 83.99
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 83.9
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 83.9
PRK05600370 thiamine biosynthesis protein ThiF; Validated 83.8
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 83.69
TIGR00497501 hsdM type I restriction system adenine methylase ( 83.63
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 83.5
PRK08618325 ornithine cyclodeaminase; Validated 83.48
PRK06141314 ornithine cyclodeaminase; Validated 83.36
PRK12921305 2-dehydropantoate 2-reductase; Provisional 83.3
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 83.15
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 83.1
PLN02256304 arogenate dehydrogenase 83.02
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 82.96
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 82.92
PRK14027283 quinate/shikimate dehydrogenase; Provisional 82.89
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 82.76
COG1565370 Uncharacterized conserved protein [Function unknow 82.2
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 82.17
cd01483143 E1_enzyme_family Superfamily of activating enzymes 82.0
COG5379 414 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3 81.97
PRK15076 431 alpha-galactosidase; Provisional 81.9
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 81.83
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 81.74
PRK06046326 alanine dehydrogenase; Validated 81.72
PRK07417279 arogenate dehydrogenase; Reviewed 81.7
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 81.68
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 81.67
PRK08306296 dipicolinate synthase subunit A; Reviewed 81.46
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 81.45
KOG1227351 consensus Putative methyltransferase [General func 81.44
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 81.43
PF06690252 DUF1188: Protein of unknown function (DUF1188); In 81.41
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 81.23
PRK07589346 ornithine cyclodeaminase; Validated 80.88
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 80.83
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 80.78
PTZ00117319 malate dehydrogenase; Provisional 80.73
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 80.5
PTZ00082321 L-lactate dehydrogenase; Provisional 80.45
PRK11730 715 fadB multifunctional fatty acid oxidation complex 80.18
PRK10083339 putative oxidoreductase; Provisional 80.06
>PLN02823 spermine synthase Back     alignment and domain information 
Probab=100.00  E-value=1.7e-63  Score=477.27  Aligned_cols=330  Identities=73%  Similarity=1.193  Sum_probs=297.9

Q ss_pred             ceeheeccCcccccCCCCCCC--CCCccCCCeEEEEeCcccceeeeeceEEEeeecCCceEEEEEeCCceEEEEEcCeee
Q 019550            5 AVEILFENGFSKVCNDTDPNI--NGNLQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQ   82 (339)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~w~~e~~~~~~~~~~~~~~vl~~~~s~~q~I~V~e~~~~g~~L~ldG~~q   82 (339)
                      ||||.--||-|....-..|.-  ..++..+.|++|...++.++.++++++|++++|+||+|+|++++.+|++|++||..|
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~e~~~~~~~~~~~~~~vl~~~~S~yQ~I~V~~~~~~g~~L~lDg~~q   80 (336)
T PLN02823          1 AVEIVHGNGTSHITAVATPTAALASNYAKSLWYEEEIEDDLRWSYAVNSVLHTGTSEFQDIALVDTKPFGKVLIIDGKMQ   80 (336)
T ss_pred             CCceeccCCcccccCCCCcccccccccccCeeEeeccCCCcceEEEeccEEEeccCCCeEEEEEECCCCceEEEECCccc
Confidence            789999999988765544432  233447789999999999999999999999999999999999999999999999999


Q ss_pred             ccccChhhHHHHHhhhhcccCCCCCeEEEEecchhHHHHHHHhcCCCCEEEEEEcCHHHHHHHHHhhhhhccccCCCCeE
Q 019550           83 SAEVDEFIYHECLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTVNQEAFCSKKLN  162 (339)
Q Consensus        83 ~~~~d~~~Y~e~l~~~~l~~~~~p~~VL~IG~G~G~~~~~l~~~~~~~~v~~VEid~~vi~~ar~~f~~~~~~~~~~rv~  162 (339)
                      +++.|++.|||+|+|++++.|++|++||+||+|+|+++++++++.+..+|++|||||+|+++||++|+.+...+++||++
T Consensus        81 s~~~de~~YhE~l~h~~l~~~~~pk~VLiiGgG~G~~~re~l~~~~~~~v~~VEiD~~vv~lar~~~~~~~~~~~dprv~  160 (336)
T PLN02823         81 SAEADEFVYHESLVHPALLHHPNPKTVFIMGGGEGSTAREVLRHKTVEKVVMCDIDQEVVDFCRKHLTVNREAFCDKRLE  160 (336)
T ss_pred             cccchHHHHHHHHHhHHHhhCCCCCEEEEECCCchHHHHHHHhCCCCCeEEEEECCHHHHHHHHHhcccccccccCCceE
Confidence            99999999999999999999999999999999999999999999888999999999999999999998766667899999


Q ss_pred             EEEccHHHHHHhcCCceeEEEecCCCCCCCCccccCCcHHHHH-HHHccccCCCcEEEEecCCCCccCchhhHHHHHHHH
Q 019550          163 LVVNDAKAELEKRNEKFDVIFGDLADPVEGGPCYQLYTKSFYE-RILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTI  241 (339)
Q Consensus       163 v~~~D~~~~l~~~~~~yDvIi~D~~d~~~~~p~~~L~t~ef~~-~~~~~~L~~gGilv~~~~~~~~~~~~~~~~~i~~~l  241 (339)
                      ++++||++||+..+++||+|++|++||...+|+..|||.|||+ . ++++|+|||++++|.+++..+...+.+..+.+++
T Consensus       161 v~~~Da~~~L~~~~~~yDvIi~D~~dp~~~~~~~~Lyt~eF~~~~-~~~~L~p~Gvlv~q~~s~~~~~~~~~~~~i~~tl  239 (336)
T PLN02823        161 LIINDARAELEKRDEKFDVIIGDLADPVEGGPCYQLYTKSFYERI-VKPKLNPGGIFVTQAGPAGILTHKEVFSSIYNTL  239 (336)
T ss_pred             EEEChhHHHHhhCCCCccEEEecCCCccccCcchhhccHHHHHHH-HHHhcCCCcEEEEeccCcchhccHHHHHHHHHHH
Confidence            9999999999887889999999999987656778899999998 8 7999999999999988764445567889999999


Q ss_pred             HhHCCceEEEEEeecccCCceeEEEEecCCCC-CCHHHHHHHHHhcCcccccccCHHhhHHhccCCHHHHHhhcCCCccc
Q 019550          242 KQVFKHVVAYTAHVPSFADTWGWVMASDQPFS-INAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVY  320 (339)
Q Consensus       242 ~~~F~~v~~~~~~iP~~~~~~~~~~as~~p~~-~~~~~l~~r~~~~~~~~~~yy~~~~h~~~f~lp~~~~~~~~~~~~~~  320 (339)
                      +++|++|.+|.+.+|+|++.|+|++||+.|.. ++.+.+.+|+.++...++||||+++|.++|+||+++++.|..+.+|+
T Consensus       240 ~~vF~~v~~y~~~vPsf~~~w~f~~aS~~~~~~~~~~~~~~~~~~~~~~~lryy~~~~h~a~F~lP~~~~~~l~~~~~v~  319 (336)
T PLN02823        240 RQVFKYVVPYTAHVPSFADTWGWVMASDHPFADLSAEELDSRIKERIDGELKYLDGETFSSAFALNKTVRQALANETHVY  319 (336)
T ss_pred             HHhCCCEEEEEeecCCCCCceEEEEEeCCccccCChhHHHHhhhhcccCCCeEECHHHHHHHccCcHHHHHhhcCCCCce
Confidence            99999999999999999888999999998753 78888888887654346999999999999999999999999999999


Q ss_pred             ccccccccccccccc
Q 019550          321 TEEDARFIHGHGVAY  335 (339)
Q Consensus       321 t~~~~~~~~~~~~~~  335 (339)
                      |+++|+++..+|-+-
T Consensus       320 t~~~p~~~~~~~~~~  334 (336)
T PLN02823        320 TEENARFIHGHGTAA  334 (336)
T ss_pred             ecCCCeeecCccccc
Confidence            999999999888653

>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG4121 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>PF14314 Methyltrans_Mon: Virus-capping methyltransferase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0821 consensus Predicted ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PF12692 Methyltransf_17: S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>COG4017 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>COG5379 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism] Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PF06690 DUF1188: Protein of unknown function (DUF1188); InterPro: IPR009573 This family consists of several hypothetical archaeal proteins of around 260 residues in length, which seem to be specific to Methanobacterium, Methanococcus and Methanopyrus species Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
3anx_A314 Crystal Structure Of TriamineAGMATINE AMINOPROPYLTR 5e-55
1uir_A314 Crystal Structure Of Polyamine Aminopropyltransfeas 2e-54
3o4f_A294 Crystal Structure Of Spermidine Synthase From E. Co 2e-38
2o05_A304 Human Spermidine Synthase Length = 304 3e-34
3rw9_A304 Crystal Structure Of Human Spermidine Synthase In C 3e-34
1mjf_A281 Putative Spermidine Synthetase From Pyrococcus Furi 4e-34
1iy9_A275 Crystal Structure Of Spermidine Synthase Length = 2 3e-33
1xj5_A334 X-Ray Structure Of Spermidine Synthase From Arabido 7e-33
1jq3_A296 Crystal Structure Of Spermidine Synthase In Complex 1e-32
2b2c_A314 Cloning, Expression, Characterisation And Three- Di 9e-31
2e5w_A280 Crystal Structure Of Spermidine Synthase From Pyroc 2e-28
2pwp_A282 Crystal Structure Of Spermidine Synthase From Plasm 9e-27
2hte_A283 The Crystal Structure Of Spermidine Synthase From P 9e-27
2pss_A321 The Structure Of Plasmodium Falciparum Spermidine S 1e-26
3bwb_A304 Crystal Structure Of The Apo Form Of Spermidine Syn 1e-22
3c6k_A381 Crystal Structure Of Human Spermine Synthase In Com 6e-04
>pdb|3ANX|A Chain A, Crystal Structure Of TriamineAGMATINE AMINOPROPYLTRANSFERASE (SPEE) From Thermus Thermophilus, Complexed With Mta Length = 314 Back     alignment and structure 
Iteration: 1

 Score =  211 bits (537), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 115/290 (39%), Positives = 174/290 (60%), Gaps = 7/290 (2%)
Query: 49  LNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKT 108
           + RV+  G + FQD  L ++K FGKVL++D  +QS E DE+IYHE L+HP +L H  PK 
Sbjct: 21  MERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR 80
Query: 109 VFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTV-NQEAFCSKKLNLVVND 167
           V I+GGGEG+  RE LKH ++EK VM DID E+V+  +R +   +Q AF   +  LV++D
Sbjct: 81  VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDD 140
Query: 168 AKAELEKRNEKFDVIFGDLADPV-EGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAG 226
           A+A LE+  E++DV+  DL DPV E  P   LYT  FY R++K  LN  G+   QAG   
Sbjct: 141 ARAYLERTEERYDVVIIDLTDPVGEDNPARLLYTVEFY-RLVKAHLNPGGVMGMQAG-MI 198
Query: 227 IFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASD--QPFSINAEEIDNRIK 284
           + TH  V   ++ T+++ F++V +Y  H+P F   +G+++ASD   P + +   I+ RI+
Sbjct: 199 LLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAFDPAAFSEGVIEARIR 258
Query: 285 SRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVA 334
            R N  L +L      +   + K +  +L  ET V T+++  ++   G A
Sbjct: 259 ER-NLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEA 307
>pdb|1UIR|A Chain A, Crystal Structure Of Polyamine Aminopropyltransfease From Thermus Thermophilus Length = 314 Back     alignment and structure
>pdb|3O4F|A Chain A, Crystal Structure Of Spermidine Synthase From E. Coli Length = 294 Back     alignment and structure
>pdb|2O05|A Chain A, Human Spermidine Synthase Length = 304 Back     alignment and structure
>pdb|3RW9|A Chain A, Crystal Structure Of Human Spermidine Synthase In Complex With Decarboxylated S-Adenosylhomocysteine Length = 304 Back     alignment and structure
>pdb|1MJF|A Chain A, Putative Spermidine Synthetase From Pyrococcus Furiosus Pfu- 132382 Length = 281 Back     alignment and structure
>pdb|1IY9|A Chain A, Crystal Structure Of Spermidine Synthase Length = 275 Back     alignment and structure
>pdb|1XJ5|A Chain A, X-Ray Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 Length = 334 Back     alignment and structure
>pdb|1JQ3|A Chain A, Crystal Structure Of Spermidine Synthase In Complex With Transition State Analogue Adodato Length = 296 Back     alignment and structure
>pdb|2B2C|A Chain A, Cloning, Expression, Characterisation And Three- Dimensional Structure Determination Of The Caenorhabditis Elegans Spermidine Synthase Length = 314 Back     alignment and structure
>pdb|2E5W|A Chain A, Crystal Structure Of Spermidine Synthase From Pyrococcus Horikoshii Ot3 Length = 280 Back     alignment and structure
>pdb|2PWP|A Chain A, Crystal Structure Of Spermidine Synthase From Plasmodium Falciparum In Complex With Spermidine Length = 282 Back     alignment and structure
>pdb|2HTE|A Chain A, The Crystal Structure Of Spermidine Synthase From P. Falciparum In Complex With 5'-Methylthioadenosine Length = 283 Back     alignment and structure
>pdb|2PSS|A Chain A, The Structure Of Plasmodium Falciparum Spermidine Synthase In Its Apo- Form Length = 321 Back     alignment and structure
>pdb|3BWB|A Chain A, Crystal Structure Of The Apo Form Of Spermidine Synthase From Trypanosoma Cruzi At 2.5 A Resolution Length = 304 Back     alignment and structure
>pdb|3C6K|A Chain A, Crystal Structure Of Human Spermine Synthase In Complex With Spermidine And 5-Methylthioadenosine Length = 381 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 1e-132
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 1e-120
2i7c_A283 Spermidine synthase; transferase, structural genom 1e-119
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 1e-119
2pt6_A321 Spermidine synthase; transferase, structural genom 1e-119
2o07_A304 Spermidine synthase; structural genomics, structur 1e-119
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 1e-116
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 1e-116
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 1e-116
1xj5_A334 Spermidine synthase 1; structural genomics, protei 1e-111
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 1e-109
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 2e-89
2cmg_A262 Spermidine synthase; transferase, putrescine amino 6e-87
3gjy_A317 Spermidine synthase; APC62791, structural genomics 9e-40
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 2e-06
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 7e-06
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 1e-05
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 2e-05
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 2e-05
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 3e-05
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 3e-05
3duw_A223 OMT, O-methyltransferase, putative; alternating of 3e-05
2fpo_A202 Methylase YHHF; structural genomics, putative meth 4e-05
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 4e-05
2avd_A229 Catechol-O-methyltransferase; structural genomics, 6e-05
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 8e-05
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 1e-04
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 1e-04
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 4e-04
2esr_A177 Methyltransferase; structural genomics, hypothetic 5e-04
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Length = 314 Back     alignment and structure
 Score =  378 bits (972), Expect = e-132
 Identities = 115/305 (37%), Positives = 175/305 (57%), Gaps = 7/305 (2%)

Query: 34  WFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHE 93
           +F E +         + RV+  G + FQD  L ++K FGKVL++D  +QS E DE+IYHE
Sbjct: 6   YFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHE 65

Query: 94  CLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLT-VN 152
            L+HP +L H  PK V I+GGGEG+  RE LKH ++EK VM DID E+V+  +R +   +
Sbjct: 66  TLVHPAMLTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWH 125

Query: 153 QEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPV-EGGPCYQLYTKSFYERILKPK 211
           Q AF   +  LV++DA+A LE+  E++DV+  DL DPV E  P   LYT  FY   +K  
Sbjct: 126 QGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLTDPVGEDNPARLLYTVEFYRL-VKAH 184

Query: 212 LNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASD-- 269
           LN  G+   Q G   + TH  V   ++ T+++ F++V +Y  H+P F   +G+++ASD  
Sbjct: 185 LNPGGVMGMQTGMI-LLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAF 243

Query: 270 QPFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIH 329
            P + +   I+ RI+ R N  L +L      +   + K +  +L  ET V T+++  ++ 
Sbjct: 244 DPAAFSEGVIEARIRER-NLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVT 302

Query: 330 GHGVA 334
             G A
Sbjct: 303 PEGEA 307
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Length = 296 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Length = 283 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Length = 321 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Length = 304 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Length = 275 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Length = 314 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Length = 281 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Length = 334 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Length = 304 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Length = 262 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Length = 317 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Length = 248 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} Length = 225 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Length = 232 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Length = 223 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Length = 202 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Length = 232 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Length = 229 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Length = 242 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Length = 237 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Length = 233 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Length = 247 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 100.0
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 100.0
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 100.0
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 100.0
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 100.0
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 100.0
2i7c_A283 Spermidine synthase; transferase, structural genom 100.0
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 100.0
2o07_A304 Spermidine synthase; structural genomics, structur 100.0
2pt6_A321 Spermidine synthase; transferase, structural genom 100.0
2cmg_A262 Spermidine synthase; transferase, putrescine amino 100.0
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 100.0
1xj5_A334 Spermidine synthase 1; structural genomics, protei 100.0
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 100.0
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 100.0
3gjy_A317 Spermidine synthase; APC62791, structural genomics 100.0
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.57
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.57
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.56
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.56
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.54
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.53
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.52
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.51
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.51
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.49
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.49
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.48
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.47
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.47
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.46
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.45
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.45
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.44
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.44
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.43
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.43
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.43
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.43
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.42
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.41
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.41
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.4
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.4
3lpm_A259 Putative methyltransferase; structural genomics, p 99.39
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.38
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.38
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.38
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.37
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.37
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.37
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.37
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.36
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.35
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.35
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.34
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.34
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.34
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.34
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.34
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.32
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.32
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.32
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.31
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.31
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.31
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.3
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.29
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.28
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.28
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.27
3f4k_A257 Putative methyltransferase; structural genomics, P 99.26
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.26
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.26
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.26
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.26
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.26
3k6r_A278 Putative transferase PH0793; structural genomics, 99.25
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.25
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.25
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.25
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.25
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.25
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.25
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.24
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.24
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.24
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.24
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.24
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.23
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 99.23
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.23
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.23
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.23
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.22
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.21
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.2
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.2
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.2
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.2
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.2
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.19
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.19
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.19
2b25_A336 Hypothetical protein; structural genomics, methyl 99.18
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.18
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.18
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.18
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.17
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.17
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.17
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.17
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.16
3ocj_A305 Putative exported protein; structural genomics, PS 99.16
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.15
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.15
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.15
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.15
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.15
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.14
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.14
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.14
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.14
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.14
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.14
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.14
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.14
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.13
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.13
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.13
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.13
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.13
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.13
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.12
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.12
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.12
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.12
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.11
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.11
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.11
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.11
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.11
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.11
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.11
3lcc_A235 Putative methyl chloride transferase; halide methy 99.1
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.1
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.1
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.1
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.1
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.09
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.09
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.09
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.09
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.08
2h00_A254 Methyltransferase 10 domain containing protein; st 99.08
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.08
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.08
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.08
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.08
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.07
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.07
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.07
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.07
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.07
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.07
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.07
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.06
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.06
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.06
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.06
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.06
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.05
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.05
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.05
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.05
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.05
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.05
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.05
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.05
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.04
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.04
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.04
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.04
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.04
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.04
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.03
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.03
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.03
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.02
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.02
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.02
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 99.02
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.01
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.01
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.01
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.01
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.01
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.01
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.0
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.98
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.97
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.97
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.96
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.96
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.95
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.93
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.93
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.92
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 98.92
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.92
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.91
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.9
3cc8_A230 Putative methyltransferase; structural genomics, j 98.9
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.9
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.9
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.9
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.88
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.88
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.88
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.87
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.87
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.87
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.87
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.87
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.86
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.86
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.86
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.86
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.85
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.84
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.84
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.82
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.82
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.81
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.81
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.75
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.73
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.73
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.72
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.71
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.69
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.68
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.68
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.67
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.67
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.66
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.66
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.66
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.63
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.62
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.6
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.6
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.6
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.6
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.6
2oo3_A283 Protein involved in catabolism of external DNA; st 98.59
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.59
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.58
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.57
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.56
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.56
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.55
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.55
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.54
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.53
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.52
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.51
3khk_A544 Type I restriction-modification system methylation 98.5
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.5
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.49
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.46
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.43
3lkd_A542 Type I restriction-modification system methyltrans 98.4
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.39
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 98.34
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.34
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.32
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 98.31
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 98.29
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.29
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.27
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.2
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.19
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.15
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.01
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 97.96
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.95
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.89
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 97.87
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.81
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 97.67
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 97.53
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 97.4
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 97.35
3ufb_A530 Type I restriction-modification system methyltran 97.24
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 97.19
2px2_A269 Genome polyprotein [contains: capsid protein C (co 97.17
1i4w_A353 Mitochondrial replication protein MTF1; mitochondr 97.16
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 97.14
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 96.99
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 96.9
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 96.67
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 96.66
2zig_A297 TTHA0409, putative modification methylase; methylt 96.63
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 96.47
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 96.43
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.38
3ubt_Y331 Modification methylase HAEIII; protein-DNA complex 96.31
4h0n_A333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 96.31
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.29
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 96.27
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 96.17
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 95.98
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 95.96
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.91
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 95.77
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 95.74
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 95.69
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 95.63
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 95.5
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 95.42
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 95.42
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 95.41
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 95.28
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 95.26
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 95.23
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 95.23
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 95.22
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.18
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 95.17
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 95.16
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 95.15
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 95.14
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 95.11
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 95.04
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.9
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 94.86
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.8
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 94.79
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 94.75
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 94.72
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.58
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 94.54
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 94.43
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.42
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 94.41
3me5_A 482 Cytosine-specific methyltransferase; structural ge 94.38
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 94.33
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 94.32
2zig_A297 TTHA0409, putative modification methylase; methylt 94.28
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 94.26
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.15
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 94.06
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 93.84
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 93.77
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 93.68
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.63
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 93.58
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 93.58
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 93.58
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 93.49
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.35
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 93.34
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.34
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 93.24
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 93.2
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 93.2
4eye_A342 Probable oxidoreductase; structural genomics, niai 93.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 92.96
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.95
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.86
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.71
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.71
3gms_A340 Putative NADPH:quinone reductase; structural genom 92.49
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 92.39
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.38
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 91.93
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 91.91
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 91.88
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 91.63
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 91.62
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 91.57
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 91.56
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 91.56
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 91.26
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 90.97
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 90.9
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 90.85
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 90.81
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 90.42
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 90.39
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 90.34
3c85_A183 Putative glutathione-regulated potassium-efflux S 90.29
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 90.28
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 90.2
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 90.07
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 90.01
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 89.82
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 89.77
1lss_A140 TRK system potassium uptake protein TRKA homolog; 89.55
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 89.48
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 89.38
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 89.33
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 89.25
2hwk_A320 Helicase NSP2; rossman fold, alpha/beta/alpha, mul 89.03
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.02
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 89.01
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 88.81
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 88.79
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 88.43
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 88.24
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 88.18
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 88.13
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 88.02
1id1_A153 Putative potassium channel protein; RCK domain, E. 87.89
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 87.4
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 87.34
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 87.21
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 87.03
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 87.01
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 86.5
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 86.22
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 86.16
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 86.05
3krt_A456 Crotonyl COA reductase; structural genomics, prote 85.88
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 85.66
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 85.57
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 85.32
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 85.31
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 85.1
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 84.93
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 84.86
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 84.79
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 84.61
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 84.55
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 84.41
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 84.25
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 84.02
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 83.98
4dkj_A403 Cytosine-specific methyltransferase; CG-specificit 83.95
4g65_A461 TRK system potassium uptake protein TRKA; structur 83.86
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 83.38
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 83.36
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 83.35
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 83.17
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 83.03
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 82.86
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 82.67
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 82.64
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 82.53
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 82.48
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 82.29
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 82.03
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 81.9
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 81.8
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 81.7
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 81.43
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 80.86
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 80.82
2rir_A300 Dipicolinate synthase, A chain; structural genomic 80.54
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 80.42
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 80.39
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 80.3
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 80.18
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 80.07
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=8.8e-65  Score=476.38  Aligned_cols=280  Identities=33%  Similarity=0.601  Sum_probs=255.1

Q ss_pred             cCCCeEEEEeCcccceeeeeceEEEeeecCCceEEEEEeCCceEEEEEcCeeeccccChhhHHHHHhhhhcccCCCCCeE
Q 019550           30 QDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKTV  109 (339)
Q Consensus        30 ~~~~w~~e~~~~~~~~~~~~~~vl~~~~s~~q~I~V~e~~~~g~~L~ldG~~q~~~~d~~~Y~e~l~~~~l~~~~~p~~V  109 (339)
                      ....|++ ...++.++.|+++++||+++|+||+|.|++++.+||+|+|||.+|++++||+.|||||+|+|++.|++|++|
T Consensus         9 ~~~~w~e-~~~~~~~~~~~v~~vl~~~~S~yQ~i~v~~s~~~G~~L~LDg~~q~te~De~~YhE~l~h~~l~~~p~pk~V   87 (294)
T 3o4f_A            9 EKKQWHE-TLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHV   87 (294)
T ss_dssp             -CEEEEC-CSSSSEEEEEEESEEEEEEC---CCEEEEEETTTEEEEEETTEEEEETTTHHHHHHHHHHHHHHHSSCCCEE
T ss_pred             cccceee-eccCCcceEEEEeeEEEeccCCCceEEEEEcCCcceEEEECCchhhccccHHHHHHHHHHHHHhhCCCCCeE
Confidence            4457984 467888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecchhHHHHHHHhcCCCCEEEEEEcCHHHHHHHHHhhhh-hccccCCCCeEEEEccHHHHHHhcCCceeEEEecCCC
Q 019550          110 FIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTV-NQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLAD  188 (339)
Q Consensus       110 L~IG~G~G~~~~~l~~~~~~~~v~~VEid~~vi~~ar~~f~~-~~~~~~~~rv~v~~~D~~~~l~~~~~~yDvIi~D~~d  188 (339)
                      |+||+|+|++++++++|++..+|++|||||+|+++||+||+. +..++++||++++++||++|++...++||+||+|++|
T Consensus        88 LIiGgGdG~~~revlk~~~v~~v~~VEID~~Vv~~a~~~lp~~~~~~~~dpRv~v~~~Dg~~~l~~~~~~yDvIi~D~~d  167 (294)
T 3o4f_A           88 LIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTD  167 (294)
T ss_dssp             EEESCTTSHHHHHHHTCTTCCEEEEEESCHHHHHHHHHHCHHHHTTGGGCTTEEEEESCTTTTTSCSSCCEEEEEESCCC
T ss_pred             EEECCCchHHHHHHHHcCCcceEEEEcCCHHHHHHHHhcCccccccccCCCcEEEEechHHHHHhhccccCCEEEEeCCC
Confidence            999999999999999999999999999999999999999974 5567889999999999999999888999999999999


Q ss_pred             CCCCCccccCCcHHHHHHHHccccCCCcEEEEecCCCCccCchhhHHHHHHHHHhHCCceEEEEEeeccc-CCceeEEEE
Q 019550          189 PVEGGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSF-ADTWGWVMA  267 (339)
Q Consensus       189 ~~~~~p~~~L~t~ef~~~~~~~~L~~gGilv~~~~~~~~~~~~~~~~~i~~~l~~~F~~v~~~~~~iP~~-~~~~~~~~a  267 (339)
                      |.  +++..|||.+||+. ++++|+|||++++|+++|  +...+.+..+.++++++|++|..|.+.+|+| ++.|+|++|
T Consensus       168 p~--~~~~~L~t~eFy~~-~~~~L~p~Gv~v~q~~sp--~~~~~~~~~~~~~l~~~F~~v~~~~~~vPty~~g~w~f~~a  242 (294)
T 3o4f_A          168 PI--GPGESLFTSAFYEG-CKRCLNPGGIFVAQNGVC--FLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWA  242 (294)
T ss_dssp             CC--CTTCCSSCCHHHHH-HHHTEEEEEEEEEEEEES--SSCCHHHHHHHHHHHHHCSEEEEEEECCTTSSSSCEEEEEE
T ss_pred             cC--CCchhhcCHHHHHH-HHHHhCCCCEEEEecCCc--ccChHHHHHHHHHHHhhCCceeeeeeeeccCCCcceeheeE
Confidence            97  77889999999999 899999999999999988  5567788999999999999999999999999 578999999


Q ss_pred             ecCC--CCCCHHHHHHHHHhcCcccccccCHHhhHHhccCCHHHHHhhcCC
Q 019550          268 SDQP--FSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNE  316 (339)
Q Consensus       268 s~~p--~~~~~~~l~~r~~~~~~~~~~yy~~~~h~~~f~lp~~~~~~~~~~  316 (339)
                      |+.+  ..++.+.+.+|+..+ ..+++|||+++|+++|+||+|++++|+++
T Consensus       243 s~~~~~~~~~~~~~~~~~~~~-~~~~~yyn~~~h~aaF~lP~~~~~~l~~e  292 (294)
T 3o4f_A          243 TDNDALRHLSTEIIQARFLAS-GLKCRYYNPAIHTAAFALPQYLQDALASQ  292 (294)
T ss_dssp             ESCTTGGGCCHHHHHHHHHSS-CCCCSSCCHHHHHHHTCCCHHHHHHTTSS
T ss_pred             ECCCccccCChHHHhHHHHhh-CCCceEECHHHHHHHccCcHHHHHHHhcC
Confidence            9875  346778888888765 34799999999999999999999999875
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d1uira_312 c.66.1.17 (A:) Spermidine synthase {Thermus thermo 1e-82
d2b2ca1312 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhab 5e-74
d1inla_295 c.66.1.17 (A:) Spermidine synthase {Thermotoga mar 2e-72
d2o07a1285 c.66.1.17 (A:16-300) Spermidine synthase {Human (H 3e-69
d1iy9a_274 c.66.1.17 (A:) Spermidine synthase {Bacillus subti 1e-66
d1xj5a_290 c.66.1.17 (A:) Spermidine synthase {Thale cress (A 3e-65
d1mjfa_276 c.66.1.17 (A:) Putative spermidine synthetase PF01 2e-60
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Spermidine synthase
domain: Spermidine synthase
species: Thermus thermophilus [TaxId: 274]

 Score =  251 bits (641), Expect = 1e-82
 Identities = 114/305 (37%), Positives = 174/305 (57%), Gaps = 7/305 (2%)

Query: 34  WFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHE 93
           +F E +         + RV+  G + FQD  L ++K FGKVL++D  +QS E DE+IYHE
Sbjct: 6   YFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHE 65

Query: 94  CLIHPPLLCHQNPKTVFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLT-VN 152
            L+HP +L H  PK V I+GGGEG+  RE LKH ++EK VM DID E+V+  +R +   +
Sbjct: 66  TLVHPAMLTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWH 125

Query: 153 QEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLADPV-EGGPCYQLYTKSFYERILKPK 211
           Q AF   +  LV++DA+A LE+  E++DV+  DL DPV E  P   LYT  FY  +    
Sbjct: 126 QGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLTDPVGEDNPARLLYTVEFYRLVKA-H 184

Query: 212 LNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVMASDQ- 270
           LN  G+   Q G   + TH  V   ++ T+++ F++V +Y  H+P F   +G+++ASD  
Sbjct: 185 LNPGGVMGMQTGMI-LLTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLLASDAF 243

Query: 271 -PFSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIH 329
            P + +   I+ RI+ R N  L +L      +   + K +  +L  ET V T+++  ++ 
Sbjct: 244 DPAAFSEGVIEARIRER-NLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVT 302

Query: 330 GHGVA 334
             G A
Sbjct: 303 PEGEA 307
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Length = 295 Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Length = 274 Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 290 Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 276 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 100.0
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 100.0
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 100.0
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 100.0
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 100.0
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 100.0
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 100.0
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.5
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.5
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.48
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.47
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.46
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.41
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.4
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.39
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.39
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.39
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.39
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.38
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.38
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.36
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.36
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.35
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.34
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.34
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.34
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.33
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.3
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.3
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.3
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.3
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 99.29
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.28
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.28
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.27
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.26
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.25
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.23
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.23
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.23
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.23
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.22
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.21
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.2
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.19
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.17
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.17
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.17
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.16
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.13
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.12
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.12
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.11
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.11
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.1
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.1
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.08
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.07
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.06
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.06
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.06
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.04
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.02
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.01
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.01
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.0
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.98
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.97
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.91
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.91
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.89
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.82
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.81
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.76
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.75
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.7
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.52
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.45
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.38
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.37
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.26
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.22
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.14
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.13
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.1
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.06
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.98
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.95
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.93
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.89
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.81
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.8
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.75
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.73
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.71
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.66
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.64
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 97.63
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.6
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.53
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.18
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.12
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.11
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.11
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.09
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.07
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.04
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.02
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.98
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.87
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.81
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.53
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.52
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.38
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.36
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.22
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.14
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.09
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 95.64
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.64
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 95.59
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 95.55
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.42
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.39
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.24
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.11
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.05
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 94.9
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.88
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.41
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 94.28
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.27
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.18
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.18
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 93.96
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.88
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.75
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.63
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.37
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.99
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.81
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 92.78
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 92.66
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 92.64
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.51
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 92.49
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.03
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 91.65
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 90.94
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.83
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.7
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.61
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 90.34
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 89.96
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 89.52
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 89.35
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 88.88
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 88.26
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.16
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 87.56
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 87.17
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 86.66
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 86.42
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 86.31
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 86.19
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 85.98
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 85.68
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 85.3
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 84.89
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 84.87
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 84.76
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 84.74
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 84.71
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 84.54
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 84.37
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 84.06
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 83.6
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 83.45
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 83.25
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 83.16
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 82.99
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 82.7
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 82.68
d1qkka_140 Transcriptional regulatory protein DctD, receiver 82.67
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 82.49
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 82.09
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 81.82
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 81.7
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 81.19
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 80.76
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 80.5
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 80.38
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 80.3
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 80.18
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Spermidine synthase
domain: Spermidine synthase
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=1.3e-65  Score=485.90  Aligned_cols=305  Identities=37%  Similarity=0.610  Sum_probs=277.6

Q ss_pred             ccCCCeEEEEeCcccceeeeeceEEEeeecCCceEEEEEeCCceEEEEEcCeeeccccChhhHHHHHhhhhcccCCCCCe
Q 019550           29 LQDCCWFEEVIDDDLKWSFALNRVLHKGTSEFQDIALLDTKRFGKVLVIDGKMQSAEVDEFIYHECLIHPPLLCHQNPKT  108 (339)
Q Consensus        29 ~~~~~w~~e~~~~~~~~~~~~~~vl~~~~s~~q~I~V~e~~~~g~~L~ldG~~q~~~~d~~~Y~e~l~~~~l~~~~~p~~  108 (339)
                      +..++||+|..+++.+..++++++|++++|+||+|+|+++..+||+|+|||.+|++++||+.|||||+|+|++.|++|++
T Consensus         1 ~~~~~~~~e~~~~~~~~~~~~~~~l~~~~s~yQ~I~v~~~~~~G~~L~ldg~~q~~~~de~~Yhe~l~h~~l~~~~~pk~   80 (312)
T d1uira_           1 MDYGMYFFEHVTPYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAMLTHPEPKR   80 (312)
T ss_dssp             CCSSCEEEEESSSSEEEEEECSEEEEEEECSSCEEEEEEETTTEEEEEETTEEEEETTTHHHHHHHHHHHHHHHSSCCCE
T ss_pred             CCCcEEEEEecCCCceEEEEEEEEEEeCCCCCceEEEEEcCCcCcEEEECCeeeeccccHHHHHHHHhhhhhhhCCCcce
Confidence            34678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEecchhHHHHHHHhcCCCCEEEEEEcCHHHHHHHHHhhhh-hccccCCCCeEEEEccHHHHHHhcCCceeEEEecCC
Q 019550          109 VFIMGGGEGSAAREALKHKSLEKVVMCDIDQEVVDFCRRFLTV-NQEAFCSKKLNLVVNDAKAELEKRNEKFDVIFGDLA  187 (339)
Q Consensus       109 VL~IG~G~G~~~~~l~~~~~~~~v~~VEid~~vi~~ar~~f~~-~~~~~~~~rv~v~~~D~~~~l~~~~~~yDvIi~D~~  187 (339)
                      ||+||+|+|+++++++++.+..+|++|||||+|+++|++||+. +...+++||++++++||++||+..+++||+||+|++
T Consensus        81 VLiiG~G~G~~~~~ll~~~~~~~v~~VEiD~~Vi~~a~~~f~~~~~~~~~d~rv~i~~~Da~~~l~~~~~~yDvIi~D~~  160 (312)
T d1uira_          81 VLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDPRAVLVIDDARAYLERTEERYDVVIIDLT  160 (312)
T ss_dssp             EEEEECTTSHHHHHHTTSTTCCEEEEEESCHHHHHHHHHHCHHHHTTGGGCTTEEEEESCHHHHHHHCCCCEEEEEEECC
T ss_pred             EEEeCCCchHHHHHHHhcCCcceEEEecCCHHHHHHHHhcCcccccCccCCCceEEEEchHHHHhhhcCCcccEEEEeCC
Confidence            9999999999999999998889999999999999999999974 455678999999999999999998899999999999


Q ss_pred             CCCC-CCccccCCcHHHHHHHHccccCCCcEEEEecCCCCccCchhhHHHHHHHHHhHCCceEEEEEeecccCCceeEEE
Q 019550          188 DPVE-GGPCYQLYTKSFYERILKPKLNDNGIFVTQAGPAGIFTHKEVFSSIYNTIKQVFKHVVAYTAHVPSFADTWGWVM  266 (339)
Q Consensus       188 d~~~-~~p~~~L~t~ef~~~~~~~~L~~gGilv~~~~~~~~~~~~~~~~~i~~~l~~~F~~v~~~~~~iP~~~~~~~~~~  266 (339)
                      ||.. .+++..|+|.|||+. ++++|+|||++++|++++. ....+....+.++++++|++|.+|.+++|+|++.|+|++
T Consensus       161 dp~~~~~~~~~L~t~eF~~~-~~~~L~p~Gvlv~~~~s~~-~~~~~~~~~i~~tl~~~F~~V~~y~~~vPs~~~~w~f~~  238 (312)
T d1uira_         161 DPVGEDNPARLLYTVEFYRL-VKAHLNPGGVMGMQTGMIL-LTHHRVHPVVHRTVREAFRYVRSYKNHIPGFFLNFGFLL  238 (312)
T ss_dssp             CCBSTTCGGGGGSSHHHHHH-HHHTEEEEEEEEEEEEEEC-C---CHHHHHHHHHHTTCSEEEEEEEEEGGGTEEEEEEE
T ss_pred             CcccccchhhhhhhHHHHHH-HHHhcCCCceEEEecCCcc-cchHHHHHHHHHHHHHhCceEEEEEeeeCCcCCCCEeEE
Confidence            8753 346678999999999 8999999999999987663 234456678889999999999999999999998899999


Q ss_pred             EecCC--CCCCHHHHHHHHHhcCcccccccCHHhhHHhccCCHHHHHhhcCCCccccccccccccccccccc
Q 019550          267 ASDQP--FSINAEEIDNRIKSRINAELLYLNGASFLSSTTMNKAVYLSLLNETHVYTEEDARFIHGHGVAYN  336 (339)
Q Consensus       267 as~~p--~~~~~~~l~~r~~~~~~~~~~yy~~~~h~~~f~lp~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~  336 (339)
                      ||+.+  ..++...+..|++.+ ..+++|||+++|.++|+||+++++.|+++++|+||++|++++++|-++-
T Consensus       239 aS~~~~p~~~~~~~~~~~~~~~-~~~~~yy~~~~h~a~F~lp~~~~~~l~~~~~v~Td~~p~~~~~~~~~~~  309 (312)
T d1uira_         239 ASDAFDPAAFSEGVIEARIRER-NLALRHLTAPYLEAMFVLPKDLLEALEKETMVSTDQNPFYVTPEGEARQ  309 (312)
T ss_dssp             EESSSCTTCCCTTHHHHHHHHT-TCCCSSCCHHHHHHTTCCCHHHHHHHHHCCCCCCSSSCEEECTTSCEEE
T ss_pred             EeCCCCccccChhhhhhhHhhc-CCCccccCHHHHHHHhcCCHHHHHHHhcCCCccccCCccccCCCccccc
Confidence            99985  445677888888876 3489999999999999999999999999999999999999999998753
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure