Citrus Sinensis ID: 019651

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVSGRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQECGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
cccccHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccHHHHHHHHccccccccEEEEEEEEEEcccccccccccccEEEEEEEEEEEEEEEccccccEEccEEEEEEEEEEEEEEEcccEEEEEEcccccccccEEEEEEEEEEcccccccccccccccEEEEEEEEEEEEEccccEEEEEEEEEEcccccEEEcccccccEEEccccHHHHHHHHHHHHHHcccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEccHHHHHcccccccccHHHHHHHHcccc
cccccHHHHHHHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHcccccEEEEEEEEEEEccccccHccccccEEEEEEEEEEEEEEEEcccccccccHHEHHHcccEccEEEEccccEEEEEcccccccccccEEEEccccccccHHHHHHHHHccccccccEEEEEEcccccEEEEEEEEEEccccEEEEcccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccEEEcHHHHHHcccccccHHHHHHEEEHHcc
miswggisccLSGAALYLLGrssgrdaeLLKTVTRVNQLEELAHLLdggskvlpSIVSvsgrvgsetpisceysglrgviveETTERhflkhndagswiqDSALMLSMskevpwylddgtgcvfvvgargatgFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVkrigrllptgtsltvvgeavkddigtvriqrphkgpfyvspkTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAAVQrseqdnegtngqaengsdstqrdrvmpDLCVICLeqecghlccclicssrltncplcrrRIDQVVRTFRH
MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAhlldggskvlPSIVSVsgrvgsetpisceysglrGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRllptgtsltvvgeavkddigtvriqrphkgpfyvspkTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAaavqrseqdnegtngqaengsdstqrdrVMPDLCVICLEQECGHLCCCLICssrltncplcrrRIDQVVRTFRH
MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVSGRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILqrkrrwelrrrvlaaaavqrSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQECGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
**SWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVSGRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAA**************************VMPDLCVICLEQECGHLCCCLICSSRLTNCPLCRRRIDQVVRT***
*ISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVSGRVGSETP**CEYSGLRGVIVEETTERHFLKHNDAGSWI**SAL*LSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKD**********HKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWEL************************************MPDLCVICLEQECGHLCCCLICSSRLTNCPLCRRRIDQVVRTFR*
MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVSGRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAA**************************DRVMPDLCVICLEQECGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVSGRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRR***A*AAV**************************MPDLCVICLEQECGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVSGRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIAKRVIRCILQRKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQECGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
Q969V5352 Mitochondrial ubiquitin l yes no 0.910 0.872 0.276 9e-18
Q4R7G8352 Mitochondrial ubiquitin l N/A no 0.910 0.872 0.274 9e-17
Q6NTT6353 Mitochondrial ubiquitin l N/A no 0.910 0.869 0.258 9e-16
Q5M7X9341 Mitochondrial ubiquitin l yes no 0.916 0.906 0.277 7e-15
Q8VCM5352 Mitochondrial ubiquitin l yes no 0.913 0.875 0.263 8e-14
Q557E7665 E3 ubiquitin-protein liga yes no 0.157 0.079 0.393 2e-08
Q7XI08513 Probable E3 ubiquitin-pro no no 0.189 0.124 0.32 4e-06
O76050574 Neuralized-like protein 1 no no 0.175 0.102 0.350 0.0001
Q6ZQM0377 E3 ubiquitin-protein liga no no 0.249 0.222 0.318 0.0001
Q8CIN9362 E3 ubiquitin-protein liga no no 0.249 0.232 0.318 0.0002
>sp|Q969V5|MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens GN=MUL1 PE=1 SV=1 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 95/343 (27%), Positives = 152/343 (44%), Gaps = 36/343 (10%)

Query: 14  AALYLLGRSSGRDAELLKTVTRVNQLEELAHLL-DGGSKVLP-SIVSVSGRVGSETPISC 71
           AALY + R   R ++ LK   +V+  E+L  +L +   K +P +++  + R   ET  S 
Sbjct: 23  AALYSVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQ 82

Query: 72  EYSGLRGVIVEETTERHFLKHNDAGS-WIQDSALMLSMSKEVPWYL---DDGTG-CVFVV 126
                +GVI   T + H +  N     W   S ++   +  VP+ L   +DG    V V+
Sbjct: 83  FVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVL 142

Query: 127 GARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAV 186
               +    L    E F  S +S       Y+ G +  G++    +L  G +LT VGE V
Sbjct: 143 KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELV 202

Query: 187 KDDIGTVRIQRPHKG-PFYVSPKTIDELLENLGKWARWYKYAS--FGLTIFGAFLIAKRV 243
            D+  +VR+Q P +G  +Y+S +  D LL+      R +K  +  FG           R 
Sbjct: 203 LDN-NSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILR- 260

Query: 244 IRCILQRKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDR-VMPDLCVICLE 302
            +  LQR+ R  L++       +Q   Q++E     A+  S +   DR  +   CV+CL 
Sbjct: 261 -KQYLQRQERLRLKQ-------MQEEFQEHE-----AQLLSRAKPEDRESLKSACVVCLS 307

Query: 303 Q-------ECGHLCCCLICSSRLT---NCPLCRRRIDQVVRTF 335
                   ECGH+C C  C   L     CP+CR+ I +V+  +
Sbjct: 308 SFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLY 350
Exhibits weak E3 ubiquitin-protein ligase activity, but preferentially acts as a SUMO E3 ligase at physiological concentrations. Plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q4R7G8|MUL1_MACFA Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Macaca fascicularis GN=MUL1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NTT6|MUL1_XENLA Mitochondrial ubiquitin ligase activator of nfkb 1 OS=Xenopus laevis GN=mul1 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7X9|MUL1A_DANRE Mitochondrial ubiquitin ligase activator of nfkb 1-A OS=Danio rerio GN=mul1a PE=2 SV=1 Back     alignment and function description
>sp|Q8VCM5|MUL1_MOUSE Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Mus musculus GN=Mul1 PE=2 SV=2 Back     alignment and function description
>sp|Q557E7|CBLA_DICDI E3 ubiquitin-protein ligase cblA OS=Dictyostelium discoideum GN=cblA-1 PE=1 SV=1 Back     alignment and function description
>sp|Q7XI08|XB34_ORYSJ Probable E3 ubiquitin-protein ligase XBOS34 OS=Oryza sativa subsp. japonica GN=XBOS34 PE=2 SV=1 Back     alignment and function description
>sp|O76050|NEU1A_HUMAN Neuralized-like protein 1A OS=Homo sapiens GN=NEURL PE=2 SV=1 Back     alignment and function description
>sp|Q6ZQM0|RFFL_MOUSE E3 ubiquitin-protein ligase rififylin OS=Mus musculus GN=Rffl PE=1 SV=1 Back     alignment and function description
>sp|Q8CIN9|RFFL_RAT E3 ubiquitin-protein ligase rififylin OS=Rattus norvegicus GN=Rffl PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
225436896343 PREDICTED: mitochondrial ubiquitin ligas 0.997 0.979 0.770 1e-155
449436571342 PREDICTED: mitochondrial ubiquitin ligas 0.994 0.979 0.755 1e-150
449515051337 PREDICTED: mitochondrial ubiquitin ligas 0.979 0.979 0.752 1e-148
356500224339 PREDICTED: mitochondrial ubiquitin ligas 0.985 0.979 0.764 1e-144
356535760339 PREDICTED: mitochondrial ubiquitin ligas 0.985 0.979 0.761 1e-144
297840101343 zinc finger family protein [Arabidopsis 0.997 0.979 0.729 1e-144
255567656363 zinc ion binding protein, putative [Rici 0.910 0.845 0.796 1e-144
312283085344 unnamed protein product [Thellungiella h 0.997 0.976 0.739 1e-142
30696917343 E3 ubiquitin ligase-like protein [Arabid 0.997 0.979 0.720 1e-141
334183615347 E3 ubiquitin ligase-like protein [Arabid 0.997 0.968 0.712 1e-139
>gi|225436896|ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|296086688|emb|CBI32323.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/344 (77%), Positives = 301/344 (87%), Gaps = 8/344 (2%)

Query: 1   MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVS 60
           MI WGGISCCLS AALYLLGRSSGRDAE LK+VTRV QL++L  LLD   KVLP +V+VS
Sbjct: 1   MIPWGGISCCLSAAALYLLGRSSGRDAEALKSVTRVQQLKDLVQLLDTACKVLPLVVTVS 60

Query: 61  GRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGT 120
           GRVGS+TPI CEYSGLRGVIVEET E+HFLKHNDAGSWIQDSALMLSMSKEVPWYLDD T
Sbjct: 61  GRVGSDTPIKCEYSGLRGVIVEETAEQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDDT 120

Query: 121 GCVFVVGARGATGFALTVGSEVFEESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLT 180
           G  ++VGARGATG  LTVGSEVFEESGRSLV GTLDYLQGLKMLGVKRI R+LPTGT LT
Sbjct: 121 GRAYIVGARGATGLVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERVLPTGTPLT 180

Query: 181 VVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLIA 240
           VVGEA+KDD+GT+RIQRPHKGPFYVSPK+ID L+ NLGKWARWY+YAS G T+FG +LIA
Sbjct: 181 VVGEAIKDDVGTIRIQRPHKGPFYVSPKSIDHLVANLGKWARWYRYASLGFTVFGVYLIA 240

Query: 241 KRVIRCILQRKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVIC 300
           K  I+ +++RKR WELR+RVLAAA+ ++S QD+E  + + ENGSD+T+RDR+MPDLCVIC
Sbjct: 241 KSAIQYVMERKRCWELRKRVLAAAS-KKSGQDSEDPDEKDENGSDNTKRDRLMPDLCVIC 299

Query: 301 LEQE-------CGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH 337
           LEQE       CGH+CCC +CSS+LTNCPLCRRRI+QVVRTFRH
Sbjct: 300 LEQEYNAVFVPCGHMCCCTMCSSQLTNCPLCRRRIEQVVRTFRH 343

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449436571|ref|XP_004136066.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515051|ref|XP_004164563.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356500224|ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356535760|ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|297840101|ref|XP_002887932.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297333773|gb|EFH64191.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255567656|ref|XP_002524807.1| zinc ion binding protein, putative [Ricinus communis] gi|223535991|gb|EEF37650.1| zinc ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|312283085|dbj|BAJ34408.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|30696917|ref|NP_176574.2| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] gi|22135946|gb|AAM91555.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|23197600|gb|AAN15327.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|51970568|dbj|BAD43976.1| unknown protein [Arabidopsis thaliana] gi|51971707|dbj|BAD44518.1| unknown protein [Arabidopsis thaliana] gi|332196043|gb|AEE34164.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334183615|ref|NP_001185305.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] gi|332196044|gb|AEE34165.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
TAIR|locus:2202882338 ZCF61 [Arabidopsis thaliana (t 0.979 0.976 0.492 5.2e-81
UNIPROTKB|E1BGD5350 MUL1 "Uncharacterized protein" 0.890 0.857 0.295 9.2e-20
UNIPROTKB|E2RBI8352 MUL1 "Uncharacterized protein" 0.682 0.653 0.285 4.6e-17
UNIPROTKB|Q969V5352 MUL1 "Mitochondrial ubiquitin 0.676 0.647 0.287 4.2e-16
UNIPROTKB|I3LH19352 MUL1 "Uncharacterized protein" 0.908 0.869 0.260 1e-15
RGD|1309944352 Mul1 "mitochondrial E3 ubiquit 0.676 0.647 0.279 1.2e-15
UNIPROTKB|Q4R7G8352 MUL1 "Mitochondrial ubiquitin 0.676 0.647 0.283 4.3e-15
MGI|MGI:1915600352 Mul1 "mitochondrial ubiquitin 0.623 0.596 0.276 5.6e-15
ZFIN|ZDB-GENE-050102-5341 mul1a "mitochondrial E3 ubiqui 0.922 0.912 0.258 6e-14
UNIPROTKB|Q6NTT6353 mul1 "Mitochondrial ubiquitin 0.908 0.866 0.256 1.7e-13
TAIR|locus:2202882 ZCF61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 813 (291.2 bits), Expect = 5.2e-81, P = 5.2e-81
 Identities = 170/345 (49%), Positives = 223/345 (64%)

Query:     1 MISWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLEELAHLLDGGSKVLPSIVSVS 60
             MI   G +CCL G ALYLL RS+GRD   +K++TRV QL++L  L++  SKV+P I++VS
Sbjct:     1 MIHLAGFTCCLGGVALYLLTRSTGRD---IKSITRVYQLKDLEQLVEVESKVVPLIIAVS 57

Query:    61 GRVGSETPISCEYSGLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGT 120
             G VGSETPI CE+S + GV ++ T E+  L+ N   SW+++S LM  M+KEVPWYLDDGT
Sbjct:    58 GDVGSETPIKCEHSYVLGVFLKRTAEQQVLRRNWRFSWVRNSTLMQPMTKEVPWYLDDGT 117

Query:   121 GCVFVVGARGATGFALTVGSEVFEESGR-SLVHGTLDYLQGLKMLGVKRIGRLLPTGTSL 179
             G V V  ++G  G ALTVGS+VFE++   SLV G L YL+G K+LGV+ + R++P GT L
Sbjct:   118 GRVNVDVSQGELGLALTVGSDVFEKAEPVSLVQGALGYLKGFKILGVRHVERVVPIGTPL 177

Query:   180 TVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASFGLTIFGAFLI 239
             TVVGEAV+D +G VRIQ+P +GPFYV+   +D+L+  LG  +R +KYAS GLT+ G  LI
Sbjct:   178 TVVGEAVRDGMGNVRIQKPEQGPFYVTYIPLDQLISKLGDLSRRFKYASMGLTVLGVILI 237

Query:   240 AKRVIRCILXXXXXXXXXXXXXXXXXXXXSEQDNEGTNGQAENGSDSTQRDRVMPDLCVI 299
             +K VI  IL                       D      +   G   T RD   PDLCV+
Sbjct:   238 SKPVIEYILKRIEDTLERRRRQFALKRVV---DAAARRAKPVTGG-GTSRDGDTPDLCVV 293

Query:   300 CLEQ-------ECGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH 337
             CL+Q       ECGH+CCC  CS +L  CPLCR RI QV++ +RH
Sbjct:   294 CLDQKYNTAFVECGHMCCCTPCSLQLRTCPLCRERIQQVLKIYRH 338
GO:0005739 "mitochondrion" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
UNIPROTKB|E1BGD5 MUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBI8 MUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q969V5 MUL1 "Mitochondrial ubiquitin ligase activator of NFKB 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LH19 MUL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309944 Mul1 "mitochondrial E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7G8 MUL1 "Mitochondrial ubiquitin ligase activator of NFKB 1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
MGI|MGI:1915600 Mul1 "mitochondrial ubiquitin ligase activator of NFKB 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050102-5 mul1a "mitochondrial E3 ubiquitin ligase 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NTT6 mul1 "Mitochondrial ubiquitin ligase activator of nfkb 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
pfam12483154 pfam12483, GIDE, E3 Ubiquitin ligase 1e-56
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 6e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 9e-04
cd0016245 cd00162, RING, RING-finger (Really Interesting New 0.001
>gnl|CDD|221597 pfam12483, GIDE, E3 Ubiquitin ligase Back     alignment and domain information 
 Score =  180 bits (459), Expect = 1e-56
 Identities = 66/153 (43%), Positives = 88/153 (57%), Gaps = 1/153 (0%)

Query: 85  TERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGCVFVVGARGATGFALTVGSEVFE 144
            E    + + +GSW + S L+ S  +EVP+YL DGTG V VV         L    + FE
Sbjct: 1   EEVVTTRDSGSGSWRRRSELVASNEREVPFYLRDGTGRVLVVMDPSGAEIELVTVLDRFE 60

Query: 145 ESGRSLVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKG-PF 203
            S  SL      +  G   LG + I R+LP GT LTVVGEAV+D+ GT+RIQ+P KG PF
Sbjct: 61  PSEGSLFSLLFGFFSGDVTLGYRYIERVLPVGTRLTVVGEAVRDEDGTLRIQKPSKGGPF 120

Query: 204 YVSPKTIDELLENLGKWARWYKYASFGLTIFGA 236
           ++S K+ +EL+E+L   AR   Y S GL + G 
Sbjct: 121 FISTKSEEELIESLASSARTLFYGSIGLGVVGI 153

This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length. There is a single completely conserved residue E that may be functionally important. GIDE is an E3 ubiquitin ligase which is involved in inducing apoptosis. Length = 154
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF12483160 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 Thi 100.0
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.3
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.96
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.92
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.72
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 97.66
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.61
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.5
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
PHA02929238 N1R/p28-like protein; Provisional 97.44
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.34
PHA02926242 zinc finger-like protein; Provisional 97.23
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.15
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.13
PF1463444 zf-RING_5: zinc-RING finger domain 97.08
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.0
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.99
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.84
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.3
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 95.79
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 95.78
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 95.49
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.12
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 95.08
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 95.0
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 94.6
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.49
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 94.44
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 94.23
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.16
KOG3002 299 consensus Zn finger protein [General function pred 93.96
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.94
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 93.86
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.85
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 93.44
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 92.93
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 92.19
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 92.08
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.02
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 91.74
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 91.43
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 90.55
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 90.43
KOG3799169 consensus Rab3 effector RIM1 and related proteins, 89.95
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 88.08
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 87.87
COG5152259 Uncharacterized conserved protein, contains RING a 86.18
PF0630568 DUF1049: Protein of unknown function (DUF1049); In 85.98
KOG0825 1134 consensus PHD Zn-finger protein [General function 85.85
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 83.14
PF1488059 COX14: Cytochrome oxidase c assembly 83.1
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 80.73
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 80.18
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-45  Score=341.57  Aligned_cols=335  Identities=32%  Similarity=0.514  Sum_probs=292.8

Q ss_pred             CceechhHHHHHHHHHHHHhh---cchhhhHhhcccccccchhHHHHhhcCC-CCccccEEEEEEEEec-CCCccccC-C
Q 019651            1 MISWGGISCCLSGAALYLLGR---SSGRDAELLKTVTRVNQLEELAHLLDGG-SKVLPSIVSVSGRVGS-ETPISCEY-S   74 (337)
Q Consensus         1 m~~~g~~~~~~~g~~~~~~~~---~~~~~~~~l~~~~~~~~~~~L~~~l~~~-~~~~~~~V~V~G~v~~-~~PL~s~~-s   74 (337)
                      |..-+.+++++..+++++.++   ++.+..+.++.++....+.|+...++.. .++++|+ .++|.+.+ ..|+.+-. +
T Consensus         1 ~~l~~~~~~~~~~v~l~l~~~~~g~~~~~s~~~~~a~k~~~~~d~~~~~~~~~~~~I~~l-~~~~~~~~~~~~~~~~~v~   79 (355)
T KOG1571|consen    1 MSLEGRFLLGLTNVALRLLFRQYGRLPRVSKVGKEAEKVLVLVDLKSSWDIAPEKKIPYL-VIRGCAIARKETLRSLCVS   79 (355)
T ss_pred             CchhHHHHHhhhHHHHHhhhhhcccchhhHHHhhhccceecchhhhhhhhhccccchHHH-HHhhcccccccchHHhhcc
Confidence            556677766666666665555   4555666667888888888888877664 8899999 59999999 77777776 7


Q ss_pred             CCcEEEEEEEEEEEEEeecCCCceeecceeeeeceeeeceEEEcCCee----EEEeCCCCCcccceeeeeeeEecCC-cc
Q 019651           75 GLRGVIVEETTERHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGC----VFVVGARGATGFALTVGSEVFEESG-RS  149 (337)
Q Consensus        75 ~~~cV~y~~~v~e~~~~~~~~~~W~~~~~~i~~~~~~vpF~L~D~tg~----V~V~~~~~A~~l~l~~~~~~f~~~~-~~  149 (337)
                      ++++|.+..+.+++...+++.+.|.+.+..++++.+++||+|.+.++.    +++..+.+.-.++++++++.|+++. .+
T Consensus        80 ~v~gvv~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~l~~q~~~~~~~~~~s~~~~~~~l~l~~~~d~f~~s~p~s  159 (355)
T KOG1571|consen   80 NVPGVVQALTLEEPKGRRDGGGHWNANSKIFHEGGNEVPFFLRSQTTGFACEVRVSKTLGRLFLPLNVVYDLFEPSDPCS  159 (355)
T ss_pred             cCCceEEEeeeccceeeeccceeeccceeeccCCCcccceeeccCCcceeeeeeeecceeeeeecceeeeccccccCcce
Confidence            999999999999999877778889999999999999999999999888    9999999999999999999999998 57


Q ss_pred             cccccccccccccccceEEEEeeecCCCeEEEEEEEEECCCcceEEeCCCCCCeEEccCCHHHHHHHHHHHHHHHHHHHh
Q 019651          150 LVHGTLDYLQGLKMLGVKRIGRLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELLENLGKWARWYKYASF  229 (337)
Q Consensus       150 ~~~~~~~~~~g~~~~g~r~~E~~L~~G~~ltvvGe~~~d~~G~l~i~~p~~gpf~lS~~~~~~L~~~~~~~a~~~~~~~i  229 (337)
                      +.+..+++++|.++.|.+.+|++|++|+.+|++||++.|+.+..++++|.+||+|++....++|+.++..+.++.++.++
T Consensus       160 ~~~~~~~~~sg~~~~~~~~~~~~l~~~~~~t~l~e~v~d~~~~~r~~~~~~g~~~v~~s~~d~LIsr~g~~s~~~kv~~~  239 (355)
T KOG1571|consen  160 LVDVGGGYHSGVRRGGFRETERVLPLGTRLTALGELVRDGYCGVRVQPPMQGPLYVTKSAADRLISREGDLSFFVKVNGM  239 (355)
T ss_pred             eeecccccccceeeecccceEEeeccccceeeeehheecCCCceEecCCccCcceeeccchhhHHHhhccceeeeeecce
Confidence            88899999999999999999999999999999999999987889999999995444444499999999999999999999


Q ss_pred             HHhHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHhhhhccCCCCCCCCCCCCcccCCCcccccccccccc---
Q 019651          230 GLTIFGAFLIAKRVIRCILQ--RKRRWELRRRVLAAAAVQRSEQDNEGTNGQAENGSDSTQRDRVMPDLCVICLEQE---  304 (337)
Q Consensus       230 ~~~~~G~~ll~~~~~r~~~~--~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~~~~---  304 (337)
                      +|+++|+++|++....++++  +++++++.+++.++.+ .|++....+++++-.+-+++.+.+...++.|+||++++   
T Consensus       240 ~~~~~~~ills~~~~d~~led~r~~r~~l~k~~~~~~~-~rae~~s~g~~gtr~~~~~~~~~~~~~p~lcVVcl~e~~~~  318 (355)
T KOG1571|consen  240 VFGTLGVILLSFIVKDNYLEDDRRQRRELVKRVEDLAT-VRAELLSRGVRGTRIQNENGTFRELPQPDLCVVCLDEPKSA  318 (355)
T ss_pred             eeeeeeEEeehHHHHHHHHHHHHHHHHHHHHhhhhhhh-heeeeecccccccccccccCcccccCCCCceEEecCCccce
Confidence            99999999999999999998  8899999999999888 78877766665553333566677777788999999999   


Q ss_pred             ----ccCcccchhhhhcCCCCccccccccceEEeeeC
Q 019651          305 ----CGHLCCCLICSSRLTNCPLCRRRIDQVVRTFRH  337 (337)
Q Consensus       305 ----CgH~~~C~~C~~~~~~CP~Cr~~i~~~~~~~~~  337 (337)
                          |||+|||..|+..++.||+||+.|+..+++|.|
T Consensus       319 ~fvpcGh~ccct~cs~~l~~CPvCR~rI~~~~k~y~~  355 (355)
T KOG1571|consen  319 VFVPCGHVCCCTLCSKHLPQCPVCRQRIRLVRKRYRS  355 (355)
T ss_pred             eeecCCcEEEchHHHhhCCCCchhHHHHHHHHHHhcC
Confidence                999999999999999999999999999999986

>PF12483 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF06305 DUF1049: Protein of unknown function (DUF1049); InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14880 COX14: Cytochrome oxidase c assembly Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 9e-16
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 2e-15
2ea5_A68 Cell growth regulator with ring finger domain prot 5e-15
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-14
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 6e-13
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 7e-13
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 6e-05
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-05
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 70.2 bits (172), Expect = 9e-16
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 275 GTNGQAENGSDSTQRDRVMPD--LCVICLEQE-------CGHLCCCLICSSRLTNCPLCR 325
           G++G  +    + ++ R + +  LC IC+++        CGHL  C  C+  +  CP+C 
Sbjct: 4   GSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCY 63

Query: 326 RRIDQVVRTF 335
             I    + F
Sbjct: 64  TVITFKQKIF 73
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
2ea5_A68 Cell growth regulator with ring finger domain prot 99.26
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.18
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.03
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.99
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.93
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.93
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.61
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.03
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.02
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.99
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.96
2ect_A78 Ring finger protein 126; metal binding protein, st 97.96
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.95
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.94
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 97.88
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.86
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.85
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.84
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.84
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.8
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.78
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.76
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.74
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.73
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.72
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.71
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.7
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.69
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.69
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.69
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.64
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.64
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.58
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.46
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.38
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.29
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.29
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.28
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.2
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.19
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.19
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.18
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.16
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.11
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.08
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.08
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.02
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.98
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.72
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 96.69
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.61
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.56
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.31
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.1
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.09
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 95.86
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 95.78
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 95.69
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.61
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 95.6
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 95.38
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 94.98
2f42_A179 STIP1 homology and U-box containing protein 1; cha 94.68
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 93.94
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 93.58
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 91.43
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 90.24
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 88.64
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 84.83
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 82.96
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.26  E-value=2.9e-12  Score=93.99  Aligned_cols=47  Identities=26%  Similarity=0.685  Sum_probs=43.2

Q ss_pred             CCCcccccccccccc-------ccCcccchhhhhcCCCCccccccccceEEeee
Q 019651          290 DRVMPDLCVICLEQE-------CGHLCCCLICSSRLTNCPLCRRRIDQVVRTFR  336 (337)
Q Consensus       290 ~~~~~~~C~iC~~~~-------CgH~~~C~~C~~~~~~CP~Cr~~i~~~~~~~~  336 (337)
                      +..+...|+||++++       |||+++|..|+..+..||+||++|...+++|.
T Consensus        11 ~~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~   64 (68)
T 2ea5_A           11 SEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSG   64 (68)
T ss_dssp             SCCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCS
T ss_pred             cCCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeec
Confidence            455567999999988       99999999999999999999999999999986
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 337
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-06
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-04
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.1 bits (101), Expect = 2e-06
 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 11/48 (22%)

Query: 295 DLCVICLEQE-------CGHLCCC----LICSSRLTNCPLCRRRIDQV 331
            LC IC E +       CGHL C         S    CP CR  I   
Sbjct: 24  QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGT 71
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.11
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.09
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.02
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.92
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.9
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.55
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.32
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.28
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.12
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 96.97
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.96
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.73
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.48
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 95.95
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 94.0
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 93.13
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.12  E-value=4e-07  Score=66.55  Aligned_cols=40  Identities=40%  Similarity=0.949  Sum_probs=32.5

Q ss_pred             cccccccccc-------ccCcccchhhhhc-----CCCCccccccccceEEee
Q 019651          295 DLCVICLEQE-------CGHLCCCLICSSR-----LTNCPLCRRRIDQVVRTF  335 (337)
Q Consensus       295 ~~C~iC~~~~-------CgH~~~C~~C~~~-----~~~CP~Cr~~i~~~~~~~  335 (337)
                      ..|.||++..       |||.+ |..|...     -.+||+||..|...-.+.
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~f-C~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHLM-CTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCEE-CHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCccCCCcCCCeEEeCCCCee-eHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            4799999987       99986 9999854     247999999998765543
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure