Citrus Sinensis ID: 019775
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| 224082832 | 341 | predicted protein [Populus trichocarpa] | 1.0 | 0.985 | 0.850 | 1e-167 | |
| 224066237 | 341 | predicted protein [Populus trichocarpa] | 1.0 | 0.985 | 0.844 | 1e-166 | |
| 255582507 | 340 | Polysialic acid capsule expression prote | 0.961 | 0.95 | 0.857 | 1e-164 | |
| 449468558 | 348 | PREDICTED: probable arabinose 5-phosphat | 0.958 | 0.925 | 0.835 | 1e-158 | |
| 225438103 | 340 | PREDICTED: probable arabinose 5-phosphat | 1.0 | 0.988 | 0.779 | 1e-153 | |
| 356572264 | 342 | PREDICTED: probable arabinose 5-phosphat | 0.997 | 0.979 | 0.746 | 1e-148 | |
| 297816764 | 350 | sugar isomerase domain-containing protei | 1.0 | 0.96 | 0.748 | 1e-146 | |
| 15232565 | 350 | sugar isomerase domain-containing protei | 0.964 | 0.925 | 0.783 | 1e-146 | |
| 294460481 | 342 | unknown [Picea sitchensis] | 1.0 | 0.982 | 0.687 | 1e-138 | |
| 297744159 | 304 | unnamed protein product [Vitis vinifera] | 0.898 | 0.993 | 0.718 | 1e-135 |
| >gi|224082832|ref|XP_002306858.1| predicted protein [Populus trichocarpa] gi|222856307|gb|EEE93854.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 593 bits (1529), Expect = e-167, Method: Compositional matrix adjust.
Identities = 290/341 (85%), Positives = 315/341 (92%), Gaps = 5/341 (1%)
Query: 1 MGSLPLTLDLLP-----HKVSENTLLDLFKSQQDHLNYFFQHLSLPHTLTFTQTLLKCRG 55
MGSLP LDL ++ + TLL+LFKSQQ+HLNYFFQ+L+L LTFTQTLL C G
Sbjct: 1 MGSLPPFLDLPSPDAKFQQIDQTTLLNLFKSQQNHLNYFFQNLNLSQALTFTQTLLNCNG 60
Query: 56 TIFFTGVGKSGFVANKISQTLISLGIKSGFLNPLDALHGDIGILSSDDILVMFSKSGNTE 115
TIFF+GVGKSGFVANKISQTLISLGI++GFL+P+DALHGDIG LSS DILV+FSKSGNTE
Sbjct: 61 TIFFSGVGKSGFVANKISQTLISLGIRAGFLSPVDALHGDIGALSSSDILVLFSKSGNTE 120
Query: 116 ELLKVVPCAKAKGAYLVSVTSVEGNALAAVCDMNVHLPVERELCPFDLAPVTSTAIQMVF 175
ELL++VPCAKAKGAYLVSVTSVEGNAL AVCDMNVHLP+ERELCPFDLAPVTSTAIQMVF
Sbjct: 121 ELLRLVPCAKAKGAYLVSVTSVEGNALTAVCDMNVHLPLERELCPFDLAPVTSTAIQMVF 180
Query: 176 GDTVAIAMMGARNLTRDEYAANHPAGRIGKSLIFKVQDVMKPQKELPVCKEGDLIMDQLV 235
GDTVAIA+MGARNL+++EYAANHPAGRIGKSLIFKV+DVMK Q ELP+CKEGDLIMDQLV
Sbjct: 181 GDTVAIALMGARNLSKEEYAANHPAGRIGKSLIFKVKDVMKKQNELPICKEGDLIMDQLV 240
Query: 236 ELTSKGCGCLLVIDEEYHLIGTFTDGDLRRTLKASGEGIFKLTVGEMCNRSPRTIGPDAM 295
ELTSKGCGCLLVIDE+ HLIGTFTDGDLRRTLKASGEGIFKLTVGEMCNR+PRTIGPDAM
Sbjct: 241 ELTSKGCGCLLVIDEDSHLIGTFTDGDLRRTLKASGEGIFKLTVGEMCNRNPRTIGPDAM 300
Query: 296 AVEAMQKMESPPSPVQFLPVINRQNILIGIVTLHGLVSAGL 336
AVEAM+KMESPPSPVQFLPVI NILIGIVTLHGLVSAGL
Sbjct: 301 AVEAMKKMESPPSPVQFLPVIKDDNILIGIVTLHGLVSAGL 341
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224066237|ref|XP_002302040.1| predicted protein [Populus trichocarpa] gi|118483855|gb|ABK93818.1| unknown [Populus trichocarpa] gi|222843766|gb|EEE81313.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255582507|ref|XP_002532039.1| Polysialic acid capsule expression protein kpsF, putative [Ricinus communis] gi|223528309|gb|EEF30355.1| Polysialic acid capsule expression protein kpsF, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449468558|ref|XP_004151988.1| PREDICTED: probable arabinose 5-phosphate isomerase-like [Cucumis sativus] gi|449524494|ref|XP_004169257.1| PREDICTED: probable arabinose 5-phosphate isomerase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225438103|ref|XP_002277616.1| PREDICTED: probable arabinose 5-phosphate isomerase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356572264|ref|XP_003554289.1| PREDICTED: probable arabinose 5-phosphate isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297816764|ref|XP_002876265.1| sugar isomerase domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322103|gb|EFH52524.1| sugar isomerase domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15232565|ref|NP_191029.1| sugar isomerase domain-containing protein [Arabidopsis thaliana] gi|75182157|sp|Q9M1T1.1|SETH3_ARATH RecName: Full=Probable arabinose 5-phosphate isomerase; Short=API; AltName: Full=CBS domain-containing protein CBSSIS1 gi|7258373|emb|CAB77589.1| sugar-phosphate isomerase-like protein [Arabidopsis thaliana] gi|110742297|dbj|BAE99073.1| sugar-phosphate isomerase - like protein [Arabidopsis thaliana] gi|332645746|gb|AEE79267.1| sugar isomerase domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|294460481|gb|ADE75818.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|297744159|emb|CBI37129.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| TAIR|locus:2102440 | 350 | SETH3 [Arabidopsis thaliana (t | 0.961 | 0.922 | 0.786 | 1.5e-136 | |
| UNIPROTKB|Q4KI82 | 324 | kdsD "Arabinose 5-phosphate is | 0.928 | 0.962 | 0.361 | 2.4e-53 | |
| UNIPROTKB|Q47VI6 | 321 | CPS_4538 "Arabinose 5-phosphat | 0.851 | 0.890 | 0.356 | 5.6e-52 | |
| TIGR_CMR|CPS_4538 | 321 | CPS_4538 "KpsF/GutQ family pro | 0.851 | 0.890 | 0.356 | 5.6e-52 | |
| UNIPROTKB|Q83DI1 | 324 | CBU_0750 "Arabinose 5-phosphat | 0.863 | 0.895 | 0.358 | 7.2e-52 | |
| TIGR_CMR|CBU_0750 | 324 | CBU_0750 "KpsF/GutQ family pro | 0.863 | 0.895 | 0.358 | 7.2e-52 | |
| TIGR_CMR|SO_3956 | 325 | SO_3956 "carbohydrate isomeras | 0.925 | 0.956 | 0.350 | 1.2e-51 | |
| UNIPROTKB|Q9KP53 | 326 | VC_2523 "Arabinose 5-phosphate | 0.958 | 0.987 | 0.324 | 1.4e-48 | |
| TIGR_CMR|VC_2523 | 326 | VC_2523 "conserved hypothetica | 0.958 | 0.987 | 0.324 | 1.4e-48 | |
| TIGR_CMR|CJE_1617 | 315 | CJE_1617 "arabinose-5-phosphat | 0.824 | 0.879 | 0.368 | 5.4e-47 |
| TAIR|locus:2102440 SETH3 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1337 (475.7 bits), Expect = 1.5e-136, P = 1.5e-136
Identities = 254/323 (78%), Positives = 289/323 (89%)
Query: 14 KVSENTLLDLFKSQQDHLNYFFQHLSLPHTLTFTQTLLKCRGTIFFTGVGKSGFVANKIS 73
++S + LL+LFKSQQD LN+FF+HL L TL F++ LL GT+FFTGVGKS FVANK+S
Sbjct: 28 EISHDNLLNLFKSQQDLLNHFFKHLDLSQTLDFSRILLSTTGTVFFTGVGKSAFVANKVS 87
Query: 74 QTLISLGIKSGFLNPLDALHGDIGILSSDDILVMFSKSGNTEELLKVVPCAKAKGAYLVS 133
QTL+SL +S FL+PLDALHGDIG LS D+LV FSKSG TEELL++VPCA+AKGA+LVS
Sbjct: 88 QTLVSLSFRSSFLSPLDALHGDIGALSPRDVLVFFSKSGATEELLRLVPCARAKGAFLVS 147
Query: 134 VTSVEGNALAAVCDMNVHLPVERELCPFDLAPVTSTAIQMVFGDTVAIAMMGARNLTRDE 193
+TSV GN LA VCDMNVHLP++RELCPF+LAPVTSTAIQMVFGDT+A+A+M ARNL+++E
Sbjct: 148 LTSVSGNPLAGVCDMNVHLPLQRELCPFNLAPVTSTAIQMVFGDTIAVALMAARNLSKEE 207
Query: 194 YAANHPAGRIGKSLIFKVQDVMKPQKELPVCKEGDLIMDQLVELTSKGCGCLLVIDEEYH 253
YAANHPAGRIGKSLIFKV+DVMK Q+ELPVCKEGDLIMDQLVELTSKGCGCLLV+DE
Sbjct: 208 YAANHPAGRIGKSLIFKVKDVMKKQEELPVCKEGDLIMDQLVELTSKGCGCLLVVDEHSR 267
Query: 254 LIGTFTDGDLRRTLKASGEGIFKLTVGEMCNRSPRTIGPDAMAVEAMQKMESPPSPVQFL 313
LIGTFTDGDLRRTLKASGE IFKL+VGEMCNR PRTIGP+ MAVEAM+KMESPPSPVQFL
Sbjct: 268 LIGTFTDGDLRRTLKASGEAIFKLSVGEMCNRKPRTIGPETMAVEAMKKMESPPSPVQFL 327
Query: 314 PVINRQNILIGIVTLHGLVSAGL 336
PV+N N LIGIVTLHGLVSAGL
Sbjct: 328 PVVNEDNTLIGIVTLHGLVSAGL 350
|
|
| UNIPROTKB|Q4KI82 kdsD "Arabinose 5-phosphate isomerase" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q47VI6 CPS_4538 "Arabinose 5-phosphate isomerase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4538 CPS_4538 "KpsF/GutQ family protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q83DI1 CBU_0750 "Arabinose 5-phosphate isomerase" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0750 CBU_0750 "KpsF/GutQ family protein" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_3956 SO_3956 "carbohydrate isomerase, KpsF/GutQ family" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KP53 VC_2523 "Arabinose 5-phosphate isomerase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2523 VC_2523 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_1617 CJE_1617 "arabinose-5-phosphate isomerase" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_V1283 | hypothetical protein (341 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_fgenesh4_pg.C_LG_V1151 | • | • | • | • | 0.898 | ||||||
| estExt_fgenesh4_pg.C_LG_II0575 | • | • | • | • | 0.897 | ||||||
| eugene3.01070060 | • | • | • | 0.846 | |||||||
| fgenesh4_pg.C_LG_XI000980 | • | • | • | 0.844 | |||||||
| eugene3.00160899 | • | • | • | 0.791 | |||||||
| estExt_fgenesh4_pg.C_LG_VI0968 | • | • | • | 0.751 | |||||||
| gw1.X.6418.1 | • | • | • | 0.658 | |||||||
| gw1.IV.2364.1 | • | • | • | 0.609 | |||||||
| gw1.XIII.2878.1 | • | • | 0.524 | ||||||||
| gw1.18032.1.1 | • | 0.504 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| TIGR00393 | 268 | TIGR00393, kpsF, KpsF/GutQ family protein | 8e-64 | |
| PRK11543 | 321 | PRK11543, gutQ, D-arabinose 5-phosphate isomerase; | 1e-59 | |
| COG0794 | 202 | COG0794, GutQ, Predicted sugar phosphate isomerase | 5e-57 | |
| cd05014 | 128 | cd05014, SIS_Kpsf, KpsF-like protein | 2e-55 | |
| PRK10892 | 326 | PRK10892, PRK10892, D-arabinose 5-phosphate isomer | 2e-53 | |
| cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain | 5e-38 | |
| cd05013 | 139 | cd05013, SIS_RpiR, RpiR-like protein | 5e-19 | |
| pfam01380 | 131 | pfam01380, SIS, SIS domain | 5e-19 | |
| COG1737 | 281 | COG1737, RpiR, Transcriptional regulators [Transcr | 1e-16 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 8e-16 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 2e-14 | |
| TIGR03127 | 179 | TIGR03127, RuMP_HxlB, 6-phospho 3-hexuloisomerase | 2e-12 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 3e-12 | |
| cd05005 | 179 | cd05005, SIS_PHI, Hexulose-6-phosphate isomerase ( | 1e-10 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 1e-10 | |
| COG2222 | 340 | COG2222, AgaS, Predicted phosphosugar isomerases [ | 4e-10 | |
| cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after | 5e-10 | |
| cd04643 | 116 | cd04643, CBS_pair_30, The CBS domain, named after | 7e-09 | |
| cd04587 | 113 | cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd | 9e-09 | |
| cd05008 | 126 | cd05008, SIS_GlmS_GlmD_1, SIS (Sugar ISomerase) do | 9e-09 | |
| cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c | 1e-08 | |
| cd05006 | 177 | cd05006, SIS_GmhA, Phosphoheptose isomerase is a m | 4e-08 | |
| cd04613 | 114 | cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con | 2e-07 | |
| cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after h | 2e-07 | |
| PRK14101 | 638 | PRK14101, PRK14101, bifunctional glucokinase/RpiR | 6e-07 | |
| cd04593 | 115 | cd04593, CBS_pair_EriC_assoc_bac_arch, This cd con | 9e-07 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-06 | |
| cd04795 | 87 | cd04795, SIS, SIS domain | 6e-06 | |
| cd05017 | 119 | cd05017, SIS_PGI_PMI_1, The members of this protei | 6e-06 | |
| cd04620 | 115 | cd04620, CBS_pair_7, The CBS domain, named after h | 9e-06 | |
| COG0279 | 176 | COG0279, GmhA, Phosphoheptose isomerase [Carbohydr | 2e-05 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 2e-05 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 2e-05 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 2e-05 | |
| cd05710 | 120 | cd05710, SIS_1, A subgroup of the SIS domain | 3e-05 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 4e-05 | |
| cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains | 4e-05 | |
| PRK11337 | 292 | PRK11337, PRK11337, DNA-binding transcriptional re | 5e-05 | |
| cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai | 6e-05 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 9e-05 | |
| PRK11557 | 278 | PRK11557, PRK11557, putative DNA-binding transcrip | 1e-04 | |
| PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent i | 4e-04 | |
| cd04629 | 114 | cd04629, CBS_pair_16, The CBS domain, named after | 6e-04 | |
| cd04615 | 113 | cd04615, CBS_pair_2, The CBS domain, named after h | 6e-04 | |
| TIGR00441 | 154 | TIGR00441, gmhA, phosphoheptose isomerase | 0.001 | |
| cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after | 0.001 | |
| COG4109 | 432 | COG4109, COG4109, Predicted transcriptional regula | 0.001 | |
| cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai | 0.002 | |
| cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after | 0.002 | |
| PRK08674 | 337 | PRK08674, PRK08674, bifunctional phosphoglucose/ph | 0.002 | |
| PLN02981 | 680 | PLN02981, PLN02981, glucosamine:fructose-6-phospha | 0.002 | |
| cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two | 0.002 | |
| PRK13937 | 188 | PRK13937, PRK13937, phosphoheptose isomerase; Prov | 0.002 | |
| cd04801 | 114 | cd04801, CBS_pair_M50_like, This cd contains two t | 0.003 | |
| cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two | 0.004 |
| >gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein | Back alignment and domain information |
|---|
Score = 203 bits (517), Expect = 8e-64
Identities = 99/272 (36%), Positives = 162/272 (59%), Gaps = 5/272 (1%)
Query: 55 GTIFFTGVGKSGFVANKISQTLISLGIKSGFLNPLDALHGDIGILSSDDILVMFSKSGNT 114
G + G+GKSG + KI T S G S FL+P +A+HGD+G++ +D+++M S SG +
Sbjct: 1 GKLVIVGIGKSGLIGKKIVATFASTGTPSFFLHPTEAMHGDLGMVEPNDVVLMISYSGES 60
Query: 115 EELLKVVPCAKAKGAYLVSVTSVEGNALAAVCDMNVHLPVERELCPFDLAPVTSTAIQMV 174
ELL ++P K +++ T ++LA D + + VE+E CP +LAP TST + +
Sbjct: 61 LELLNLIPHLKRLSHKIIAFTGSPNSSLARAADYVLDIKVEKEACPINLAPTTSTTLTLA 120
Query: 175 FGDTVAIAMMGARNLTRDEYAANHPAGRIGKSLIFKVQDVMKPQKELPVCKEGDLIMDQL 234
GD +A+A+M ARN +++++A+ HP G +G+ L+ KV+D+M+ +LP+ D L
Sbjct: 121 LGDALAVALMRARNFSQEDFASFHPGGALGRKLLVKVKDLMQ-TTDLPLIAPTTSFKDAL 179
Query: 235 VELTSKGCGCLLVIDEEYHLIGTFTDGDLRRTLKASGEGIFKLTVGEMCNRSPRTIGPDA 294
+E++ K G +V DE L+G FTDGDLRR L G G K V + P+T DA
Sbjct: 180 LEMSEKRLGSAIVCDENNQLVGVFTDGDLRRAL--LGGGSLKSEVRDFMTLGPKTFKLDA 237
Query: 295 MAVEAMQKMESPPSPVQFLPVINRQNILIGIV 326
+ +EA++ +E + L V++ N ++G++
Sbjct: 238 LLLEALEFLER--RKITSLVVVDDHNKVLGVL 267
|
This model describes a number of closely related proteins with the phosphosugar-binding domain SIS (Sugar ISomerase) followed by two copies of the CBS (named after Cystathionine Beta Synthase) domain. One is GutQ, a protein of the glucitol operon. Another is KpsF, a virulence factor involved in capsular polysialic acid biosynthesis in some pathogenic strains of E. coli [Energy metabolism, Sugars]. Length = 268 |
| >gnl|CDD|183186 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223865 COG0794, GutQ, Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|240145 cd05014, SIS_Kpsf, KpsF-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|182814 PRK10892, PRK10892, D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >gnl|CDD|240144 cd05013, SIS_RpiR, RpiR-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|216466 pfam01380, SIS, SIS domain | Back alignment and domain information |
|---|
| >gnl|CDD|224651 COG1737, RpiR, Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|132171 TIGR03127, RuMP_HxlB, 6-phospho 3-hexuloisomerase | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240138 cd05005, SIS_PHI, Hexulose-6-phosphate isomerase (PHI) | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225132 COG2222, AgaS, Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240014 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240141 cd05008, SIS_GlmS_GlmD_1, SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) | Back alignment and domain information |
|---|
| >gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240139 cd05006, SIS_GmhA, Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|184507 PRK14101, PRK14101, bifunctional glucokinase/RpiR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239966 cd04593, CBS_pair_EriC_assoc_bac_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|240112 cd04795, SIS, SIS domain | Back alignment and domain information |
|---|
| >gnl|CDD|240148 cd05017, SIS_PGI_PMI_1, The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions | Back alignment and domain information |
|---|
| >gnl|CDD|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223356 COG0279, GmhA, Phosphoheptose isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|240214 cd05710, SIS_1, A subgroup of the SIS domain | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >gnl|CDD|183089 PRK11337, PRK11337, DNA-binding transcriptional repressor RpiR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|183195 PRK11557, PRK11557, putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|129533 TIGR00441, gmhA, phosphoheptose isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|226594 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|181536 PRK08674, PRK08674, bifunctional phosphoglucose/phosphomannose isomerase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215531 PLN02981, PLN02981, glucosamine:fructose-6-phosphate aminotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >gnl|CDD|184408 PRK13937, PRK13937, phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240114 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 100.0 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 100.0 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 100.0 | |
| COG0794 | 202 | GutQ Predicted sugar phosphate isomerase involved | 99.97 | |
| COG1737 | 281 | RpiR Transcriptional regulators [Transcription] | 99.96 | |
| cd05005 | 179 | SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI | 99.96 | |
| TIGR03127 | 179 | RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of | 99.96 | |
| PRK15482 | 285 | transcriptional regulator MurR; Provisional | 99.95 | |
| PRK11557 | 278 | putative DNA-binding transcriptional regulator; Pr | 99.95 | |
| PRK11337 | 292 | DNA-binding transcriptional repressor RpiR; Provis | 99.95 | |
| PRK11302 | 284 | DNA-binding transcriptional regulator HexR; Provis | 99.93 | |
| cd05014 | 128 | SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 | 99.91 | |
| PRK14101 | 638 | bifunctional glucokinase/RpiR family transcription | 99.9 | |
| PRK02947 | 246 | hypothetical protein; Provisional | 99.88 | |
| cd05013 | 139 | SIS_RpiR RpiR-like protein. RpiR contains a SIS (S | 99.88 | |
| PF01380 | 131 | SIS: SIS domain SIS domain web page.; InterPro: IP | 99.86 | |
| cd05008 | 126 | SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repea | 99.86 | |
| cd05006 | 177 | SIS_GmhA Phosphoheptose isomerase is a member of t | 99.85 | |
| PRK00414 | 192 | gmhA phosphoheptose isomerase; Reviewed | 99.83 | |
| PRK13936 | 197 | phosphoheptose isomerase; Provisional | 99.83 | |
| PRK05441 | 299 | murQ N-acetylmuramic acid-6-phosphate etherase; Re | 99.82 | |
| TIGR00441 | 154 | gmhA phosphoheptose isomerase. Involved in lipopol | 99.82 | |
| cd05710 | 120 | SIS_1 A subgroup of the SIS domain. SIS (Sugar ISo | 99.81 | |
| PRK13937 | 188 | phosphoheptose isomerase; Provisional | 99.81 | |
| PRK10886 | 196 | DnaA initiator-associating protein DiaA; Provision | 99.8 | |
| PRK13938 | 196 | phosphoheptose isomerase; Provisional | 99.8 | |
| cd05007 | 257 | SIS_Etherase N-acetylmuramic acid 6-phosphate ethe | 99.8 | |
| PRK00331 | 604 | glucosamine--fructose-6-phosphate aminotransferase | 99.8 | |
| TIGR00274 | 291 | N-acetylmuramic acid 6-phosphate etherase. This pr | 99.8 | |
| PRK11382 | 340 | frlB fructoselysine-6-P-deglycase; Provisional | 99.78 | |
| TIGR01135 | 607 | glmS glucosamine--fructose-6-phosphate aminotransf | 99.77 | |
| PTZ00295 | 640 | glucosamine-fructose-6-phosphate aminotransferase; | 99.76 | |
| PLN02981 | 680 | glucosamine:fructose-6-phosphate aminotransferase | 99.76 | |
| PTZ00394 | 670 | glucosamine-fructose-6-phosphate aminotransferase; | 99.76 | |
| PRK12570 | 296 | N-acetylmuramic acid-6-phosphate etherase; Reviewe | 99.75 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.75 | |
| cd05017 | 119 | SIS_PGI_PMI_1 The members of this protein family c | 99.71 | |
| cd05009 | 153 | SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repea | 99.71 | |
| COG2222 | 340 | AgaS Predicted phosphosugar isomerases [Cell envel | 99.7 | |
| TIGR02815 | 372 | agaS_fam putative sugar isomerase, AgaS family. So | 99.69 | |
| COG0449 | 597 | GlmS Glucosamine 6-phosphate synthetase, contains | 99.66 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.66 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.66 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.65 | |
| COG0279 | 176 | GmhA Phosphoheptose isomerase [Carbohydrate transp | 99.65 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.63 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.62 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.61 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.61 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.6 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.6 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.6 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.59 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.59 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.59 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.58 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.58 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.58 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.58 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.58 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.57 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.57 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.57 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.57 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.57 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.56 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.56 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.56 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.56 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.56 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.56 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.56 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.56 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.56 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.55 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.55 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.55 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.55 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.55 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.55 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.54 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.54 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.54 | |
| PRK08674 | 337 | bifunctional phosphoglucose/phosphomannose isomera | 99.54 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.54 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.54 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.53 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.53 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.53 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.53 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.52 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.52 | |
| cd04795 | 87 | SIS SIS domain. SIS (Sugar ISomerase) domains are | 99.52 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.52 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.52 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.52 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.51 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.51 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.51 | |
| PF13580 | 138 | SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_ | 99.51 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.5 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.5 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.5 | |
| COG4821 | 243 | Uncharacterized protein containing SIS (Sugar ISom | 99.49 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.49 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.49 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.48 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.47 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.46 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.46 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.46 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.46 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.46 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.45 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.45 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.44 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.42 | |
| TIGR02128 | 308 | G6PI_arch bifunctional phosphoglucose/phosphomanno | 99.42 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.42 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.42 | |
| KOG1268 | 670 | consensus Glucosamine 6-phosphate synthetases, con | 99.41 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.4 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.4 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.39 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.39 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.39 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.39 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.38 | |
| cd05015 | 158 | SIS_PGI_1 Phosphoglucose isomerase (PGI) contains | 99.34 | |
| PTZ00295 | 640 | glucosamine-fructose-6-phosphate aminotransferase; | 99.34 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.33 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.32 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.28 | |
| COG2103 | 298 | Predicted sugar phosphate isomerase [General funct | 99.26 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.24 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.22 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 99.2 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.14 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 99.09 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 99.01 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.99 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.9 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.85 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.84 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 98.84 | |
| PTZ00394 | 670 | glucosamine-fructose-6-phosphate aminotransferase; | 98.76 | |
| COG0449 | 597 | GlmS Glucosamine 6-phosphate synthetase, contains | 98.66 | |
| TIGR01135 | 607 | glmS glucosamine--fructose-6-phosphate aminotransf | 98.63 | |
| PRK00331 | 604 | glucosamine--fructose-6-phosphate aminotransferase | 98.6 | |
| PF10740 | 172 | DUF2529: Protein of unknown function (DUF2529); In | 98.5 | |
| PLN02981 | 680 | glucosamine:fructose-6-phosphate aminotransferase | 98.43 | |
| cd05010 | 151 | SIS_AgaS_like AgaS-like protein. AgaS contains a S | 98.41 | |
| PRK11382 | 340 | frlB fructoselysine-6-P-deglycase; Provisional | 98.34 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 98.34 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 98.3 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 98.27 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.25 | |
| COG2222 | 340 | AgaS Predicted phosphosugar isomerases [Cell envel | 98.25 | |
| PRK03868 | 410 | glucose-6-phosphate isomerase; Provisional | 98.24 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.22 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.15 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 98.11 | |
| PRK00973 | 446 | glucose-6-phosphate isomerase; Provisional | 98.1 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.07 | |
| TIGR02815 | 372 | agaS_fam putative sugar isomerase, AgaS family. So | 98.04 | |
| PRK14096 | 528 | pgi glucose-6-phosphate isomerase; Provisional | 98.03 | |
| PRK09533 | 948 | bifunctional transaldolase/phosoglucose isomerase; | 98.03 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 98.0 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.94 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.92 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.91 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.9 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.89 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.88 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.87 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.87 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.86 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 97.84 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.83 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 97.82 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 97.82 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.82 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.81 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.8 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 97.8 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.79 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 97.79 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.79 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.79 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.78 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.77 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.77 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.77 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.75 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 97.75 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 97.75 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.74 | |
| PRK14095 | 533 | pgi glucose-6-phosphate isomerase; Provisional | 97.74 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.73 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.7 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.7 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.7 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.7 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.69 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 97.69 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.69 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 97.68 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.68 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 97.67 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 97.67 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.67 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 97.66 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.66 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.65 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.64 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 97.64 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.63 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.61 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 97.61 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.61 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.6 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.6 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.6 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.59 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 97.59 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 97.59 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 97.58 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.58 | |
| COG0166 | 446 | Pgi Glucose-6-phosphate isomerase [Carbohydrate tr | 97.56 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.55 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.53 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 97.52 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 97.52 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.51 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 97.49 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.49 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.45 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 97.44 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.41 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 97.38 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 97.35 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.35 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.32 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 97.3 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 97.3 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.28 | |
| PRK14097 | 448 | pgi glucose-6-phosphate isomerase; Provisional | 97.27 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.21 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.19 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 97.18 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.17 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 97.15 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 97.14 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.0 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 96.97 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.89 | |
| TIGR01012 | 196 | Sa_S2_E_A ribosomal protein Sa(cytosolic)/S2(archa | 96.88 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 96.86 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 96.82 | |
| PRK04020 | 204 | rps2P 30S ribosomal protein S2; Provisional | 96.73 | |
| PF00342 | 486 | PGI: Phosphoglucose isomerase The structure is C a | 96.63 | |
| PTZ00254 | 249 | 40S ribosomal protein SA; Provisional | 96.61 | |
| PRK00179 | 548 | pgi glucose-6-phosphate isomerase; Reviewed | 96.57 | |
| PLN02649 | 560 | glucose-6-phosphate isomerase | 96.41 | |
| PTZ00430 | 552 | glucose-6-phosphate isomerase; Provisional | 96.21 | |
| cd01425 | 193 | RPS2 Ribosomal protein S2 (RPS2), involved in form | 96.21 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.16 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 96.13 | |
| PRK05299 | 258 | rpsB 30S ribosomal protein S2; Provisional | 95.83 | |
| cd02767 | 574 | MopB_ydeP The MopB_ydeP CD includes a group of rel | 95.68 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 95.44 | |
| TIGR00315 | 162 | cdhB CO dehydrogenase/acetyl-CoA synthase complex, | 95.42 | |
| TIGR01011 | 225 | rpsB_bact ribosomal protein S2, bacterial type. TI | 95.38 | |
| PRK12311 | 326 | rpsB 30S ribosomal protein S2/unknown domain fusio | 95.32 | |
| TIGR01701 | 743 | Fdhalpha-like oxidoreductase alpha (molybdopterin) | 95.19 | |
| KOG1268 | 670 | consensus Glucosamine 6-phosphate synthetases, con | 95.15 | |
| COG0052 | 252 | RpsB Ribosomal protein S2 [Translation, ribosomal | 95.11 | |
| CHL00067 | 230 | rps2 ribosomal protein S2 | 95.09 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 94.95 | |
| PRK09939 | 759 | putative oxidoreductase; Provisional | 94.64 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 94.49 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 94.24 | |
| PF00318 | 211 | Ribosomal_S2: Ribosomal protein S2; InterPro: IPR0 | 93.84 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 93.42 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 93.42 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 93.19 | |
| PF10087 | 97 | DUF2325: Uncharacterized protein conserved in bact | 92.66 | |
| PRK00945 | 171 | acetyl-CoA decarbonylase/synthase complex subunit | 92.23 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 92.21 | |
| TIGR01553 | 1009 | formate-DH-alph formate dehydrogenase, alpha subun | 92.14 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 91.76 | |
| TIGR01591 | 671 | Fdh-alpha formate dehydrogenase, alpha subunit, ar | 90.59 | |
| cd02753 | 512 | MopB_Formate-Dh-H Formate dehydrogenase H (Formate | 90.49 | |
| cd02759 | 477 | MopB_Acetylene-hydratase The MopB_Acetylene-hydrat | 90.37 | |
| PF01936 | 146 | NYN: NYN domain; InterPro: IPR021139 This highly c | 90.22 | |
| TIGR00288 | 160 | conserved hypothetical protein TIGR00288. This fam | 90.13 | |
| cd02754 | 565 | MopB_Nitrate-R-NapA-like Nitrate reductases, NapA | 89.91 | |
| cd02750 | 461 | MopB_Nitrate-R-NarG-like Respiratory nitrate reduc | 89.78 | |
| PRK13532 | 830 | nitrate reductase catalytic subunit; Provisional | 89.72 | |
| cd02755 | 454 | MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-lik | 89.58 | |
| cd02762 | 539 | MopB_1 The MopB_1 CD includes a group of related u | 89.42 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 88.85 | |
| cd02766 | 501 | MopB_3 The MopB_3 CD includes a group of related u | 88.78 | |
| cd02752 | 649 | MopB_Formate-Dh-Na-like Formate dehydrogenase N, a | 88.32 | |
| KOG2446 | 546 | consensus Glucose-6-phosphate isomerase [Carbohydr | 88.29 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 88.23 | |
| PF13793 | 116 | Pribosyltran_N: N-terminal domain of ribose phosph | 88.17 | |
| TIGR03479 | 912 | DMSO_red_II_alp DMSO reductase family type II enzy | 88.15 | |
| PRK06702 | 432 | O-acetylhomoserine aminocarboxypropyltransferase; | 87.99 | |
| cd02765 | 567 | MopB_4 The MopB_4 CD includes a group of related u | 87.85 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 87.63 | |
| cd06167 | 149 | LabA_like LabA_like proteins. A well conserved gro | 87.21 | |
| cd02770 | 617 | MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the D | 87.0 | |
| cd02763 | 679 | MopB_2 The MopB_2 CD includes a group of related u | 86.99 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 86.5 | |
| cd02761 | 415 | MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the | 86.39 | |
| KOG0832 | 251 | consensus Mitochondrial/chloroplast ribosomal prot | 86.11 | |
| TIGR01706 | 830 | NAPA periplasmic nitrate reductase, large subunit. | 86.04 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 85.95 | |
| TIGR02166 | 797 | dmsA_ynfE anaerobic dimethyl sulfoxide reductase, | 85.75 | |
| cd01410 | 206 | SIRT7 SIRT7: Eukaryotic and prokaryotic group (cla | 84.55 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 84.1 | |
| PF08484 | 160 | Methyltransf_14: C-methyltransferase C-terminal do | 83.95 | |
| cd01409 | 260 | SIRT4 SIRT4: Eukaryotic and prokaryotic group (cla | 83.89 | |
| cd02757 | 523 | MopB_Arsenate-R This CD includes the respiratory a | 83.64 | |
| cd01413 | 222 | SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group | 83.46 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 82.27 | |
| PRK07199 | 301 | phosphoribosylpyrophosphate synthetase; Provisiona | 81.63 | |
| PRK00553 | 332 | ribose-phosphate pyrophosphokinase; Provisional | 81.22 | |
| PRK14138 | 244 | NAD-dependent deacetylase; Provisional | 81.15 | |
| PRK09271 | 160 | flavodoxin; Provisional | 81.08 | |
| PRK02458 | 323 | ribose-phosphate pyrophosphokinase; Provisional | 80.87 | |
| cd02760 | 760 | MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA | 80.76 | |
| PRK15488 | 759 | thiosulfate reductase PhsA; Provisional | 80.73 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 80.49 | |
| TIGR03590 | 279 | PseG pseudaminic acid biosynthesis-associated prot | 80.25 | |
| TIGR01754 | 140 | flav_RNR ribonucleotide reductase-associated flavo | 80.13 | |
| COG1832 | 140 | Predicted CoA-binding protein [General function pr | 80.1 | |
| PTZ00409 | 271 | Sir2 (Silent Information Regulator) protein; Provi | 80.07 |
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.1e-47 Score=344.31 Aligned_cols=314 Identities=31% Similarity=0.554 Sum_probs=281.1
Q ss_pred HHHHHHHHHHHHHHHHHHhcCChhHHHHHHHHHHcCCCeEEEEeccchHHHHHHHHHHHHhcCCeeeecCCccccccccC
Q 019775 18 NTLLDLFKSQQDHLNYFFQHLSLPHTLTFTQTLLKCRGTIFFTGVGKSGFVANKISQTLISLGIKSGFLNPLDALHGDIG 97 (336)
Q Consensus 18 ~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~~~i~~a~~~I~i~G~G~s~~~a~~~~~~l~~~g~~~~~~~~~~~~~~~~~ 97 (336)
++..+.+...++.++++++.++ +++.++++.+.+++++||++|.|.|+.+|++|+++|.++|+++.++++.+.+.....
T Consensus 7 ~~~~~~~~~~~~~~~~~~~~l~-~~~~~~~~~l~~~~~~I~i~G~G~S~~~A~~~~~~l~~~g~~~~~~~~~~~~~~~~~ 85 (321)
T PRK11543 7 NAGRQTLMLELQEASRLPERLG-DDFVRAANIILHCEGKVVVSGIGKSGHIGKKIAATLASTGTPAFFVHPAEALHGDLG 85 (321)
T ss_pred HHHHHHHHHHHHHHHHHHHhcc-HHHHHHHHHHHhcCCcEEEEecChhHHHHHHHHHHHHcCCCceeecChHHHhhCCcC
Confidence 4455666777777788888877 679999999988734999999999999999999999999999999988777777778
Q ss_pred CCCCCcEEEEEeCCCCcHHHHHHHHHHHHcCCeEEEEeCCCCCccccccCEEEEcCCCcccCCCCCCChhHHHHHHHHHH
Q 019775 98 ILSSDDILVMFSKSGNTEELLKVVPCAKAKGAYLVSVTSVEGNALAAVCDMNVHLPVERELCPFDLAPVTSTAIQMVFGD 177 (336)
Q Consensus 98 ~~~~~dlvi~iS~sG~~~~~~~~~~~ak~~g~~vi~IT~~~~s~l~~~ad~~i~~~~~~~~~~~~~~~~~s~~~~~~l~d 177 (336)
.++++|++|+||+||++++++++++.||++|+++|+||++.+||++++||+++.++...+...+...++++.++.+++.|
T Consensus 86 ~~~~~d~~i~iS~sG~t~~~~~~~~~ak~~g~~vI~iT~~~~s~la~~ad~~l~~~~~~~~~~~~~~~~ss~~~~~~~~d 165 (321)
T PRK11543 86 MIESRDVMLFISYSGGAKELDLIIPRLEDKSIALLAMTGKPTSPLGLAAKAVLDISVEREACPMHLAPTSSTVNTLMMGD 165 (321)
T ss_pred ccCCCCEEEEEeCCCCcHHHHHHHHHHHHcCCeEEEEECCCCChhHHhCCEEEEcCCccccCCCCCCcHHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999998754423445678999999999999
Q ss_pred HHHHHHHhhcCCChHHHhhcCCCCchhhhhhhhhhhccccCCCCccccCCCcHHHHHHHHHhcCcceEEEEcCCCcEEEE
Q 019775 178 TVAIAMMGARNLTRDEYAANHPAGRIGKSLIFKVQDVMKPQKELPVCKEGDLIMDQLVELTSKGCGCLLVIDEEYHLIGT 257 (336)
Q Consensus 178 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~im~~~~~~~~~~~~~~v~~~~~~~~~~~~~~ipVvd~~~~~~G~ 257 (336)
.|+..+..+.+...++|.+.|+.+.+++.+.++|+++|.++.++++++++.++.++.+.|.+++...+||+|++|+++|+
T Consensus 166 sL~~~~l~~~g~~~~~~~~~~~~~~l~~~~~~~V~~im~~~~~~~~v~~~~sv~~a~~~~~~~~~~~~~Vvd~~g~~iG~ 245 (321)
T PRK11543 166 ALAMAVMQARGFNEEDFARSHPAGALGARLLNKVHHLMRRDDAIPQVALTASVMDAMLELSRTGLGLVAVCDAQQQVQGV 245 (321)
T ss_pred HHHHHHHHHcCCCHHHhccCCCCCHHHHHHHhHHHHHhccCCCCcEeCCCCCHHHHHHHHHHcCCCEEEEEcCCCcEEEE
Confidence 99999999999999999999999999988889999999997445699999999999999998888999999999999999
Q ss_pred eeHHHHHHHHHhcCCchhhhhHhhhcCCCCeeeCCCccHHHHHHHhcCCCCCccEeEEEeCCCcEEEEEehhhHhhcCC
Q 019775 258 FTDGDLRRTLKASGEGIFKLTVGEMCNRSPRTIGPDAMAVEAMQKMESPPSPVQFLPVINRQNILIGIVTLHGLVSAGL 336 (336)
Q Consensus 258 it~~dl~~~~~~~~~~~~~~~i~~~~~~~~~~v~~~~~l~~~~~~~~~~~~~~~~l~Vv~~~~~~iGiit~~di~~~~~ 336 (336)
|+..|+...+..... ...++.++|.+++.++.+++++.++++.|.++ +...+||+|++|+++|+||+.|++++|.
T Consensus 246 vt~~dl~~~~~~~~~--~~~~v~~im~~~~~~v~~~~~l~~a~~~m~~~--~~~~lpVvd~~~~lvGvIt~~di~~~~~ 320 (321)
T PRK11543 246 FTDGDLRRWLVGGGA--LTTPVNEAMTRGGTTLQAQSRAIDAKEILMKR--KITAAPVVDENGKLTGAINLQDFYQAGI 320 (321)
T ss_pred ecHHHHHHHHhCCCC--cCCcHHHhcCCCCEEECCCCCHHHHHHHHHHc--CCCEEEEEcCCCeEEEEEEHHHHHhccC
Confidence 999999886643221 24568899999999999999999999999999 9999999998899999999999999984
|
|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >COG0794 GutQ Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1737 RpiR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) | Back alignment and domain information |
|---|
| >TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase | Back alignment and domain information |
|---|
| >PRK15482 transcriptional regulator MurR; Provisional | Back alignment and domain information |
|---|
| >PRK11557 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11337 DNA-binding transcriptional repressor RpiR; Provisional | Back alignment and domain information |
|---|
| >PRK11302 DNA-binding transcriptional regulator HexR; Provisional | Back alignment and domain information |
|---|
| >cd05014 SIS_Kpsf KpsF-like protein | Back alignment and domain information |
|---|
| >PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK02947 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05013 SIS_RpiR RpiR-like protein | Back alignment and domain information |
|---|
| >PF01380 SIS: SIS domain SIS domain web page | Back alignment and domain information |
|---|
| >cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) | Back alignment and domain information |
|---|
| >cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily | Back alignment and domain information |
|---|
| >PRK00414 gmhA phosphoheptose isomerase; Reviewed | Back alignment and domain information |
|---|
| >PRK13936 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00441 gmhA phosphoheptose isomerase | Back alignment and domain information |
|---|
| >cd05710 SIS_1 A subgroup of the SIS domain | Back alignment and domain information |
|---|
| >PRK13937 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10886 DnaA initiator-associating protein DiaA; Provisional | Back alignment and domain information |
|---|
| >PRK13938 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >cd05007 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase | Back alignment and domain information |
|---|
| >PRK00331 glucosamine--fructose-6-phosphate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00274 N-acetylmuramic acid 6-phosphate etherase | Back alignment and domain information |
|---|
| >PRK11382 frlB fructoselysine-6-P-deglycase; Provisional | Back alignment and domain information |
|---|
| >TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase (isomerizing) | Back alignment and domain information |
|---|
| >PTZ00295 glucosamine-fructose-6-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02981 glucosamine:fructose-6-phosphate aminotransferase | Back alignment and domain information |
|---|
| >PTZ00394 glucosamine-fructose-6-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12570 N-acetylmuramic acid-6-phosphate etherase; Reviewed | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd05017 SIS_PGI_PMI_1 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions | Back alignment and domain information |
|---|
| >cd05009 SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) | Back alignment and domain information |
|---|
| >COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02815 agaS_fam putative sugar isomerase, AgaS family | Back alignment and domain information |
|---|
| >COG0449 GlmS Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0279 GmhA Phosphoheptose isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >PRK08674 bifunctional phosphoglucose/phosphomannose isomerase; Validated | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04795 SIS SIS domain | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >PF13580 SIS_2: SIS domain; PDB: 1TK9_C 2I22_B 2I2W_A 1X92_A 3BJZ_D 2XBL_B 2X3Y_F 2YVA_B 3CVJ_D 3TRJ_D | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4821 Uncharacterized protein containing SIS (Sugar ISomerase) phosphosugar binding domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02128 G6PI_arch bifunctional phosphoglucose/phosphomannose isomerase | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >KOG1268 consensus Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd05015 SIS_PGI_1 Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains | Back alignment and domain information |
|---|
| >PTZ00295 glucosamine-fructose-6-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2103 Predicted sugar phosphate isomerase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00394 glucosamine-fructose-6-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0449 GlmS Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase (isomerizing) | Back alignment and domain information |
|---|
| >PRK00331 glucosamine--fructose-6-phosphate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >PF10740 DUF2529: Protein of unknown function (DUF2529); InterPro: IPR019676 This entry represents a protein family conserved in the Bacillales | Back alignment and domain information |
|---|
| >PLN02981 glucosamine:fructose-6-phosphate aminotransferase | Back alignment and domain information |
|---|
| >cd05010 SIS_AgaS_like AgaS-like protein | Back alignment and domain information |
|---|
| >PRK11382 frlB fructoselysine-6-P-deglycase; Provisional | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK03868 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00973 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR02815 agaS_fam putative sugar isomerase, AgaS family | Back alignment and domain information |
|---|
| >PRK14096 pgi glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK09533 bifunctional transaldolase/phosoglucose isomerase; Validated | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK14095 pgi glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0166 Pgi Glucose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14097 pgi glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01012 Sa_S2_E_A ribosomal protein Sa(cytosolic)/S2(archaeal) | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK04020 rps2P 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >PF00342 PGI: Phosphoglucose isomerase The structure is C alpha atoms only with no sequence assignment | Back alignment and domain information |
|---|
| >PTZ00254 40S ribosomal protein SA; Provisional | Back alignment and domain information |
|---|
| >PRK00179 pgi glucose-6-phosphate isomerase; Reviewed | Back alignment and domain information |
|---|
| >PLN02649 glucose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PTZ00430 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd01425 RPS2 Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05299 rpsB 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >cd02767 MopB_ydeP The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit | Back alignment and domain information |
|---|
| >TIGR01011 rpsB_bact ribosomal protein S2, bacterial type | Back alignment and domain information |
|---|
| >PRK12311 rpsB 30S ribosomal protein S2/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01701 Fdhalpha-like oxidoreductase alpha (molybdopterin) subunit | Back alignment and domain information |
|---|
| >KOG1268 consensus Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG0052 RpsB Ribosomal protein S2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >CHL00067 rps2 ribosomal protein S2 | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09939 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00318 Ribosomal_S2: Ribosomal protein S2; InterPro: IPR001865 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01553 formate-DH-alph formate dehydrogenase, alpha subunit, proteobacterial-type | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit, archaeal-type | Back alignment and domain information |
|---|
| >cd02753 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons | Back alignment and domain information |
|---|
| >cd02759 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins | Back alignment and domain information |
|---|
| >PF01936 NYN: NYN domain; InterPro: IPR021139 This highly conserved domain has no known function | Back alignment and domain information |
|---|
| >TIGR00288 conserved hypothetical protein TIGR00288 | Back alignment and domain information |
|---|
| >cd02754 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite | Back alignment and domain information |
|---|
| >cd02750 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins | Back alignment and domain information |
|---|
| >PRK13532 nitrate reductase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd02755 MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins | Back alignment and domain information |
|---|
| >cd02762 MopB_1 The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >cd02766 MopB_3 The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >cd02752 MopB_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E | Back alignment and domain information |
|---|
| >KOG2446 consensus Glucose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13793 Pribosyltran_N: N-terminal domain of ribose phosphate pyrophosphokinase; PDB: 2JI4_A 1DKU_B 1IBS_B 1DKR_B 3MBI_C 3LRT_B 3LPN_B 3NAG_B 2H07_B 2H06_B | Back alignment and domain information |
|---|
| >TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit | Back alignment and domain information |
|---|
| >PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >cd02765 MopB_4 The MopB_4 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd06167 LabA_like LabA_like proteins | Back alignment and domain information |
|---|
| >cd02770 MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes | Back alignment and domain information |
|---|
| >cd02763 MopB_2 The MopB_2 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins | Back alignment and domain information |
|---|
| >KOG0832 consensus Mitochondrial/chloroplast ribosomal protein S2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01706 NAPA periplasmic nitrate reductase, large subunit | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >TIGR02166 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family | Back alignment and domain information |
|---|
| >cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08484 Methyltransf_14: C-methyltransferase C-terminal domain; InterPro: IPR013691 This domain is found in bacterial C-methyltransferase proteins, often together with other methyltransferase domains such as IPR013216 from INTERPRO or IPR013217 from INTERPRO | Back alignment and domain information |
|---|
| >cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation | Back alignment and domain information |
|---|
| >cd02757 MopB_Arsenate-R This CD includes the respiratory arsenate reductase, As(V), catalytic subunit (ArrA) and other related proteins | Back alignment and domain information |
|---|
| >cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PRK07199 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00553 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14138 NAD-dependent deacetylase; Provisional | Back alignment and domain information |
|---|
| >PRK09271 flavodoxin; Provisional | Back alignment and domain information |
|---|
| >PRK02458 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd02760 MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA-OR CD contains the phenylacetyl-CoA:acceptor oxidoreductase, large subunit (PadB2), and other related proteins | Back alignment and domain information |
|---|
| >PRK15488 thiosulfate reductase PhsA; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG | Back alignment and domain information |
|---|
| >TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative | Back alignment and domain information |
|---|
| >COG1832 Predicted CoA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 336 | ||||
| 3fxa_A | 201 | Crystal Structure Of A Putative Sugar-Phosphate Iso | 9e-23 | ||
| 2xhz_A | 183 | Probing The Active Site Of The Sugar Isomerase Doma | 1e-21 | ||
| 3etn_A | 220 | Crystal Structure Of Putative Phosphosugar Isomeras | 4e-15 | ||
| 3k2v_A | 149 | Structure Of The Cbs Pair Of A Putative D-Arabinose | 4e-14 | ||
| 3fna_A | 149 | Crystal Structure Of The Cbs Pair Of Possible D-Ara | 5e-14 | ||
| 1vim_A | 200 | Crystal Structure Of An Hypothetical Protein Length | 5e-08 | ||
| 1jeo_A | 180 | Crystal Structure Of The Hypothetical Protein Mj124 | 1e-04 | ||
| 1x94_A | 191 | Crystal Structure Of A Hypothetical Protein Length | 4e-04 | ||
| 2p9m_A | 138 | Crystal Structure Of Conserved Hypothetical Protein | 7e-04 |
| >pdb|3FXA|A Chain A, Crystal Structure Of A Putative Sugar-Phosphate Isomerase (Lmof2365_0531) From Listeria Monocytogenes Str. 4b F2365 At 1.60 A Resolution Length = 201 | Back alignment and structure |
|
| >pdb|2XHZ|A Chain A, Probing The Active Site Of The Sugar Isomerase Domain From E. Coli Arabinose-5-Phosphate Isomerase Via X-Ray Crystallography Length = 183 | Back alignment and structure |
| >pdb|3ETN|A Chain A, Crystal Structure Of Putative Phosphosugar Isomerase Involved In Capsule Formation (Yp_209877.1) From Bacteroides Fragilis Nctc 9343 At 1.70 A Resolution Length = 220 | Back alignment and structure |
| >pdb|3K2V|A Chain A, Structure Of The Cbs Pair Of A Putative D-Arabinose 5-Phosphate Isomerase From Klebsiella Pneumoniae Subsp. Pneumoniae. Length = 149 | Back alignment and structure |
| >pdb|3FNA|A Chain A, Crystal Structure Of The Cbs Pair Of Possible D-Arabinose 5-Phosphate Isomerase Yrbh From Escherichia Coli Cft073 Length = 149 | Back alignment and structure |
| >pdb|1VIM|A Chain A, Crystal Structure Of An Hypothetical Protein Length = 200 | Back alignment and structure |
| >pdb|1JEO|A Chain A, Crystal Structure Of The Hypothetical Protein Mj1247 From Methanococcus Jannaschii At 2.0 A Resolution Infers A Molecular Function Of 3-Hexulose-6-Phosphate Isomerase Length = 180 | Back alignment and structure |
| >pdb|1X94|A Chain A, Crystal Structure Of A Hypothetical Protein Length = 191 | Back alignment and structure |
| >pdb|2P9M|A Chain A, Crystal Structure Of Conserved Hypothetical Protein Mj0922 From Methanocaldococcus Jannaschii Dsm 2661 Length = 138 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| 3fxa_A | 201 | SIS domain protein; structural genomics, joint cen | 1e-58 | |
| 3etn_A | 220 | Putative phosphosugar isomerase involved in capsu | 3e-54 | |
| 2xhz_A | 183 | KDSD, YRBH, arabinose 5-phosphate isomerase; lipop | 2e-48 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 2e-45 | |
| 1m3s_A | 186 | Hypothetical protein YCKF; structural genomics, PS | 7e-41 | |
| 1vim_A | 200 | Hypothetical protein AF1796; structural genomics, | 5e-40 | |
| 1jeo_A | 180 | MJ1247, hypothetical protein MJ1247; RUMP pathway, | 8e-37 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 1e-21 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 1e-20 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 8e-20 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 2e-19 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 3e-19 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 3e-17 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 5e-17 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 2e-05 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-16 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-04 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 3e-16 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 2e-04 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 9e-16 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 1e-04 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 3e-15 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 5e-15 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 1e-14 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 2e-14 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 3e-04 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 3e-14 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 5e-14 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-13 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 5e-14 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 2e-13 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 3e-13 | |
| 3sho_A | 187 | Transcriptional regulator, RPIR family; structural | 4e-13 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 6e-12 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 7e-11 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-08 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 6e-11 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 3e-04 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 6e-11 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 8e-07 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 5e-05 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 8e-11 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 2e-10 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 3e-10 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 4e-10 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 5e-10 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 2e-09 | |
| 1tzb_A | 302 | Glucose-6-phosphate isomerase, conjectural; enzyme | 9e-09 | |
| 3cvj_A | 243 | Putative phosphoheptose isomerase; rossman fold, 3 | 4e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 2e-06 | |
| 2xbl_A | 198 | Phosphoheptose isomerase; capsule; HET: M7P PGE PG | 4e-06 | |
| 1tk9_A | 188 | Phosphoheptose isomerase 1; lipopolysaccharide bio | 4e-06 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 5e-06 | |
| 2i2w_A | 212 | Phosphoheptose isomerase; lipopolysaccharide biosy | 1e-05 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 1e-05 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 2e-05 | |
| 2a3n_A | 355 | Putative glucosamine-fructose-6-phosphate aminotr; | 6e-05 | |
| 2yva_A | 196 | DNAA initiator-associating protein DIAA; intermole | 2e-04 | |
| 1x92_A | 199 | APC5045, phosphoheptose isomerase; midwest centre | 2e-04 | |
| 3trj_A | 201 | Phosphoheptose isomerase; lipopolysaccharide biosy | 2e-04 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 3e-04 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 3e-04 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 8e-04 |
| >3fxa_A SIS domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Listeria monocytogenes str} Length = 201 | Back alignment and structure |
|---|
Score = 187 bits (476), Expect = 1e-58
Identities = 55/163 (33%), Positives = 89/163 (54%)
Query: 48 QTLLKCRGTIFFTGVGKSGFVANKISQTLISLGIKSGFLNPLDALHGDIGILSSDDILVM 107
+ + +C G I G G SG A K+ + + + FL P DA+HG +G+L +DIL++
Sbjct: 39 EKIAECTGKIVVAGCGTSGVAAKKLVHSFNCIERPAVFLTPSDAVHGTLGVLQKEDILIL 98
Query: 108 FSKSGNTEELLKVVPCAKAKGAYLVSVTSVEGNALAAVCDMNVHLPVERELCPFDLAPVT 167
SK GNT ELL ++P K KG+ L+ VT + +A D+ + V +E PF++
Sbjct: 99 ISKGGNTGELLNLIPACKTKGSTLIGVTENPDSVIAKEADIFFPVSVSKEPDPFNMLATA 158
Query: 168 STAIQMVFGDTVAIAMMGARNLTRDEYAANHPAGRIGKSLIFK 210
ST + D V + +M N T+++++ HP G +G L+ K
Sbjct: 159 STMAVIASFDAVIVCLMTYMNYTKEQFSVIHPGGAVGNKLLNK 201
|
| >3etn_A Putative phosphosugar isomerase involved in capsu formation; YP_209877.1; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343} Length = 220 | Back alignment and structure |
|---|
| >2xhz_A KDSD, YRBH, arabinose 5-phosphate isomerase; lipopolysaccharide biogenesis; 2.60A {Escherichia coli} Length = 183 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 | Back alignment and structure |
|---|
| >1m3s_A Hypothetical protein YCKF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: c.80.1.3 PDB: 1viv_A Length = 186 | Back alignment and structure |
|---|
| >1vim_A Hypothetical protein AF1796; structural genomics, unknown function; 1.36A {Archaeoglobus fulgidus} SCOP: c.80.1.3 Length = 200 | Back alignment and structure |
|---|
| >1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} SCOP: c.80.1.3 Length = 180 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >3sho_A Transcriptional regulator, RPIR family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.80A {Sphaerobacter thermophilus} Length = 187 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >1tzb_A Glucose-6-phosphate isomerase, conjectural; enzyme, crenarchaeon, hyperthermophIle, PGI family; 1.16A {Pyrobaculum aerophilum} SCOP: c.80.1.1 PDB: 1tzc_A* 1x9h_A* 1x9i_A* Length = 302 | Back alignment and structure |
|---|
| >3cvj_A Putative phosphoheptose isomerase; rossman fold, 3-layer (ABA) sandwich, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.00A {Bacillus halodurans c-125} Length = 243 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xbl_A Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1.62A {Burkholderia pseudomallei} PDB: 2x3y_A Length = 198 | Back alignment and structure |
|---|
| >1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 Length = 188 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A Length = 212 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Length = 205 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >2a3n_A Putative glucosamine-fructose-6-phosphate aminotr; structural genomics, joint center for structural genomics; HET: MSE; 1.23A {Salmonella typhimurium} Length = 355 | Back alignment and structure |
|---|
| >2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar BIND protein, DNAA binding protein; 1.85A {Escherichia coli} Length = 196 | Back alignment and structure |
|---|
| >1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A Length = 199 | Back alignment and structure |
|---|
| >3trj_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 2.80A {Francisella tularensis subsp} Length = 201 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Length = 286 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Length = 278 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Length = 473 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| 3fxa_A | 201 | SIS domain protein; structural genomics, joint cen | 100.0 | |
| 3etn_A | 220 | Putative phosphosugar isomerase involved in capsu | 100.0 | |
| 3sho_A | 187 | Transcriptional regulator, RPIR family; structural | 99.96 | |
| 2xhz_A | 183 | KDSD, YRBH, arabinose 5-phosphate isomerase; lipop | 99.96 | |
| 1m3s_A | 186 | Hypothetical protein YCKF; structural genomics, PS | 99.96 | |
| 1vim_A | 200 | Hypothetical protein AF1796; structural genomics, | 99.96 | |
| 1jeo_A | 180 | MJ1247, hypothetical protein MJ1247; RUMP pathway, | 99.95 | |
| 2yva_A | 196 | DNAA initiator-associating protein DIAA; intermole | 99.92 | |
| 1x92_A | 199 | APC5045, phosphoheptose isomerase; midwest centre | 99.92 | |
| 2xbl_A | 198 | Phosphoheptose isomerase; capsule; HET: M7P PGE PG | 99.89 | |
| 3trj_A | 201 | Phosphoheptose isomerase; lipopolysaccharide biosy | 99.89 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.88 | |
| 1tk9_A | 188 | Phosphoheptose isomerase 1; lipopolysaccharide bio | 99.88 | |
| 3cvj_A | 243 | Putative phosphoheptose isomerase; rossman fold, 3 | 99.88 | |
| 3knz_A | 366 | Putative sugar binding protein; structural genomic | 99.87 | |
| 2i2w_A | 212 | Phosphoheptose isomerase; lipopolysaccharide biosy | 99.87 | |
| 1j5x_A | 342 | Glucosamine-6-phosphate deaminase; structural geno | 99.87 | |
| 3hba_A | 334 | Putative phosphosugar isomerase; structural genomi | 99.86 | |
| 1nri_A | 306 | Hypothetical protein HI0754; structural genomics, | 99.86 | |
| 3fj1_A | 344 | Putative phosphosugar isomerase; YP_167080.1, stru | 99.86 | |
| 1moq_A | 368 | Glucosamine 6-phosphate synthase; glutamine amidot | 99.85 | |
| 3tbf_A | 372 | Glucosamine--fructose-6-phosphate aminotransferas | 99.85 | |
| 2a3n_A | 355 | Putative glucosamine-fructose-6-phosphate aminotr; | 99.85 | |
| 2poc_A | 367 | D-fructose-6- PH, isomerase domain of glutamine-fr | 99.85 | |
| 2zj3_A | 375 | Glucosamine--fructose-6-phosphate aminotransferase | 99.84 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.84 | |
| 2aml_A | 373 | SIS domain protein; 46906266, LMO0035 protein, str | 99.83 | |
| 3g68_A | 352 | Putative phosphosugar isomerase; SIS domain, doubl | 99.83 | |
| 3c3j_A | 384 | Putative tagatose-6-phosphate ketose/aldose isome; | 99.82 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.82 | |
| 3fkj_A | 347 | Putative phosphosugar isomerases; structural genom | 99.81 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.81 | |
| 2bpl_A | 608 | Glucosamine--fructose-6-phosphate aminotransferase | 99.81 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.81 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.81 | |
| 3eua_A | 329 | Putative fructose-aminoacid-6-phosphate deglycase; | 99.81 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.8 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.8 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.8 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.8 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.79 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.79 | |
| 2e5f_A | 325 | Hypothetical protein PH0510; structural genomics, | 99.79 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.79 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.78 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.78 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.78 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.77 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.77 | |
| 3odp_A | 393 | Putative tagatose-6-phosphate ketose/aldose isome; | 99.77 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.77 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.76 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.76 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.76 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.76 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.76 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.76 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.76 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.76 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.76 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.75 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.75 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.75 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.74 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.74 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.74 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.73 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.73 | |
| 3i0z_A | 389 | Putative tagatose-6-phosphate ketose/aldose isome; | 99.73 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.72 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.7 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.7 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.69 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.67 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.66 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.64 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.64 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.64 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.63 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.63 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.61 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.61 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.6 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.6 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.6 | |
| 3jx9_A | 170 | Putative phosphoheptose isomerase; YP_001815198.1, | 99.58 | |
| 1tzb_A | 302 | Glucose-6-phosphate isomerase, conjectural; enzyme | 99.58 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.58 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.54 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.53 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.53 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.51 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.5 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.5 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.48 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.43 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.43 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.42 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.41 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.4 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.38 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.27 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.21 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 99.18 | |
| 2q8n_A | 460 | Glucose-6-phosphate isomerase; TM1385, structural | 99.11 | |
| 3tbf_A | 372 | Glucosamine--fructose-6-phosphate aminotransferas | 98.9 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.88 | |
| 1zzg_A | 415 | Glucose-6-phosphate isomerase; structural genomics | 98.83 | |
| 1moq_A | 368 | Glucosamine 6-phosphate synthase; glutamine amidot | 98.83 | |
| 2e5f_A | 325 | Hypothetical protein PH0510; structural genomics, | 98.81 | |
| 2zj3_A | 375 | Glucosamine--fructose-6-phosphate aminotransferase | 98.8 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.76 | |
| 2bpl_A | 608 | Glucosamine--fructose-6-phosphate aminotransferase | 98.71 | |
| 3odp_A | 393 | Putative tagatose-6-phosphate ketose/aldose isome; | 98.7 | |
| 2poc_A | 367 | D-fructose-6- PH, isomerase domain of glutamine-fr | 98.67 | |
| 3knz_A | 366 | Putative sugar binding protein; structural genomic | 98.61 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.59 | |
| 3fj1_A | 344 | Putative phosphosugar isomerase; YP_167080.1, stru | 98.58 | |
| 3i0z_A | 389 | Putative tagatose-6-phosphate ketose/aldose isome; | 98.57 | |
| 3hba_A | 334 | Putative phosphosugar isomerase; structural genomi | 98.56 | |
| 3g68_A | 352 | Putative phosphosugar isomerase; SIS domain, doubl | 98.54 | |
| 3fkj_A | 347 | Putative phosphosugar isomerases; structural genom | 98.5 | |
| 2aml_A | 373 | SIS domain protein; 46906266, LMO0035 protein, str | 98.5 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.44 | |
| 1j5x_A | 342 | Glucosamine-6-phosphate deaminase; structural geno | 98.42 | |
| 1b0z_A | 445 | Protein (phosphoglucose isomerase); autocrinefacto | 98.4 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.39 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.35 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.34 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.34 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.33 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.32 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.32 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.32 | |
| 2wu8_A | 549 | Glucose-6-phosphate isomerase; gluconeogenesis, 5- | 98.32 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.32 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.31 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.31 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.3 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.28 | |
| 3eua_A | 329 | Putative fructose-aminoacid-6-phosphate deglycase; | 98.28 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.28 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.28 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.28 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 98.27 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.27 | |
| 2a3n_A | 355 | Putative glucosamine-fructose-6-phosphate aminotr; | 98.27 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.26 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.26 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.25 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.25 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.25 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.24 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.24 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.23 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.21 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.2 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.19 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.19 | |
| 2cxn_A | 557 | Glucose-6-phosphate isomerase; 1.40A {Mus musculus | 98.18 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.14 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.13 | |
| 3c3j_A | 384 | Putative tagatose-6-phosphate ketose/aldose isome; | 98.12 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.12 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.11 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.1 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.09 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.08 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.06 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.04 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.03 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 98.01 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 98.0 | |
| 2o2c_A | 613 | GPI, glucose-6-phosphate isomerase, glycosomal, PG | 97.97 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.96 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.9 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.86 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.78 | |
| 1t10_A | 605 | GPI, glucose-6-phosphate isomerase, PGI, phosphohe | 97.77 | |
| 3ff1_A | 446 | Glucose-6-phosphate isomerase; alpha beta, rossman | 97.74 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.59 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.43 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 97.43 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 97.29 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.19 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.1 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.09 | |
| 4em6_D | 553 | Glucose-6-phosphate isomerase; GPI, phosphoglucose | 96.94 | |
| 3ljk_A | 543 | Glucose-6-phosphate isomerase; structural genomics | 96.92 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 96.9 | |
| 3ujh_A | 567 | Glucose-6-phosphate isomerase; ssgcid, structural | 96.89 | |
| 1tzb_A | 302 | Glucose-6-phosphate isomerase, conjectural; enzyme | 96.78 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 96.7 | |
| 3qki_A | 597 | Glucose-6-phosphate isomerase; structural genomics | 96.51 | |
| 3hjb_A | 574 | Glucose-6-phosphate isomerase; PGI, IDP01329, gluc | 96.24 | |
| 2zkq_b | 295 | 40S ribosomal protein SA; protein-RNA complex, 40S | 96.2 | |
| 3bch_A | 253 | 40S ribosomal protein SA; laminin receptor, P40 ri | 95.98 | |
| 1vi6_A | 208 | 30S ribosomal protein S2P; structural genomics, ri | 95.81 | |
| 3iz6_A | 305 | 40S ribosomal protein SA (S2P); eukaryotic ribosom | 95.75 | |
| 3j20_B | 202 | 30S ribosomal protein S2P; archaea, archaeal, KINK | 95.43 | |
| 2xzm_B | 241 | RPS0E; ribosome, translation; 3.93A {Tetrahymena t | 95.24 | |
| 3u5c_A | 252 | 40S ribosomal protein S0-A; translation, ribosome, | 94.79 | |
| 1wiw_A | 290 | Glucose-6-phosphate isomerase like protein; riken | 94.65 | |
| 3bbn_B | 231 | Ribosomal protein S2; small ribosomal subunit, spi | 93.41 | |
| 2nap_A | 723 | Protein (periplasmic nitrate reductase); nitrogeno | 91.94 | |
| 2iv2_X | 715 | Formate dehydrogenase H; oxidoreductase, 4Fe-4S, a | 91.63 | |
| 3ml1_A | 802 | NAPA, periplasmic nitrate reductase; heterodimer, | 89.64 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 87.77 | |
| 1h0h_A | 977 | Formate dehydrogenase (large subunit); tungsten se | 86.08 | |
| 2qip_A | 165 | Protein of unknown function VPA0982; APC85975, vib | 85.47 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 85.26 | |
| 2e7z_A | 727 | Acetylene hydratase AHY; tungstoprotein, DMSO redu | 85.23 | |
| 2vpz_A | 765 | Thiosulfate reductase; oxidoreductase, molybdopter | 85.18 | |
| 2vqe_B | 256 | 30S ribosomal protein S2; tRNA-binding, rRNA-bindi | 84.54 | |
| 1kqf_A | 1015 | FDH-N alpha, formate dehydrogenase, nitrate-induci | 82.23 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 80.01 |
| >3fxa_A SIS domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Listeria monocytogenes str} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-32 Score=231.38 Aligned_cols=195 Identities=28% Similarity=0.519 Sum_probs=176.7
Q ss_pred CcchHHHHHHHHHHHHHHHHHHhcCChhHHHHHHHHHHcCCCeEEEEeccchHHHHHHHHHHHHhcCCeeeecCCccccc
Q 019775 14 KVSENTLLDLFKSQQDHLNYFFQHLSLPHTLTFTQTLLKCRGTIFFTGVGKSGFVANKISQTLISLGIKSGFLNPLDALH 93 (336)
Q Consensus 14 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~~~i~~a~~~I~i~G~G~s~~~a~~~~~~l~~~g~~~~~~~~~~~~~ 93 (336)
.+..++++++++.+.++++++.+.++.+.++++++.|.+++++||++|.|.|+.+|.+++++|.++|+++..+++.+.+.
T Consensus 5 ~~~~~i~~~~~~~~~~~l~~t~~~l~~~~i~~~~~~i~~a~~~I~i~G~G~S~~~A~~~~~~l~~~g~~~~~~~~~~~~~ 84 (201)
T 3fxa_A 5 QAILDNIHQTWQEEANAISRLPEVTSEEALVKTVEKIAECTGKIVVAGCGTSGVAAKKLVHSFNCIERPAVFLTPSDAVH 84 (201)
T ss_dssp HHHHHHHHHHHHHHHHHHHTHHHHSCHHHHHHHHHHHHHCSSCEEEECCTHHHHHHHHHHHHHHHTTCCEEECCHHHHTT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCcEEEEEecHHHHHHHHHHHHHHhcCCcEEEeCchHHHh
Confidence 35568899999999999999999999999999999999992299999999999999999999999999999999888777
Q ss_pred cccCCCCCCcEEEEEeCCCCcHHHHHHHHHHHHcCCeEEEEeCCCCCccccccCEEEEcCCCcccCCCCCCChhHHHHHH
Q 019775 94 GDIGILSSDDILVMFSKSGNTEELLKVVPCAKAKGAYLVSVTSVEGNALAAVCDMNVHLPVERELCPFDLAPVTSTAIQM 173 (336)
Q Consensus 94 ~~~~~~~~~dlvi~iS~sG~~~~~~~~~~~ak~~g~~vi~IT~~~~s~l~~~ad~~i~~~~~~~~~~~~~~~~~s~~~~~ 173 (336)
.....++++|++|+||+||++++++++++.||++|+++|+||++.++|++++||++|.++...+...+...++.|.++++
T Consensus 85 ~~~~~~~~~dvvI~iS~sG~t~~~~~~~~~ak~~g~~vi~IT~~~~s~l~~~ad~~l~~~~~~e~~~~~~~~~~s~~~~l 164 (201)
T 3fxa_A 85 GTLGVLQKEDILILISKGGNTGELLNLIPACKTKGSTLIGVTENPDSVIAKEADIFFPVSVSKEPDPFNMLATASTMAVI 164 (201)
T ss_dssp TGGGGCCTTCEEEEECSSSCCHHHHTTHHHHHHHTCEEEEEESCTTSHHHHHCSEEEECCCSCCCSTTSCSCHHHHHHHH
T ss_pred hhhhcCCCCCEEEEEeCCCCCHHHHHHHHHHHHcCCeEEEEECCCCChhHHhCCEEEEcCCCccccccCCCchHHHHHHH
Confidence 77788999999999999999999999999999999999999999999999999999999987654455667899999999
Q ss_pred HHHHHHHHHHHhhcCCChHHHhhcCCCCchhhhhh
Q 019775 174 VFGDTVAIAMMGARNLTRDEYAANHPAGRIGKSLI 208 (336)
Q Consensus 174 ~l~d~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 208 (336)
+++|+|+..++++++.++++++++||.|.+++.++
T Consensus 165 ~~~d~L~~~l~~~~g~~~~~~~~~H~~g~~g~~l~ 199 (201)
T 3fxa_A 165 ASFDAVIVCLMTYMNYTKEQFSVIHPGGAVGNKLL 199 (201)
T ss_dssp HHHHHHHHHHHHHTTCCHHHHHHHCCCCC------
T ss_pred HHHHHHHHHHHHhcCCCHHHHhhcCCCcHHHHHhh
Confidence 99999999999999999999999999999998754
|
| >3etn_A Putative phosphosugar isomerase involved in capsu formation; YP_209877.1; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3sho_A Transcriptional regulator, RPIR family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.80A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2xhz_A KDSD, YRBH, arabinose 5-phosphate isomerase; lipopolysaccharide biogenesis; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1m3s_A Hypothetical protein YCKF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: c.80.1.3 PDB: 1viv_A | Back alignment and structure |
|---|
| >1vim_A Hypothetical protein AF1796; structural genomics, unknown function; 1.36A {Archaeoglobus fulgidus} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar BIND protein, DNAA binding protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A | Back alignment and structure |
|---|
| >2xbl_A Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1.62A {Burkholderia pseudomallei} PDB: 2x3y_A | Back alignment and structure |
|---|
| >3trj_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 2.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >3cvj_A Putative phosphoheptose isomerase; rossman fold, 3-layer (ABA) sandwich, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.00A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3knz_A Putative sugar binding protein; structural genomics, joint C structural genomics, JCSG, protein structure initiative; 2.50A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A | Back alignment and structure |
|---|
| >1j5x_A Glucosamine-6-phosphate deaminase; structural genomics, TM0813, glucosamine-6-phosphate deamina PSI, protein structure initiative; 1.80A {Thermotoga maritima} SCOP: c.80.1.1 | Back alignment and structure |
|---|
| >3hba_A Putative phosphosugar isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE CIT; 2.00A {Shewanella denitrificans OS217} | Back alignment and structure |
|---|
| >1nri_A Hypothetical protein HI0754; structural genomics, haemophilus influ PSI, protein structure initiative, midwest center for struc genomics; 1.90A {Haemophilus influenzae} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >3fj1_A Putative phosphosugar isomerase; YP_167080.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 1.75A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1moq_A Glucosamine 6-phosphate synthase; glutamine amidotransferase; HET: GLP MES; 1.57A {Escherichia coli} SCOP: c.80.1.1 PDB: 1mor_A* 1mos_A* | Back alignment and structure |
|---|
| >3tbf_A Glucosamine--fructose-6-phosphate aminotransferas [isomerizing]; structural genomics; 2.28A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2a3n_A Putative glucosamine-fructose-6-phosphate aminotr; structural genomics, joint center for structural genomics; HET: MSE; 1.23A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2poc_A D-fructose-6- PH, isomerase domain of glutamine-fructose-6-phosphat transaminase (isomerizing); glucosamine-6-phosphate synthase; HET: BG6 UD1; 1.80A {Candida albicans} PDB: 2put_A* 2puv_A* 2puw_A* | Back alignment and structure |
|---|
| >2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2aml_A SIS domain protein; 46906266, LMO0035 protein, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g68_A Putative phosphosugar isomerase; SIS domain, double-SIS DOMA protein, structural genomics, joint center for structural G JCSG; HET: MSE CIT; 1.80A {Clostridium difficile} | Back alignment and structure |
|---|
| >3c3j_A Putative tagatose-6-phosphate ketose/aldose isome; tagatose-6-phosphate ketose/aldose isomerase, structural GEN PSI, MCSG; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3fkj_A Putative phosphosugar isomerases; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.12A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2bpl_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; amidotransferase, ammonia channeling, glucosamine 6- phosphate synthase; HET: F6R; 2.05A {Escherichia coli} SCOP: c.80.1.1 d.153.1.1 PDB: 1jxa_A* 2j6h_A* 2vf4_X 2vf5_X* 3ooj_A* | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3eua_A Putative fructose-aminoacid-6-phosphate deglycase; putative phosphosugar isomerase, structural genomics, joint for structural genomics, JCSG; HET: MSE FLC; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2e5f_A Hypothetical protein PH0510; structural genomics, sugar binding protein, NPPSFA, national on protein structural and functional analyses; 1.35A {Pyrococcus horikoshii} PDB: 2dec_A* 2df8_A 2cb0_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3odp_A Putative tagatose-6-phosphate ketose/aldose isome; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PG4; 2.35A {Clostridium novyi} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3i0z_A Putative tagatose-6-phosphate ketose/aldose isome; NP_344614.1, putative putative tagatose-6-phosphate ketose/A isomerase; HET: MSE; 1.70A {Streptococcus pneumoniae TIGR4} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3jx9_A Putative phosphoheptose isomerase; YP_001815198.1, structura genomics, joint center for structural genomics, JCSG; HET: MSE; 1.95A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >1tzb_A Glucose-6-phosphate isomerase, conjectural; enzyme, crenarchaeon, hyperthermophIle, PGI family; 1.16A {Pyrobaculum aerophilum} SCOP: c.80.1.1 PDB: 1tzc_A* 1x9h_A* 1x9i_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2q8n_A Glucose-6-phosphate isomerase; TM1385, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: 2PE; 1.82A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3tbf_A Glucosamine--fructose-6-phosphate aminotransferas [isomerizing]; structural genomics; 2.28A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1zzg_A Glucose-6-phosphate isomerase; structural genomics, riken structural genomics/PR initiative, RSGI, NPPSFA; 1.95A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1moq_A Glucosamine 6-phosphate synthase; glutamine amidotransferase; HET: GLP MES; 1.57A {Escherichia coli} SCOP: c.80.1.1 PDB: 1mor_A* 1mos_A* | Back alignment and structure |
|---|
| >2e5f_A Hypothetical protein PH0510; structural genomics, sugar binding protein, NPPSFA, national on protein structural and functional analyses; 1.35A {Pyrococcus horikoshii} PDB: 2dec_A* 2df8_A 2cb0_A* | Back alignment and structure |
|---|
| >2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2bpl_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; amidotransferase, ammonia channeling, glucosamine 6- phosphate synthase; HET: F6R; 2.05A {Escherichia coli} SCOP: c.80.1.1 d.153.1.1 PDB: 1jxa_A* 2j6h_A* 2vf4_X 2vf5_X* 3ooj_A* | Back alignment and structure |
|---|
| >3odp_A Putative tagatose-6-phosphate ketose/aldose isome; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PG4; 2.35A {Clostridium novyi} | Back alignment and structure |
|---|
| >2poc_A D-fructose-6- PH, isomerase domain of glutamine-fructose-6-phosphat transaminase (isomerizing); glucosamine-6-phosphate synthase; HET: BG6 UD1; 1.80A {Candida albicans} PDB: 2put_A* 2puv_A* 2puw_A* | Back alignment and structure |
|---|
| >3knz_A Putative sugar binding protein; structural genomics, joint C structural genomics, JCSG, protein structure initiative; 2.50A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3fj1_A Putative phosphosugar isomerase; YP_167080.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 1.75A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3i0z_A Putative tagatose-6-phosphate ketose/aldose isome; NP_344614.1, putative putative tagatose-6-phosphate ketose/A isomerase; HET: MSE; 1.70A {Streptococcus pneumoniae TIGR4} | Back alignment and structure |
|---|
| >3hba_A Putative phosphosugar isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE CIT; 2.00A {Shewanella denitrificans OS217} | Back alignment and structure |
|---|
| >3g68_A Putative phosphosugar isomerase; SIS domain, double-SIS DOMA protein, structural genomics, joint center for structural G JCSG; HET: MSE CIT; 1.80A {Clostridium difficile} | Back alignment and structure |
|---|
| >3fkj_A Putative phosphosugar isomerases; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.12A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2aml_A SIS domain protein; 46906266, LMO0035 protein, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1j5x_A Glucosamine-6-phosphate deaminase; structural genomics, TM0813, glucosamine-6-phosphate deamina PSI, protein structure initiative; 1.80A {Thermotoga maritima} SCOP: c.80.1.1 | Back alignment and structure |
|---|
| >1b0z_A Protein (phosphoglucose isomerase); autocrinefactor, neuroleukin, crystallography motility; 2.30A {Geobacillus stearothermophilus} SCOP: c.80.1.2 PDB: 1c7q_A* 1c7r_A* 2pgi_A | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2wu8_A Glucose-6-phosphate isomerase; gluconeogenesis, 5-phosphoarabinonate (PAB), PGI, cytoplasm, glycolysis; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3eua_A Putative fructose-aminoacid-6-phosphate deglycase; putative phosphosugar isomerase, structural genomics, joint for structural genomics, JCSG; HET: MSE FLC; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2a3n_A Putative glucosamine-fructose-6-phosphate aminotr; structural genomics, joint center for structural genomics; HET: MSE; 1.23A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2cxn_A Glucose-6-phosphate isomerase; 1.40A {Mus musculus} PDB: 2cvp_A 2cxo_A* 2cxp_A* 2cxq_A* 2cxr_A* 2cxs_A* 2cxt_A* 2cxu_A 1u0e_A 1u0f_A* 1u0g_A* 1jiq_A 1iri_A 1nuh_A* 1jlh_A 1iat_A 1hm5_A 1g98_A 1hox_A* 1xtb_A* ... | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3c3j_A Putative tagatose-6-phosphate ketose/aldose isome; tagatose-6-phosphate ketose/aldose isomerase, structural GEN PSI, MCSG; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2o2c_A GPI, glucose-6-phosphate isomerase, glycosomal, PGI, phosphohexose; dimer; HET: G6Q; 1.58A {Trypanosoma brucei brucei} PDB: 2o2d_A* 1q50_A | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >1t10_A GPI, glucose-6-phosphate isomerase, PGI, phosphohexose; phosphoglucose isomerase, substrate, D-fructose-6-phosphate; HET: F6P; 2.35A {Leishmania mexicana mexicana} SCOP: c.80.1.2 | Back alignment and structure |
|---|
| >3ff1_A Glucose-6-phosphate isomerase; alpha beta, rossmann fold, gluconeogenesis, glycolysis, structural genomics; HET: G6Q; 1.65A {Staphylococcus aureus subsp} SCOP: c.80.1.2 PDB: 3ifs_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4em6_D Glucose-6-phosphate isomerase; GPI, phosphoglucose isomerase phosphohexose isomerase, PHI, ssgcid; 1.90A {Brucella melitensis BV} | Back alignment and structure |
|---|
| >3ljk_A Glucose-6-phosphate isomerase; structural genomics, IDP02733, cytoplasm, gluconeogenesis, glycolysis; HET: MSE MES; 1.48A {Francisella tularensis} PDB: 3m5p_A* 3q7i_A* 3q88_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3ujh_A Glucose-6-phosphate isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: G6Q; 2.10A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1tzb_A Glucose-6-phosphate isomerase, conjectural; enzyme, crenarchaeon, hyperthermophIle, PGI family; 1.16A {Pyrobaculum aerophilum} SCOP: c.80.1.1 PDB: 1tzc_A* 1x9h_A* 1x9i_A* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3qki_A Glucose-6-phosphate isomerase; structural genomics, structural genomics consortium, SGC; 1.92A {Plasmodium falciparum} PDB: 3pr3_A | Back alignment and structure |
|---|
| >3hjb_A Glucose-6-phosphate isomerase; PGI, IDP01329, gluconeogenesi glycolysis, structural genomics, center for STRU genomics of infectious diseases; HET: PG4; 1.50A {Vibrio cholerae} PDB: 3nbu_A | Back alignment and structure |
|---|
| >2zkq_b 40S ribosomal protein SA; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >3bch_A 40S ribosomal protein SA; laminin receptor, P40 ribosomal protein, acetylation, cytoplasm, phosphorylation, polymorphism; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1vi6_A 30S ribosomal protein S2P; structural genomics, ribosome; 1.95A {Archaeoglobus fulgidus} SCOP: c.23.15.1 PDB: 1vi5_A | Back alignment and structure |
|---|
| >3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3j20_B 30S ribosomal protein S2P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2xzm_B RPS0E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_B | Back alignment and structure |
|---|
| >3u5c_A 40S ribosomal protein S0-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_A 3o30_A 3o2z_A 3u5g_A 3jyv_B* 1s1h_B | Back alignment and structure |
|---|
| >1wiw_A Glucose-6-phosphate isomerase like protein; riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.80.1.1 | Back alignment and structure |
|---|
| >3bbn_B Ribosomal protein S2; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 | Back alignment and structure |
|---|
| >2nap_A Protein (periplasmic nitrate reductase); nitrogenous acceptor, dissimilatory nitrate reductase; HET: MGD MES; 1.90A {Desulfovibrio desulfuricans} SCOP: b.52.2.2 c.81.1.1 PDB: 2jim_A* 2jir_A* 2jip_A* 2v45_A* 2v3v_A* 2jiq_A* 2jio_A* | Back alignment and structure |
|---|
| >2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A* | Back alignment and structure |
|---|
| >3ml1_A NAPA, periplasmic nitrate reductase; heterodimer, oxidoreductase; HET: MGD HEC; 1.60A {Ralstonia eutropha} PDB: 3o5a_A* 1ogy_A* 2nya_A* | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >1h0h_A Formate dehydrogenase (large subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: b.52.2.2 c.81.1.1 | Back alignment and structure |
|---|
| >2qip_A Protein of unknown function VPA0982; APC85975, vibrio parahaemolyticus RIMD 2210633, STR genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >2e7z_A Acetylene hydratase AHY; tungstoprotein, DMSO reductase family, iron-sulfur-cluster, lyase; HET: MGD; 1.26A {Pelobacter acetylenicus} | Back alignment and structure |
|---|
| >2vpz_A Thiosulfate reductase; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_A* 2vpw_A* 2vpy_A* | Back alignment and structure |
|---|
| >2vqe_B 30S ribosomal protein S2; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.23.15.1 PDB: 1gix_E* 1hnw_B* 1hnx_B* 1hnz_B* 1hr0_B 1ibk_B* 1ibl_B* 1ibm_B 1j5e_B 1jgo_E* 1jgp_E* 1jgq_E* 1ml5_E* 1n32_B* 1n33_B* 1n34_B 1n36_B 1xmo_B* 1xmq_B* 1xnq_B* ... | Back alignment and structure |
|---|
| >1kqf_A FDH-N alpha, formate dehydrogenase, nitrate-inducible, major S; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1kqg_A* | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 336 | ||||
| d1jeoa_ | 177 | c.80.1.3 (A:) Probable 3-hexulose-6-phosphate isom | 5e-20 | |
| d1m3sa_ | 186 | c.80.1.3 (A:) Hypothetical protein YckF {Bacillus | 6e-20 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 2e-10 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 2e-10 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 6e-10 | |
| d1vima_ | 192 | c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeo | 1e-09 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 2e-09 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 5e-09 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 6e-09 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 8e-09 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 2e-08 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 3e-08 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 5e-08 | |
| d1yava3 | 132 | d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bac | 5e-08 | |
| d1x9ia_ | 300 | c.80.1.1 (A:) Glucose-6-phosphate isomerase, conje | 6e-08 | |
| d1j5xa_ | 329 | c.80.1.1 (A:) Hypothetical protein TM0813 {Thermot | 9e-08 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 3e-07 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 3e-07 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 7e-07 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 2e-06 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 5e-06 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 8e-06 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 8e-06 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 9e-06 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 9e-04 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 5e-05 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 6e-05 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 1e-04 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 5e-04 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 7e-04 |
| >d1jeoa_ c.80.1.3 (A:) Probable 3-hexulose-6-phosphate isomerase MJ1247 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 177 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: SIS domain superfamily: SIS domain family: mono-SIS domain domain: Probable 3-hexulose-6-phosphate isomerase MJ1247 species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Score = 83.7 bits (206), Expect = 5e-20
Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 10/179 (5%)
Query: 21 LDLFKSQQDHLNYFFQHLSLPHTL-TFTQTLLKCRGTIFFTGVGKSGFVANKISQTLISL 79
LD+ + L F+ + + L + ++K + IF GVG+SG++ + L+ L
Sbjct: 4 LDIVSNNILILKKFYTNDEWKNKLDSLIDRIIKAK-KIFIFGVGRSGYIGRCFAMRLMHL 62
Query: 80 GIKSGFLNPLDALHGDIGILSSDDILVMFSKSGNTEELLKVVPCAKAKGAYLVSVTSVEG 139
G KS F+ DD+L++ S SG TE +L V AK ++++ G
Sbjct: 63 GFKSYFVG-----ETTTPSYEKDDLLILISGSGRTESVLTVAKKAKNINNNIIAIVCECG 117
Query: 140 NALAAVCDMNVHLPVERELCPFDLAPVTSTAIQMVFGDTVAIAMMGARNLTRDEYAANH 198
N + D+ + L V++ + T ++F D V +M NL E H
Sbjct: 118 N-VVEFADLTIPLEVKK--SKYLPMGTTFEETALIFLDLVIAEIMKRLNLDESEIIKRH 173
|
| >d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} Length = 186 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 192 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Length = 132 | Back information, alignment and structure |
|---|
| >d1x9ia_ c.80.1.1 (A:) Glucose-6-phosphate isomerase, conjectural {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 300 | Back information, alignment and structure |
|---|
| >d1j5xa_ c.80.1.1 (A:) Hypothetical protein TM0813 {Thermotoga maritima [TaxId: 2336]} Length = 329 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| d1m3sa_ | 186 | Hypothetical protein YckF {Bacillus subtilis [TaxI | 99.96 | |
| d1vima_ | 192 | Hypothetical protein AF1796 {Archaeon Archaeoglobu | 99.96 | |
| d1jeoa_ | 177 | Probable 3-hexulose-6-phosphate isomerase MJ1247 { | 99.95 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.86 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.85 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.83 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.83 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.83 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.83 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.82 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.82 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.82 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.81 | |
| d1x94a_ | 191 | Phosphoheptose isomerase GmhA1 {Vibrio cholerae [T | 99.81 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.8 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.79 | |
| d1j5xa_ | 329 | Hypothetical protein TM0813 {Thermotoga maritima [ | 99.79 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.78 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.77 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.77 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.77 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.76 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.75 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.75 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.72 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.71 | |
| d1nria_ | 248 | Hypothetical protein HI0754 {Haemophilus influenza | 99.7 | |
| d1x92a_ | 194 | Phosphoheptose isomerase GmhA1 {Pseudomonas aerugi | 99.7 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.7 | |
| d1tk9a_ | 188 | Phosphoheptose isomerase GmhA1 {Campylobacter jeju | 99.7 | |
| d1moqa_ | 366 | "Isomerase domain" of glucosamine 6-phosphate synt | 99.69 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.69 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.69 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.68 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.63 | |
| d1x9ia_ | 300 | Glucose-6-phosphate isomerase, conjectural {Archae | 99.31 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.79 | |
| d1moqa_ | 366 | "Isomerase domain" of glucosamine 6-phosphate synt | 98.74 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.57 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.49 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.49 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.48 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.47 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.47 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.47 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.46 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.46 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.45 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.44 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.41 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.38 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.37 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.36 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.34 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.27 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.26 | |
| d1j5xa_ | 329 | Hypothetical protein TM0813 {Thermotoga maritima [ | 98.25 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.2 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.19 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.12 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 98.1 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.1 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.05 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.87 | |
| d1c7qa_ | 442 | Phosphoglucose isomerase, PGI {Bacillus stearother | 97.12 | |
| d1vi6a_ | 193 | Ribosomal protein S2 {Archaeon Archaeoglobus fulgi | 96.82 | |
| d1q50a_ | 561 | Phosphoglucose isomerase, PGI {Leishmania mexicana | 96.34 | |
| d1iata_ | 556 | Phosphoglucose isomerase, PGI {Human (Homo sapiens | 95.51 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 94.23 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 93.97 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 93.77 | |
| d2gy9b1 | 218 | Ribosomal protein S2 {Escherichia coli [TaxId: 562 | 92.83 | |
| d1ytla1 | 158 | Acetyl-CoA decarbonylase/synthase complex epsilon | 91.63 | |
| d1q6za1 | 160 | Benzoylformate decarboxylase {Pseudomonas putida [ | 91.42 | |
| d2jioa2 | 597 | Periplasmic nitrate reductase alpha chain {Desulfo | 91.26 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 90.84 | |
| d2iv2x2 | 564 | Formate dehydrogenase H {Escherichia coli [TaxId: | 90.76 | |
| d2ji7a1 | 175 | Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ | 90.71 | |
| d1u9ya1 | 155 | Phosphoribosylpyrophosphate synthetase {Methanocal | 90.41 | |
| d1tifa_ | 76 | Translation initiation factor IF3, N-terminal doma | 89.33 | |
| d1dkua1 | 159 | Phosphoribosylpyrophosphate synthetase {Bacillus s | 89.28 | |
| d1ja1a2 | 177 | NADPH-cytochrome p450 reductase, N-terminal domain | 89.2 | |
| d1h0ha2 | 812 | Tungsten containing formate dehydrogenase, large s | 88.04 | |
| d1ogya2 | 670 | Periplasmic nitrate reductase alpha chain {Rhodoba | 87.8 | |
| d1t9ba1 | 171 | Acetohydroxyacid synthase catalytic subunit {Baker | 87.37 | |
| d2uubb1 | 234 | Ribosomal protein S2 {Thermus thermophilus [TaxId: | 86.93 | |
| d1kqfa2 | 817 | Formate dehydrogenase N, alpha subunit {Escherichi | 86.87 | |
| d2ctza1 | 421 | O-acetyl-L-homoserine sulfhydrylase {Thermus therm | 86.87 | |
| d1m2ka_ | 249 | AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo | 86.49 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 86.48 | |
| d2b4ya1 | 267 | NAD-dependent deacetylase sirtuin-5 {Human (Homo s | 85.64 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 85.53 | |
| d2ihta1 | 177 | Carboxyethylarginine synthase {Streptomyces clavul | 85.03 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 84.91 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 84.35 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 84.27 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 84.18 | |
| d1ybha1 | 179 | Acetohydroxyacid synthase catalytic subunit {Thale | 84.07 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 84.01 | |
| d1lkvx_ | 213 | FliG {Thermotoga maritima [TaxId: 2336]} | 83.63 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 82.68 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 82.62 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 81.44 | |
| d1y4ia1 | 397 | Methionine gamma-lyase, MGL {Citrobacter freundii | 81.08 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 80.73 | |
| d1qgna_ | 398 | Cystathionine gamma-synthase, CGS {Common tobacco | 80.65 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 80.29 | |
| d1pvda1 | 179 | Pyruvate decarboxylase {Baker's yeast (Saccharomyc | 80.25 |
| >d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: SIS domain superfamily: SIS domain family: mono-SIS domain domain: Hypothetical protein YckF species: Bacillus subtilis [TaxId: 1423]
Probab=99.96 E-value=1.4e-28 Score=202.12 Aligned_cols=174 Identities=18% Similarity=0.301 Sum_probs=152.4
Q ss_pred HHHHHHHHHHHHHHHhcCChhHHHHHHHHHHcCCCeEEEEeccchHHHHHHHHHHHHhcCCeeeecCCccccccccCCCC
Q 019775 21 LDLFKSQQDHLNYFFQHLSLPHTLTFTQTLLKCRGTIFFTGVGKSGFVANKISQTLISLGIKSGFLNPLDALHGDIGILS 100 (336)
Q Consensus 21 ~~~~~~~~~~l~~~~~~~~~~~i~~~~~~i~~a~~~I~i~G~G~s~~~a~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~ 100 (336)
.++.+...+.++++.+.++.++++++++.|.++ +|||++|.|.|..+|.+|+++|.++|+++.++.+. ....++
T Consensus 5 ~e~~~~~~~~i~~t~~~i~~~~i~~~~~~i~~a-~~I~i~G~G~S~~~a~~~~~~l~~lg~~~~~~~d~-----~~~~~~ 78 (186)
T d1m3sa_ 5 TEYVAEILNELHNSAAYISNEEADQLADHILSS-HQIFTAGAGRSGLMAKSFAMRLMHMGFNAHIVGEI-----LTPPLA 78 (186)
T ss_dssp HHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHC-SCEEEECSHHHHHHHHHHHHHHHHTTCCEEETTST-----TCCCCC
T ss_pred HHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHcC-CeEEEEECcHHHHHHHHHHHHHHhccCCCCcCChh-----hcccCC
Confidence 456777788899999999999999999999999 69999999999999999999999999999988653 234678
Q ss_pred CCcEEEEEeCCCCcHHHHHHHHHHHHcCCeEEEEeCCCCCccccccCEEEEcCCCcccCCC----CCCChhHHH--HHHH
Q 019775 101 SDDILVMFSKSGNTEELLKVVPCAKAKGAYLVSVTSVEGNALAAVCDMNVHLPVERELCPF----DLAPVTSTA--IQMV 174 (336)
Q Consensus 101 ~~dlvi~iS~sG~~~~~~~~~~~ak~~g~~vi~IT~~~~s~l~~~ad~~i~~~~~~~~~~~----~~~~~~s~~--~~~~ 174 (336)
++|++|++|+||++++++++++.||++|+++|+||++.+||++++||++|.+|...+.... ...++.+.+ ..++
T Consensus 79 ~~Dl~I~iS~sG~t~~~i~~~~~ak~~g~~iI~IT~~~~s~La~~ad~~i~i~~~~~~~~~~~~~s~~~~~s~~~~~~~~ 158 (186)
T d1m3sa_ 79 EGDLVIIGSGSGETKSLIHTAAKAKSLHGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLL 158 (186)
T ss_dssp TTCEEEEECSSSCCHHHHHHHHHHHHTTCEEEEEESCTTSHHHHHCSEEEECSCCSCC-----CCCCSSTTHHHHHHHHH
T ss_pred CCCEEEEecCccchhhhHHHHHHHHHCCCCEEEEecCCCchhhHhCCEEEEeCCCcccccCCCccccCcchHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999887654321 234555554 5578
Q ss_pred HHHHHHHHHHhhcCCChHHHhhcCCC
Q 019775 175 FGDTVAIAMMGARNLTRDEYAANHPA 200 (336)
Q Consensus 175 l~d~l~~~~~~~~~~~~~~~~~~~~~ 200 (336)
++|.++..++++++.+.++++++|.+
T Consensus 159 ~~d~l~~~l~~~~~~~~~~~~~~H~n 184 (186)
T d1m3sa_ 159 FYDAVILKLMEKKGLDSETMFTHHAN 184 (186)
T ss_dssp HHHHHHHHHHHHTTCCTTTCCCCCCC
T ss_pred HHHHHHHHHHHHhCcCHHHHHHHhhc
Confidence 99999999999999999999888875
|
| >d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jeoa_ c.80.1.3 (A:) Probable 3-hexulose-6-phosphate isomerase MJ1247 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1j5xa_ c.80.1.1 (A:) Hypothetical protein TM0813 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nria_ c.80.1.3 (A:) Hypothetical protein HI0754 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1x92a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tk9a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1moqa_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1x9ia_ c.80.1.1 (A:) Glucose-6-phosphate isomerase, conjectural {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1moqa_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1j5xa_ c.80.1.1 (A:) Hypothetical protein TM0813 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1c7qa_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1q50a_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Leishmania mexicana [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1iata_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gy9b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2jioa2 c.81.1.1 (A:4-600) Periplasmic nitrate reductase alpha chain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2iv2x2 c.81.1.1 (X:1-564) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} | Back information, alignment and structure |
|---|
| >d1u9ya1 c.61.1.2 (A:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1tifa_ d.15.8.1 (A:) Translation initiation factor IF3, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dkua1 c.61.1.2 (A:8-166) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h0ha2 c.81.1.1 (A:1-812) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1ogya2 c.81.1.1 (A:12-681) Periplasmic nitrate reductase alpha chain {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uubb1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kqfa2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|