Citrus Sinensis ID: 019604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MAVEARHQYSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFLPTVVYGSSINSDSFPHQKPLINKSDSSLTYNNYENNNLPLTPSRKRSRESCSTPTPFSFLGNDMSFQIQEQQFDIDRLISQHMEKVRMEVEERKKRQVRIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLASAAAQVKEGRAPAPAALGLEEEVVDDAESCCGSSWEDNGNKKINNCDHKDGDNGSSHSGGSRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS
cccccccccccccccHHHHHHHHccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHccccccccccccEEEEEEEEEc
cccccccccccccHHHcccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccccccccccccccHHHHHccccccccccccccccccccccccHcccccccccHccccccEEEEEEccccEEEccHHHHHHccccccccccccEEEEEcc
mavearhqysifppqllanreiimnpieansniyntqmggtggygrlplsgtattaeaFLPTvvygssinsdsfphqkplinksdssltynnyennnlpltpsrkrsrescstptpfsflgndmsFQIQEQQFDIDRLISQHMEKVRMEVEERKKRQVRIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLASAAAQVkegrapapaalgleeevvddaesccgsswedngnkkinncdhkdgdngsshsggsrlcrncrkeescvlllpcrhlclctvcgsslhtcpvckspktvSVHVNMS
mavearhqysifppqllANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFLPTVVYGSSINSDSFPHQKPLINKSDSSLTYNNYEnnnlpltpsrkrsresCSTPTPFSFLGNDMSFQIQEQQFDIDRLISQHMEKVRmeveerkkrqvriimdvieegvmkklkakedeieKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLASAAAQVKEGRAPAPAALGLEEEVVDDAESCCGSSWEDNGNKKINNCDHKDGDNGSSHSGGSRLCRNCRKEESCVLLLPCRHLCLCTVCGsslhtcpvckspktvsvhvnms
MAVEARHQYSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFLPTVVYGSSINSDSFPHQKPLINKSDSSLTYNNYENNNLPLTPSRKRSRESCSTPTPFSFLGNDMSFQIQEQQFDIDRLISQHmekvrmeveerkkrqvrIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLASAAAQVKegrapapaalgleeeVVDDAESCCGSSWEDNGNKKINNCdhkdgdngsshsggsRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS
********YSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFLPTVVYGSS***************************************************L***MSFQIQEQQFDIDRLIS***************RQVRIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQ********************************************************************************LCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKS***********
MAVEARHQYSIFPPQLL**************NIYNTQMG*****************EA******************************************************************SFQIQEQQFDIDRLISQHMEKVR****************VIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWR**************TNL**V****************************************************************LCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS
MAVEARHQYSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFLPTVVYGSSINSDSFPHQKPLINKSDSSLTYNNYENNNLPLT************PTPFSFLGNDMSFQIQEQQFDIDRLISQHMEKVRMEVEERKKRQVRIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLASAAAQVKEGRAPAPAALGLEEEVVDDAESCCGSSWEDNGNKKINNCDHKDG***********LCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPK*********
*****RHQYSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFLPT******INSDS*******INKSDSSL*Y***********************PTPFSFLGNDMSFQIQEQQFDIDRLISQHMEKVRMEVEERKKRQVRIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLASAAA*********************************************************RLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVEARHQYSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFLPTVVYGSSINSDSFPHQKPLINKSDSSLTYNNYENNNLPLTPSRKRSRESCSTPTPFSFLGNDMSFQIQEQQFDIDRLISQHMEKVRMEVEERKKRQVRIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLASAAAQVKEGRAPAPAALGLEEEVVDDAESCCGSSWEDNGNKKINNCDHKDGDNGSSHSGGSRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query338 2.2.26 [Sep-21-2011]
Q9D074 532 E3 ubiquitin-protein liga yes no 0.174 0.110 0.357 4e-05
Q5XIQ4 533 E3 ubiquitin-protein liga yes no 0.174 0.110 0.357 4e-05
O60291 552 E3 ubiquitin-protein liga yes no 0.174 0.106 0.357 9e-05
Q8JHV9401 Baculoviral IAP repeat-co N/A no 0.147 0.124 0.38 0.0001
A9ULZ2345 Baculoviral IAP repeat-co N/A no 0.147 0.144 0.38 0.0002
Q7ZUL9 529 Probable E3 ubiquitin-pro yes no 0.174 0.111 0.328 0.0002
Q24306438 Apoptosis 1 inhibitor OS= no no 0.174 0.134 0.355 0.0002
Q9LFH6299 Probable E3 ubiquitin-pro no no 0.627 0.709 0.206 0.0003
Q24307498 Apoptosis 2 inhibitor OS= no no 0.118 0.080 0.45 0.0003
Q13489604 Baculoviral IAP repeat-co no no 0.147 0.082 0.36 0.0005
>sp|Q9D074|MGRN1_MOUSE E3 ubiquitin-protein ligase MGRN1 OS=Mus musculus GN=Mgrn1 PE=1 SV=2 Back     alignment and function desciption
 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 11/70 (15%)

Query: 263 EDNGNKKINNCDHKDGDNGSSHSGGSRLCRNCRKEESCVLLLPCRHLCLCTVCGSSL--- 319
           E+  N++    D ++ DN S        C  C  +    L+LPCRHLCLCT C  +L   
Sbjct: 257 ENKNNQETKPSDDENSDNSSE-------CVVCLSDLRDTLILPCRHLCLCTSCADTLRYQ 309

Query: 320 -HTCPVCKSP 328
            + CP+C+ P
Sbjct: 310 ANNCPICRLP 319
E3 ubiquitin-protein ligase. Mediates TSG101 monoubiquitination at multiple sites. Plays a role in the regulation of endosome-to-lysosome trafficking. Impairs MC1R- and MC4R-signaling by competing with GNAS-binding to MCRs and inhibiting agonist-induced cAMP production. Does not inhibit ADRB2-signaling. Does not promote MC1R ubiquitination.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q5XIQ4|MGRN1_RAT E3 ubiquitin-protein ligase MGRN1 OS=Rattus norvegicus GN=Mgrn1 PE=2 SV=1 Back     alignment and function description
>sp|O60291|MGRN1_HUMAN E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens GN=MGRN1 PE=1 SV=2 Back     alignment and function description
>sp|Q8JHV9|BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis GN=birc7-a PE=1 SV=1 Back     alignment and function description
>sp|A9ULZ2|BIR7B_XENLA Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis GN=birc7-b PE=2 SV=2 Back     alignment and function description
>sp|Q7ZUL9|MGRN1_DANRE Probable E3 ubiquitin-protein ligase MGRN1 OS=Danio rerio GN=mgrn1 PE=2 SV=1 Back     alignment and function description
>sp|Q24306|IAP1_DROME Apoptosis 1 inhibitor OS=Drosophila melanogaster GN=th PE=1 SV=2 Back     alignment and function description
>sp|Q9LFH6|LUL2_ARATH Probable E3 ubiquitin-protein ligase LUL2 OS=Arabidopsis thaliana GN=LUL2 PE=2 SV=1 Back     alignment and function description
>sp|Q24307|IAP2_DROME Apoptosis 2 inhibitor OS=Drosophila melanogaster GN=Iap2 PE=2 SV=3 Back     alignment and function description
>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
224115204337 predicted protein [Populus trichocarpa] 0.926 0.928 0.582 1e-105
224117588340 predicted protein [Populus trichocarpa] 0.931 0.926 0.581 2e-96
118488869340 unknown [Populus trichocarpa x Populus d 0.931 0.926 0.578 6e-96
255544694333 conserved hypothetical protein [Ricinus 0.923 0.936 0.604 1e-92
449444126351 PREDICTED: uncharacterized protein LOC10 0.946 0.911 0.544 3e-90
357451829366 S-RNase binding protein [Medicago trunca 0.940 0.868 0.507 1e-85
356556974337 PREDICTED: uncharacterized protein LOC10 0.940 0.943 0.554 6e-84
297834100333 protein binding protein [Arabidopsis lyr 0.937 0.951 0.492 2e-78
18399792335 S-ribonuclease binding protein [Arabidop 0.937 0.946 0.490 2e-77
21617976335 unknown [Arabidopsis thaliana] 0.937 0.946 0.490 5e-77
>gi|224115204|ref|XP_002332187.1| predicted protein [Populus trichocarpa] gi|222875294|gb|EEF12425.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 211/362 (58%), Positives = 259/362 (71%), Gaps = 49/362 (13%)

Query: 1   MAVEARHQYSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFL 60
           MAVEARH  ++FPPQLL+NRE++MNPIEA++ +YNTQMG    YG +PLSGT TTAE  L
Sbjct: 1   MAVEARH-LNLFPPQLLSNREMMMNPIEADTYMYNTQMG----YG-VPLSGTTTTAETVL 54

Query: 61  PTVVYGSSINSDSFPHQKPLINKSDSSLTYNNYENNNLPLTPSRKRSR------------ 108
           P     SS+ +DS PH+  +  KS+S LTYN      LP+   RKR R            
Sbjct: 55  PMY---SSVITDSIPHKTQI--KSESGLTYN------LPV--QRKRPRDTINPLLSYPIP 101

Query: 109 -ESCSTPTPFSFLGNDMSFQIQEQQFDIDRLISQHMEKVRMEVEERKKRQVRIIMDVIEE 167
            +S  T TPFSFLG D+SFQIQ+QQ D D LISQHMEKVRME+EE++KRQ R +++ +E 
Sbjct: 102 VQSTKTCTPFSFLGQDLSFQIQQQQLDTDCLISQHMEKVRMEIEEKRKRQARRLLEALET 161

Query: 168 GVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLEQVLA 227
           G++K+L+AKE+EIEKIGKLNWALEE+VKSLC+ENQIWRDLAQSNEATANALR+NLEQVL 
Sbjct: 162 GMVKRLRAKEEEIEKIGKLNWALEEKVKSLCMENQIWRDLAQSNEATANALRSNLEQVL- 220

Query: 228 SAAAQVKEGRAPAPAALGLEEEVVDDAESCCGSS----------WEDNGNKKINNCDHKD 277
             AAQV E R            ++DDA+SCCGSS          WE+  +++   C   +
Sbjct: 221 --AAQVNEERTLGAGLDNQAAALMDDAQSCCGSSGGDGPVGDDGWEERVSER---CTLAN 275

Query: 278 GDNGSSHSG-GSRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVN 336
           G   +  +G GS +CRNC KEESCVLLLPCRHLCLCTVCGSSLHTCP+C++ K  SVHVN
Sbjct: 276 GAQDNKGTGAGSWMCRNCNKEESCVLLLPCRHLCLCTVCGSSLHTCPICRATKNASVHVN 335

Query: 337 MS 338
           +S
Sbjct: 336 LS 337

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224117588|ref|XP_002317616.1| predicted protein [Populus trichocarpa] gi|222860681|gb|EEE98228.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118488869|gb|ABK96244.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|255544694|ref|XP_002513408.1| conserved hypothetical protein [Ricinus communis] gi|223547316|gb|EEF48811.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449444126|ref|XP_004139826.1| PREDICTED: uncharacterized protein LOC101212862 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357451829|ref|XP_003596191.1| S-RNase binding protein [Medicago truncatula] gi|355485239|gb|AES66442.1| S-RNase binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356556974|ref|XP_003546794.1| PREDICTED: uncharacterized protein LOC100787292 [Glycine max] Back     alignment and taxonomy information
>gi|297834100|ref|XP_002884932.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297330772|gb|EFH61191.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18399792|ref|NP_566438.1| S-ribonuclease binding protein [Arabidopsis thaliana] gi|15795121|dbj|BAB02499.1| unnamed protein product [Arabidopsis thaliana] gi|26451940|dbj|BAC43062.1| unknown protein [Arabidopsis thaliana] gi|30017303|gb|AAP12885.1| At3g12920 [Arabidopsis thaliana] gi|332641741|gb|AEE75262.1| S-ribonuclease binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21617976|gb|AAM67026.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
TAIR|locus:2089225335 BRG3 "BOI-related gene 3" [Ara 0.937 0.946 0.450 1.2e-65
TAIR|locus:2207385358 BRG2 "BOI-related gene 2" [Ara 0.784 0.740 0.460 9.9e-55
TAIR|locus:2153227294 BRG1 "BOI-related gene 1" [Ara 0.683 0.785 0.404 2e-45
TAIR|locus:2133990304 RING [Arabidopsis thaliana (ta 0.721 0.802 0.333 1e-27
TAIR|locus:2036596340 AT1G60610 [Arabidopsis thalian 0.452 0.45 0.267 1.8e-18
TAIR|locus:2019983339 AT1G10650 [Arabidopsis thalian 0.565 0.563 0.247 1.1e-16
TAIR|locus:2171042300 AT5G47050 [Arabidopsis thalian 0.133 0.15 0.533 1.5e-14
TAIR|locus:2131571265 AT4G35070 "AT4G35070" [Arabido 0.316 0.403 0.280 2.1e-13
TAIR|locus:2129336314 AT4G17680 [Arabidopsis thalian 0.473 0.509 0.242 2.5e-13
TAIR|locus:2054224133 AT2G12290 "AT2G12290" [Arabido 0.136 0.345 0.608 4.1e-10
TAIR|locus:2089225 BRG3 "BOI-related gene 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 668 (240.2 bits), Expect = 1.2e-65, P = 1.2e-65
 Identities = 160/355 (45%), Positives = 203/355 (57%)

Query:     1 MAVEARHQYSIFPPQLLANREIIMNPIEANSNIYNTQMGGTGGYGRLPLSGTATTAEAFL 60
             MAVEA H   +F     +NRE+I +P+EA+  +YNTQM     YG +P        +  L
Sbjct:     1 MAVEAHHLNPLFS----SNREMI-HPVEASGVVYNTQMR----YGTVPTFNPTVECQTSL 51

Query:    61 PTVVYGSSINSDSFPHQ--KPLINKSDSSLTYNNYENNNLPLTP--SRKRSRESC----- 111
                +Y  S   D   HQ  KP I   DSSLT+N+ +NN   L P  SRKRSRE       
Sbjct:    52 FNPIYNIS-PVDRLVHQSMKPTIQSVDSSLTFNS-DNNVDFLRPVSSRKRSREESVVLNP 109

Query:   112 -------STPT-PFSFLGNDMSFQIQEQQFDIDRLISQHXXXXXXXXXXXXXXXXXIIMD 163
                      PT P  FLG D+S  +Q+  FDIDRLIS H                  I++
Sbjct:   110 SAYMQIQKNPTDPLMFLGQDLSSNVQQHHFDIDRLISNHVERMRMEIEEKRKTQGRRIVE 169

Query:   164 VIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQIWRDLAQSNEATANALRTNLE 223
              +E+G+MK L+AK+DEI  IGKLN  LEE+VKSLC+ENQIWRD+AQSNEAT NALR+NL+
Sbjct:   170 AVEQGLMKTLRAKDDEINHIGKLNLFLEEKVKSLCVENQIWRDVAQSNEATVNALRSNLQ 229

Query:   224 QVLASAAAQVKXXXXXXXXXXXXXXXVVDDAESCCGSSWEDNGNKKINNCXXXXXXXXXX 283
             QVLA+                     V DDA+SCCGS+ E +  ++              
Sbjct:   230 QVLAAVERN----------RWEEPPTVADDAQSCCGSNDEGDSEEERWKLAGEAQDTKKM 279

Query:   284 XXXXXRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS 338
                   +CR+C K E+ VLLLPCRH+CLC+VCGSSL+TCP+CKSPKT S+HVN+S
Sbjct:   280 CRVGMSMCRSCGKGEASVLLLPCRHMCLCSVCGSSLNTCPICKSPKTASLHVNLS 334
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0043067 "regulation of programmed cell death" evidence=IMP
TAIR|locus:2207385 BRG2 "BOI-related gene 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153227 BRG1 "BOI-related gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133990 RING [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036596 AT1G60610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019983 AT1G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171042 AT5G47050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131571 AT4G35070 "AT4G35070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129336 AT4G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054224 AT2G12290 "AT2G12290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.02020019
hypothetical protein (337 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-10
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 55.1 bits (133), Expect = 2e-10
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 3/46 (6%)

Query: 288 SRLCRNCRKEESCVLLLPCRHLCLCTVCGSSL---HTCPVCKSPKT 330
             LC  C +    V+ LPC HLCLC  C   L     CP+C+ P  
Sbjct: 2   DDLCVICLERPRNVVFLPCGHLCLCEECAKRLRSKKKCPICRQPIE 47

Length = 49

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 338
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.33
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.05
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.01
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.94
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.81
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.94
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.89
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 97.68
PF1463444 zf-RING_5: zinc-RING finger domain 97.68
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.66
PHA02929238 N1R/p28-like protein; Provisional 97.62
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.48
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.44
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.42
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.39
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.15
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.11
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.05
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.99
PHA02926242 zinc finger-like protein; Provisional 96.82
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 96.63
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.51
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 96.48
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.3
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.18
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.12
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.68
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.48
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.4
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 95.09
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 94.87
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.53
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 94.46
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 94.31
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 94.21
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 92.67
PF04641260 Rtf2: Rtf2 RING-finger 92.33
KOG0825 1134 consensus PHD Zn-finger protein [General function 92.01
KOG3039303 consensus Uncharacterized conserved protein [Funct 91.6
KOG1103 561 consensus Predicted coiled-coil protein [Function 91.33
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 91.04
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 90.8
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 90.56
KOG2113394 consensus Predicted RNA binding protein, contains 90.21
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 90.21
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 89.83
PF00038312 Filament: Intermediate filament protein; InterPro: 89.77
COG5152259 Uncharacterized conserved protein, contains RING a 89.37
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 88.86
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 88.68
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 88.41
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 88.0
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 86.68
KOG3002 299 consensus Zn finger protein [General function pred 86.35
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 84.99
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 84.53
KOG0163 1259 consensus Myosin class VI heavy chain [Cytoskeleto 82.55
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 82.54
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 81.71
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 80.84
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 80.78
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 80.55
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 80.39
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 80.37
PF00804103 Syntaxin: Syntaxin; InterPro: IPR006011 Syntaxins 80.31
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-39  Score=297.02  Aligned_cols=193  Identities=48%  Similarity=0.856  Sum_probs=163.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHHHHH
Q 019604          123 DMSFQIQEQQFDIDRLISQHMEKVRMEVEERKKRQVRIIMDVIEEGVMKKLKAKEDEIEKIGKLNWALEERVKSLCIENQ  202 (338)
Q Consensus       123 ~l~~ql~qQ~~EID~~i~~q~ErLR~~L~E~R~rq~r~ll~avE~~v~~rLReKE~EiEr~~r~n~ELEErlrql~~E~q  202 (338)
                      ++++++++|..|||+|+..|.|+||..+.+.++++++.++.++|..+.++||+|++||++++++|++|+++++++.+|+|
T Consensus        15 ~~~~~~~~q~~~id~f~~~~~~~l~~~~~~~~~~~~~~~l~~~e~~~~~~l~~k~~ei~~~~~~~~~l~~~~~~~~~e~~   94 (207)
T KOG1100|consen   15 DLASDIQRQSDEIDRFLKIQGEQLRRELEENRQRELRNLLKAVEEALVKKLREKDEEIERIGNLNWELEERVKSLYVEAQ   94 (207)
T ss_pred             cceeecccccchhhHHHHhhHHHHHHHHHHhChHHHHHHHHHHHHHHHHHhhcchhHHHhcccccceehhhhhhhhhhHH
Confidence            78899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhHHHHHHHHhhHHHHHHHHhHhhhhcCCCCCcccCccccccCCCCCcCCCCCcCCCcccccCCCCCCCCCCC
Q 019604          203 IWRDLAQSNEATANALRTNLEQVLASAAAQVKEGRAPAPAALGLEEEVVDDAESCCGSSWEDNGNKKINNCDHKDGDNGS  282 (338)
Q Consensus       203 ~Wq~~Ak~nEA~a~~Lr~~LeQ~l~~~~~~~~~~~~g~~~~~~l~~~e~dDAeScc~~~~~~~~~~~~er~~~~~~~~e~  282 (338)
                      .|+++|++||+++++|+.+|+|++++.. .      .     .   ...|++.++|+....+++...   ...  .+.+ 
T Consensus        95 ~w~~~a~~ne~~~~~l~~nl~q~~~~~~-~------~-----~---~~~~~~~~~~g~~~~~~~~s~---~~~--~~~~-  153 (207)
T KOG1100|consen   95 IWRDRAQTNEATVNSLRTNLDQVLAQCP-A------S-----A---PAEERGQKSCGDREADDGKSS---YVD--PSVD-  153 (207)
T ss_pred             HHHHHHHhChHHHHHHHHHHHHHHHhcc-c------c-----c---CchhhhccccCcccccccccc---ccc--hhhh-
Confidence            9999999999999999999999998851 0      0     0   234566666655554432211   000  0000 


Q ss_pred             CCCCcccccccccccCcceEEeCCCCcccchhHHhcCCCCCCCCCCCCceEEEee
Q 019604          283 SHSGGSRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNM  337 (338)
Q Consensus       283 ~~~~~~~~C~vC~~~~~~vvLlPCrHlclC~~C~~~l~~CPvCR~~i~~~V~V~l  337 (338)
                       .......|+.|..+++.|+|+||+|+|+|..|...+..||+|+.+++++++||+
T Consensus       154 -~~~~~~~Cr~C~~~~~~VlllPCrHl~lC~~C~~~~~~CPiC~~~~~s~~~v~~  207 (207)
T KOG1100|consen  154 -NFKRMRSCRKCGEREATVLLLPCRHLCLCGICDESLRICPICRSPKTSSVEVNF  207 (207)
T ss_pred             -hhhccccceecCcCCceEEeecccceEecccccccCccCCCCcChhhceeeccC
Confidence             111222399999999999999999999999999989999999999999999986

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00804 Syntaxin: Syntaxin; InterPro: IPR006011 Syntaxins A and B are nervous system-specific proteins implicated in the docking of synaptic vesicles with the presynaptic plasma membrane Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 6e-05
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 8e-05
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 28/50 (56%)
Query: 289 RLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS 338
           R C+ C  +E  ++ +PC HL +C  C  SL  CP+C+S    +V   +S
Sbjct: 25  RTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS 74
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
2ea5_A68 Cell growth regulator with ring finger domain prot 5e-14
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 1e-13
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 2e-12
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 4e-11
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 4e-07
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 2e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-04
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
 Score = 65.2 bits (159), Expect = 5e-14
 Identities = 17/60 (28%), Positives = 24/60 (40%)

Query: 279 DNGSSHSGGSRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS 338
                    S+ C  C+      +LLPCRH CLC  C      CP+C+     S  ++  
Sbjct: 6   SGVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGP 65
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
2ea5_A68 Cell growth regulator with ring finger domain prot 99.43
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.37
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.33
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.32
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.31
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.27
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.02
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.48
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.45
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.44
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.43
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.4
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.34
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.33
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.3
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.28
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.25
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.25
2ect_A78 Ring finger protein 126; metal binding protein, st 98.24
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.23
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.21
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.2
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.19
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.18
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.16
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.15
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.14
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.12
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.11
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.11
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.09
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.03
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.0
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.96
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.96
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.95
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.93
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.9
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.89
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.85
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.85
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.83
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.82
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.81
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.8
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.79
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.71
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.69
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.68
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.64
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.63
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.59
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.56
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.35
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.18
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.13
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.11
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.1
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.08
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.03
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.57
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.55
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.21
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 95.93
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.74
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.79
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 94.53
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 94.49
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 93.96
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 91.8
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 91.15
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 91.12
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 89.78
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 89.04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 88.83
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 84.81
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 83.88
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 82.38
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 81.46
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.43  E-value=1e-13  Score=105.17  Aligned_cols=52  Identities=33%  Similarity=0.747  Sum_probs=48.9

Q ss_pred             cccccccccccCcceEEeCCCCcccchhHHhcCCCCCCCCCCCCceEEEeeC
Q 019604          287 GSRLCRNCRKEESCVLLLPCRHLCLCTVCGSSLHTCPVCKSPKTVSVHVNMS  338 (338)
Q Consensus       287 ~~~~C~vC~~~~~~vvLlPCrHlclC~~C~~~l~~CPvCR~~i~~~V~V~lS  338 (338)
                      +...|+||++++++++|+||+|+++|..|...+..||+||.+|...++||.+
T Consensus        14 ~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~~   65 (68)
T 2ea5_A           14 NSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGP   65 (68)
T ss_dssp             CSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCSS
T ss_pred             CCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeecC
Confidence            3568999999999999999999999999999999999999999999999863
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 338
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 0.001
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.002
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.0 bits (80), Expect = 0.001
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 4/43 (9%)

Query: 290 LCRNCRKEESCVLLLPCRHL----CLCTVCGSSLHTCPVCKSP 328
           LC+ C + +  V + PC HL    CL +   S    CP C+  
Sbjct: 25  LCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCE 67
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.31
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.29
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.11
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.07
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.0
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.96
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.85
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.66
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.6
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.46
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.27
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.22
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.16
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.11
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.85
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.93
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.54  E-value=1.1e-08  Score=77.74  Aligned_cols=47  Identities=32%  Similarity=0.794  Sum_probs=40.3

Q ss_pred             cccccccccCcceEEeCCCCcccchhHHhcC-----CCCCCCCCCCCceEEEe
Q 019604          289 RLCRNCRKEESCVLLLPCRHLCLCTVCGSSL-----HTCPVCKSPKTVSVHVN  336 (338)
Q Consensus       289 ~~C~vC~~~~~~vvLlPCrHlclC~~C~~~l-----~~CPvCR~~i~~~V~V~  336 (338)
                      ..|.||++...+.+++||||. +|..|...+     .+||+||..|...-.|.
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            469999999999999999998 899997652     57999999998765543
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure