Citrus Sinensis ID: 019933

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MAFSSLLRSTASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSLQTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKVKYRYPVFADIHDLKIVAWWYNFTKSDIAGCW
cccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHHcccccEEEEEcccccccccEEEEccccccccccccEEEEEcccEEEEccEEEEEEEEccccccccccccccEEEEcccccccHHHHHHHHcccccEEEEccccccccEEEEEcccccccccccEEEEcccccccccHHHHEEccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHccccccccccccEEEEEEEEEEcccccccc
cHHHHHHHHHHHHHccccccccccccccEEEEccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHcccccccccccEEEEEccEEEEccEEEEEEccccHHHccHHHHcccEEEEcccccccHHHHHHHHcccccEEEEccccccccEccccccHHHccccccEEEcccHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccEccccccccccHHHcEcccccEEEcccHHHcccEcHHHcccEEEEEEEEEEEEcccccEccc
MAFSSLLRSTASASLVRadltsspsdrvkgsptaafsrnlntssifgtsvpsgssssslqtCAAKgiqpiratateipptiqksrsdgntkvgingfGRIGRLVLRVAafrddvdvvavndpfidAKYMAYMFKydsthgvfkgtinvvddstlEINGKLIKVfskrdpaeipwgdygvDYVVESSGVFTTIAKASAHMKGGAKKVVIsapsadapmfvvgvnektykpnmnivsnascttnclaplakvvheEFGILEGLMTTVHattatqktvdgpsmkdwrggrgasqniipsstgaakvkyrypvfadihDLKIVAWWYNftksdiagcw
mafssllrstasaslvradltsspsdrvkgsptaafsrnlntSSIFGTSVPSGSSSSSLQTCAAKGIQpiratateipptiqksrsdgntkvginGFGRIGRLVLRVaafrddvdvvAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIkvfskrdpaeipWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHAttatqktvdgpsmkdwrggrgasqniipsstgaakvKYRYPVFADIHDLKIVAWWYNFTKSDIAGCW
MafssllrstasaslVRADLTSSPSDRVKGSPTAAFSRNLNTssifgtsvpsgsssssLQTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLvlrvaafrddvdvvavNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMttvhattatqktvDGPSMKDWRGGRGASQNIIPSSTGAAKVKYRYPVFADIHDLKIVAWWYNFTKSDIAGCW
******************************************************************************************KVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTAT**********************I***TGAAKVKYRYPVFADIHDLKIVAWWYNFTKSDIAGC*
*********************************************************************************************INGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKVKYRYPVFADIHDLKIVAWWYNFTKSDI*GCW
*******************************PTAAFSRNLNTSSIFG****************AKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKA********KKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKVKYRYPVFADIHDLKIVAWWYNFTKSDIAGCW
***************************************************************************************GNTKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKVKYRYPVFADIHDLKIVAWWYNFTKSDIAGCW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFSSLLRSTASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSLQTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKVKYRYPVFADIHDLKIVAWWYNFTKSDIAGCW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query334 2.2.26 [Sep-21-2011]
Q9Y796337 Glyceraldehyde-3-phosphat N/A no 0.634 0.629 0.760 1e-91
Q8X1X3338 Glyceraldehyde-3-phosphat N/A no 0.634 0.627 0.726 1e-90
Q9HFX1337 Glyceraldehyde-3-phosphat N/A no 0.631 0.626 0.731 2e-89
P32636338 Glyceraldehyde-3-phosphat N/A no 0.631 0.624 0.75 1e-88
P0CN74339 Glyceraldehyde-3-phosphat yes no 0.631 0.622 0.75 1e-88
P0CN75339 Glyceraldehyde-3-phosphat N/A no 0.631 0.622 0.75 1e-88
P32637337 Glyceraldehyde-3-phosphat yes no 0.631 0.626 0.731 2e-88
Q42671337 Glyceraldehyde-3-phosphat N/A no 0.634 0.629 0.723 1e-87
Q6BMK0335 Glyceraldehyde-3-phosphat yes no 0.628 0.626 0.729 1e-87
P54270335 Glyceraldehyde-3-phosphat N/A no 0.631 0.629 0.712 1e-87
>sp|Q9Y796|G3P_CRYCU Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus curvatus GN=GPD PE=3 SV=1 Back     alignment and function desciption
 Score =  336 bits (862), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 177/213 (83%), Gaps = 1/213 (0%)

Query: 90  TKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVV 149
           TKVGINGFGRIGR+VLR A    D+DVVA+NDPFID  YM YMFKYDSTHG FKG +   
Sbjct: 3   TKVGINGFGRIGRIVLRNALEHGDIDVVAINDPFIDLDYMVYMFKYDSTHGRFKGKVET- 61

Query: 150 DDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVIS 209
            D  L I GK I VF +RDPA IPWG  G DYVVES+GVFTTI KAS H+KGGAKKV+IS
Sbjct: 62  KDGKLVIEGKPISVFGERDPAAIPWGKAGADYVVESTGVFTTIEKASLHLKGGAKKVIIS 121

Query: 210 APSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATT 269
           APSADAPMFV GVN + YKP   ++SNASCTTNCLAPLAKV+H+ FGI+EGLMTTVHATT
Sbjct: 122 APSADAPMFVCGVNLEAYKPEYEVISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHATT 181

Query: 270 ATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAK 302
           ATQKTVDGPS KDWRGGRGA+ NIIPSSTGAAK
Sbjct: 182 ATQKTVDGPSHKDWRGGRGAAANIIPSSTGAAK 214

Cryptococcus curvatus (taxid: 57679)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q8X1X3|G3P_PARBA Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=GPD PE=1 SV=1 Back     alignment and function description
>sp|Q9HFX1|G3P_AJECA Glyceraldehyde-3-phosphate dehydrogenase OS=Ajellomyces capsulatus GN=GPD PE=2 SV=1 Back     alignment and function description
>sp|P32636|G3P2_AGABI Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agaricus bisporus GN=gpd2 PE=3 SV=1 Back     alignment and function description
>sp|P0CN74|G3P_CRYNJ Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GPD PE=3 SV=1 Back     alignment and function description
>sp|P0CN75|G3P_CRYNB Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GPD PE=3 SV=1 Back     alignment and function description
>sp|P32637|G3P_PODAS Glyceraldehyde-3-phosphate dehydrogenase OS=Podospora anserina GN=GPD PE=3 SV=1 Back     alignment and function description
>sp|Q42671|G3PC_CRAPL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|Q6BMK0|G3P_DEBHA Glyceraldehyde-3-phosphate dehydrogenase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPD PE=3 SV=1 Back     alignment and function description
>sp|P54270|G3PC_GRAGA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Gracilaria gracilis GN=GAPC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
118487867422 unknown [Populus trichocarpa] 0.886 0.701 0.8 1e-137
224101329422 predicted protein [Populus trichocarpa] 0.883 0.699 0.794 1e-137
224109070422 predicted protein [Populus trichocarpa] 0.886 0.701 0.796 1e-136
225462254429 PREDICTED: glyceraldehyde-3-phosphate de 0.895 0.696 0.776 1e-130
297844552420 GAPCP-2 [Arabidopsis lyrata subsp. lyrat 0.883 0.702 0.763 1e-129
255544534426 glyceraldehyde 3-phosphate dehydrogenase 0.895 0.701 0.794 1e-129
449444512415 PREDICTED: glyceraldehyde-3-phosphate de 0.898 0.722 0.776 1e-128
449475837425 PREDICTED: glyceraldehyde-3-phosphate de 0.898 0.705 0.776 1e-128
27754473420 putative glyceraldehyde-3-phosphate dehy 0.883 0.702 0.756 1e-127
21618027420 putative glyceraldehyde-3-phosphate dehy 0.883 0.702 0.753 1e-127
>gi|118487867|gb|ABK95756.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/305 (80%), Positives = 271/305 (88%), Gaps = 9/305 (2%)

Query: 1   MAFSSLLRSTASASLV---RADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSS 57
           MAFS LLRST +A LV   R+D + SPSDR K S + +F+   +  SIFGTS+P+GSSSS
Sbjct: 1   MAFSCLLRSTPAAPLVEASRSDFSPSPSDRFKVS-SVSFN---SLKSIFGTSIPTGSSSS 56

Query: 58  SLQTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVV 117
             QTC+ + IQPI+ATATE+PPT+ KSR+DG TK+GINGFGRIGRLVLRVA FRDD+DVV
Sbjct: 57  --QTCSGRSIQPIKATATEMPPTVLKSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVV 114

Query: 118 AVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDY 177
           AVNDPFIDA YMAYMFKYDSTHGVF GTI V+DDS LEINGK IK+ SKRDP EIPWGD+
Sbjct: 115 AVNDPFIDANYMAYMFKYDSTHGVFSGTIKVLDDSNLEINGKQIKITSKRDPTEIPWGDF 174

Query: 178 GVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA 237
           G +YVVESSG+FTT+ KA+AHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNM+IVSNA
Sbjct: 175 GAEYVVESSGIFTTVEKAAAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMDIVSNA 234

Query: 238 SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS 297
           SCTTNCLAPLAKVVHEEFGI+EGLMTTVHATTATQKTVDGPS KDWRGGRGA+QNIIPSS
Sbjct: 235 SCTTNCLAPLAKVVHEEFGIIEGLMTTVHATTATQKTVDGPSRKDWRGGRGAAQNIIPSS 294

Query: 298 TGAAK 302
           TGAAK
Sbjct: 295 TGAAK 299

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224101329|ref|XP_002312235.1| predicted protein [Populus trichocarpa] gi|222852055|gb|EEE89602.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109070|ref|XP_002315071.1| predicted protein [Populus trichocarpa] gi|222864111|gb|EEF01242.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225462254|ref|XP_002263263.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Vitis vinifera] gi|297736130|emb|CBI24168.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297844552|ref|XP_002890157.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata] gi|297335999|gb|EFH66416.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255544534|ref|XP_002513328.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223547236|gb|EEF48731.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449444512|ref|XP_004140018.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449475837|ref|XP_004154566.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|27754473|gb|AAO22684.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21618027|gb|AAM67077.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
TAIR|locus:2032810420 GAPCP-2 "glyceraldehyde-3-phos 0.859 0.683 0.649 8.4e-97
TAIR|locus:2206435422 GAPCP-1 "glyceraldehyde-3-phos 0.838 0.663 0.665 1.4e-96
UNIPROTKB|P17244333 GAPDH "Glyceraldehyde-3-phosph 0.631 0.633 0.627 2.4e-69
UNIPROTKB|G4NCH2336 MGG_01084 "Glyceraldehyde-3-ph 0.631 0.627 0.622 3.8e-69
UNIPROTKB|Q05025333 GAPDH "Glyceraldehyde-3-phosph 0.631 0.633 0.622 8e-69
UNIPROTKB|Q28259333 GAPDH "Glyceraldehyde-3-phosph 0.631 0.633 0.622 1e-68
UNIPROTKB|P10096333 GAPDH "Glyceraldehyde-3-phosph 0.631 0.633 0.622 1.3e-68
UNIPROTKB|A3FKF7333 GAPDH "Glyceraldehyde-3-phosph 0.631 0.633 0.622 1.3e-68
UNIPROTKB|Q4KYY3333 GAPDH "Glyceraldehyde-3-phosph 0.631 0.633 0.622 1.3e-68
ASPGD|ASPL0000009927336 gpdA [Emericella nidulans (tax 0.631 0.627 0.622 1.7e-68
TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 962 (343.7 bits), Expect = 8.4e-97, P = 8.4e-97
 Identities = 189/291 (64%), Positives = 214/291 (73%)

Query:    16 VRADLTSSPSDRVKGSPTAAFSRNLNTXXXXXXXXXXXXXXXXLQTCA----AKGIQPIR 71
             +R+  TS+ + RV+  P+++++ +  T                         AK +QPI+
Sbjct:     7 LRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTGKYNAKRVQPIK 66

Query:    72 ATATEIPPTIQKSRSDGNTKVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAY 131
             ATATE PP + +SRS G TKVGINGFGRIGRL                NDPFIDAKYMAY
Sbjct:    67 ATATEAPPAVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIEVVAVNDPFIDAKYMAY 126

Query:   132 MFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTT 191
             MFKYDSTHG +KGTINV+DDSTLEINGK +KV SKRDPAEIPW D G +YVVESSGVFTT
Sbjct:   127 MFKYDSTHGNYKGTINVIDDSTLEINGKQVKVVSKRDPAEIPWADLGAEYVVESSGVFTT 186

Query:   192 IAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVV 251
             + +AS+H+KGGAKKV+ISAPSADAPMFVVGVNEKTY PNM+IVSNASCTTNCLAPLAKVV
Sbjct:   187 VGQASSHLKGGAKKVIISAPSADAPMFVVGVNEKTYLPNMDIVSNASCTTNCLAPLAKVV 246

Query:   252 HEEFGILEGLMXXXXXXXXXXXXXDGPSMKDWRGGRGASQNIIPSSTGAAK 302
             HEEFGILEGLM             DGPSMKDWRGGRGASQNIIPSSTGAAK
Sbjct:   247 HEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAK 297
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009536 "plastid" evidence=ISS;IDA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=IMP
GO:0005975 "carbohydrate metabolic process" evidence=IMP
GO:0080022 "primary root development" evidence=IMP
GO:0080144 "amino acid homeostasis" evidence=IMP
TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P17244 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|G4NCH2 MGG_01084 "Glyceraldehyde-3-phosphate dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q05025 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Coturnix japonica (taxid:93934)] Back     alignment and assigned GO terms
UNIPROTKB|Q28259 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P10096 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A3FKF7 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Mustela putorius furo (taxid:9669)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KYY3 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Spermophilus citellus (taxid:9997)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009927 gpdA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96US8G3P_SCLSC1, ., 2, ., 1, ., 1, 20.70890.63470.6272N/Ano
Q4KYY3G3P_SPECI2, ., 6, ., 9, 9, ., -0.71220.63170.6336N/Ano
P17244G3P_CRIGR2, ., 6, ., 9, 9, ., -0.71690.63170.6336yesno
P46406G3P_RABIT2, ., 6, ., 9, 9, ., -0.71690.63170.6336yesno
Q9HFX1G3P_AJECA1, ., 2, ., 1, ., 1, 20.73110.63170.6261N/Ano
P54270G3PC_GRAGA1, ., 2, ., 1, ., 1, 20.71220.63170.6298N/Ano
Q42671G3PC_CRAPL1, ., 2, ., 1, ., 1, 20.72300.63470.6290N/Ano
Q43247G3PC3_MAIZE1, ., 2, ., 1, ., 1, 20.72760.63470.6290N/Ano
P20445G3P_EMENI1, ., 2, ., 1, ., 1, 20.71690.63170.6279yesno
P0CN74G3P_CRYNJ1, ., 2, ., 1, ., 1, 20.750.63170.6224yesno
P0CN75G3P_CRYNB1, ., 2, ., 1, ., 1, 20.750.63170.6224N/Ano
P04796G3PC_SINAL1, ., 2, ., 1, ., 1, 20.70640.64970.6420N/Ano
P04797G3P_RAT2, ., 6, ., 9, 9, ., -0.71690.63170.6336yesno
P09317G3P_USTMA1, ., 2, ., 1, ., 1, 20.72030.62870.6231N/Ano
Q12552G3P_ASPNG1, ., 2, ., 1, ., 1, 20.71690.63170.6279yesno
P48812G3P_BRUMA1, ., 2, ., 1, ., 1, 20.73140.63470.6253N/Ano
P00356G3P_CHICK2, ., 6, ., 9, 9, ., -0.70750.63170.6336yesno
P00357G3P_HOMAM1, ., 2, ., 1, ., 1, 20.72760.63170.6336N/Ano
P00355G3P_PIG2, ., 6, ., 9, 9, ., -0.71220.63170.6336yesno
O59841G3P_PICAD1, ., 2, ., 1, ., 1, 20.71090.62870.6268N/Ano
P26517G3PC1_HORVU1, ., 2, ., 1, ., 1, 20.72220.64370.6379N/Ano
P54118G3P_NEUCR1, ., 2, ., 1, ., 1, 20.71220.63170.6242N/Ano
Q9HGY7G3P_ASPOR1, ., 2, ., 1, ., 1, 20.72640.63170.6242yesno
Q9N2D5G3P_FELCA2, ., 6, ., 9, 9, ., -0.71220.63170.6336N/Ano
Q8X1X3G3P_PARBA1, ., 2, ., 1, ., 1, 20.72640.63470.6272N/Ano
P34924G3PC_PINSY1, ., 2, ., 1, ., 1, 20.71550.64970.6382N/Ano
P34921G3PC_DIACA1, ., 2, ., 1, ., 1, 20.72300.63470.6272N/Ano
Q5R2J2G3P_PELSI2, ., 6, ., 9, 9, ., -0.70280.63170.6336N/Ano
P32636G3P2_AGABI1, ., 2, ., 1, ., 1, 20.750.63170.6242N/Ano
P32637G3P_PODAS1, ., 2, ., 1, ., 1, 20.73110.63170.6261yesno
Q8WZN0G3P_SORMA1, ., 2, ., 1, ., 1, 20.70750.63170.6242N/Ano
Q4U3L0G3P_GLOMM1, ., 2, ., 1, ., 1, 20.73230.63170.6336N/Ano
P26520G3PC_PETHY1, ., 2, ., 1, ., 1, 20.72300.63470.6290N/Ano
Q05025G3P_COTJA2, ., 6, ., 9, 9, ., -0.71220.63170.6336N/Ano
Q28259G3P_CANFA2, ., 6, ., 9, 9, ., -0.71220.63170.6336yesno
Q92211G3P_CANAW1, ., 2, ., 1, ., 1, 20.72640.63170.6298N/Ano
Q6CCU7G3P_YARLI1, ., 2, ., 1, ., 1, 20.73580.63170.6242yesno
P56649G3P_PANVR1, ., 2, ., 1, ., 1, 20.71830.63170.6336N/Ano
Q39769G3PC_GINBI1, ., 2, ., 1, ., 1, 20.71550.64970.6382N/Ano
P26521G3PC_RANAC1, ., 2, ., 1, ., 1, 20.72220.64370.6360N/Ano
O13507G3P_PHARH1, ., 2, ., 1, ., 1, 20.73580.63170.6242N/Ano
A3FKF7G3P_MUSPF2, ., 6, ., 9, 9, ., -0.71220.63170.6336N/Ano
Q6BMK0G3P_DEBHA1, ., 2, ., 1, ., 1, 20.72980.62870.6268yesno
Q9Y796G3P_CRYCU1, ., 2, ., 1, ., 1, 20.76050.63470.6290N/Ano
Q5RAB4G3P_PONAB2, ., 6, ., 9, 9, ., -0.69760.64070.6388yesno
P10096G3P_BOVIN2, ., 6, ., 9, 9, ., -0.71220.63170.6336yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.120.824
3rd Layer1.2.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 0.0
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 1e-109
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 1e-108
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 1e-106
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 1e-102
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 1e-89
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 3e-83
pfam00044148 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh 2e-81
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de 2e-81
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 3e-79
PLN02237 442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 1e-73
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 2e-73
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 7e-68
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 1e-59
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 3e-58
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 1e-55
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 2e-40
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 5e-35
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 3e-28
cd12167330 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 5e-05
COG0136 334 COG0136, Asd, Aspartate-semialdehyde dehydrogenase 6e-05
cd05299312 cd05299, CtBP_dh, C-terminal binding protein (CtBP 8e-05
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 0.001
TIGR01296 338 TIGR01296, asd_B, aspartate-semialdehyde dehydroge 0.002
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  526 bits (1356), Expect = 0.0
 Identities = 241/305 (79%), Positives = 261/305 (85%), Gaps = 10/305 (3%)

Query: 1   MAFSSLLRSTASASLV---RADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSS 57
           MAFSSLLRS A+A       +D +SS SD  K S       ++  SS    S  S  +SS
Sbjct: 1   MAFSSLLRSAATAPAAAARGSDFSSSSSDPSKVS-------SVGFSSSLSFSGSSSGASS 53

Query: 58  SLQTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFGRIGRLVLRVAAFRDDVDVV 117
           SLQ+C+A+ +QPI+ATATE PP + KS S G TK+GINGFGRIGRLVLR+A  RDD++VV
Sbjct: 54  SLQSCSARSVQPIKATATEAPPAVLKSSSSGKTKIGINGFGRIGRLVLRIATSRDDIEVV 113

Query: 118 AVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDY 177
           AVNDPFIDAKYMAYMFKYDSTHG FKGTINVVDDSTLEINGK IKV SKRDPAEIPWGD+
Sbjct: 114 AVNDPFIDAKYMAYMFKYDSTHGNFKGTINVVDDSTLEINGKQIKVTSKRDPAEIPWGDF 173

Query: 178 GVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA 237
           G +YVVESSGVFTT+ KASAH+KGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA
Sbjct: 174 GAEYVVESSGVFTTVEKASAHLKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNA 233

Query: 238 SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS 297
           SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS
Sbjct: 234 SCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSS 293

Query: 298 TGAAK 302
           TGAAK
Sbjct: 294 TGAAK 298

Length = 421
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 334
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
KOG0657285 consensus Glyceraldehyde 3-phosphate dehydrogenase 100.0
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 100.0
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 100.0
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 99.95
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 99.94
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 99.91
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 99.89
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 99.86
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 99.84
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 99.84
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 99.81
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 99.77
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 99.76
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 99.76
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 99.69
PLN02383 344 aspartate semialdehyde dehydrogenase 99.66
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 99.59
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 99.56
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 99.53
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 99.51
KOG4777 361 consensus Aspartate-semialdehyde dehydrogenase [Am 99.44
PRK08300302 acetaldehyde dehydrogenase; Validated 99.43
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 99.31
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.25
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.77
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 98.07
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.03
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.03
PRK13303265 L-aspartate dehydrogenase; Provisional 97.88
TIGR00036266 dapB dihydrodipicolinate reductase. 97.64
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 97.64
PRK06270341 homoserine dehydrogenase; Provisional 97.58
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.5
PRK00048257 dihydrodipicolinate reductase; Provisional 97.33
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.32
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.31
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.28
PRK08374336 homoserine dehydrogenase; Provisional 97.12
PRK11579 346 putative oxidoreductase; Provisional 97.11
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.08
PRK06349 426 homoserine dehydrogenase; Provisional 96.97
PRK06392326 homoserine dehydrogenase; Provisional 96.94
PRK06813346 homoserine dehydrogenase; Validated 96.86
PLN02775286 Probable dihydrodipicolinate reductase 96.84
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.78
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.6
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.4
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 96.0
PRK10206 344 putative oxidoreductase; Provisional 95.85
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 95.81
PRK09414445 glutamate dehydrogenase; Provisional 95.8
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 95.8
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 95.78
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 95.63
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 95.51
PLN02477410 glutamate dehydrogenase 95.47
COG0673 342 MviM Predicted dehydrogenases and related proteins 95.22
PLN02700 377 homoserine dehydrogenase family protein 95.16
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.15
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 94.92
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.7
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 94.65
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.41
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 94.38
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 94.1
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.92
PLN00016378 RNA-binding protein; Provisional 93.47
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 93.47
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 93.34
PRK08229341 2-dehydropantoate 2-reductase; Provisional 92.45
CHL00194317 ycf39 Ycf39; Provisional 92.16
PRK07417279 arogenate dehydrogenase; Reviewed 92.07
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 92.01
PRK14030445 glutamate dehydrogenase; Provisional 91.97
PRK06487317 glycerate dehydrogenase; Provisional 91.8
COG2344211 AT-rich DNA-binding protein [General function pred 91.55
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 91.39
PRK14031444 glutamate dehydrogenase; Provisional 91.32
PRK06932314 glycerate dehydrogenase; Provisional 91.26
COG2910211 Putative NADH-flavin reductase [General function p 91.25
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 91.23
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 90.9
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 90.85
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 90.71
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.46
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 90.42
PLN02928347 oxidoreductase family protein 90.38
KOG4354340 consensus N-acetyl-gamma-glutamyl-phosphate reduct 90.2
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 90.16
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 90.12
PRK07502307 cyclohexadienyl dehydrogenase; Validated 90.11
PRK06436303 glycerate dehydrogenase; Provisional 89.8
PRK07574385 formate dehydrogenase; Provisional 89.7
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 89.68
PRK13243333 glyoxylate reductase; Reviewed 89.6
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 89.54
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 89.53
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 89.52
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 89.3
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 89.23
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 89.09
PLN02712 667 arogenate dehydrogenase 89.06
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 88.94
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 88.94
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 88.77
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 88.49
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 88.42
PLN02712667 arogenate dehydrogenase 88.33
PRK08306296 dipicolinate synthase subunit A; Reviewed 88.28
PLN02256304 arogenate dehydrogenase 87.98
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 87.78
PLN03209 576 translocon at the inner envelope of chloroplast su 87.77
PRK12480330 D-lactate dehydrogenase; Provisional 87.76
PLN02306386 hydroxypyruvate reductase 87.72
PTZ00117319 malate dehydrogenase; Provisional 87.65
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 87.3
PLN03139386 formate dehydrogenase; Provisional 87.03
PRK09880343 L-idonate 5-dehydrogenase; Provisional 86.38
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 86.2
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 86.09
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 86.03
COG3804 350 Uncharacterized conserved protein related to dihyd 86.02
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 85.56
PRK06223307 malate dehydrogenase; Reviewed 85.11
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 84.35
PTZ00082321 L-lactate dehydrogenase; Provisional 84.24
PRK13403335 ketol-acid reductoisomerase; Provisional 84.14
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 84.07
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 84.07
PRK08605332 D-lactate dehydrogenase; Validated 83.89
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 83.73
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 83.03
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 82.88
PRK15116268 sulfur acceptor protein CsdL; Provisional 82.33
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 82.1
cd01483143 E1_enzyme_family Superfamily of activating enzymes 81.61
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 80.95
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 80.83
PLN02602350 lactate dehydrogenase 80.51
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 80.37
PLN02572 442 UDP-sulfoquinovose synthase 80.09
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.7e-87  Score=654.25  Aligned_cols=226  Identities=56%  Similarity=0.892  Sum_probs=215.9

Q ss_pred             CceeEEEEcCChhHHHHHHHHHcC----CCceEEEEeCCCCCHHHHhhhhccccccccCCCeEEE--------eCCCeEE
Q 019933           88 GNTKVGINGFGRIGRLVLRVAAFR----DDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINV--------VDDSTLE  155 (334)
Q Consensus        88 M~ikVgINGfGrIGR~vlRal~~~----~d~eiVAIND~~~d~~~~ayLlkYDSthGkf~~~v~~--------e~~~~L~  155 (334)
                      |++||||||||||||+++|+++++    ++++||||||++.++++++|||||||+||+|+++++.        ++ +.|.
T Consensus         2 m~ikVgINGFGRIGR~v~R~~~~~~~~~~~ievVAINd~~~~~~~~ayLlkyDS~hG~~~~~v~~~~~~~~~~~~-~~l~   80 (361)
T PTZ00434          2 APIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKYDTVHGRPKYTVETTKSSPSVKTD-DVLV   80 (361)
T ss_pred             CceEEEEECcChHHHHHHHHHHHcccCCCCeEEEEEeCCCCChhheeeeeeeecCCCCcCCceeecccccccccC-CEEE
Confidence            668999999999999999998875    5799999999879999999999999999999999987        54 6899


Q ss_pred             ECCEEEEEE-eccCCCCCCCCccCccEEEeccCCCCCHHHHHHHHHcCCCEEEEeCCCCC-CCeEEeecCccccCC-CCC
Q 019933          156 INGKLIKVF-SKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSAD-APMFVVGVNEKTYKP-NMN  232 (334)
Q Consensus       156 inGk~I~V~-~~~dP~~i~W~~~gvDiVvEsTG~f~t~e~a~~hl~aGaKkVIISaPs~D-~p~~V~GVN~~~y~~-~~~  232 (334)
                      +||++|.++ +++||+++||+++|+||||||||.|+++++++.||++||||||||+|++| .+||||||||+.|++ .++
T Consensus        81 ing~~I~~~~~~~dP~~ipW~~~gvD~ViE~TG~f~t~~~a~~Hl~~GAKkViiSAP~~d~~~t~V~GVN~~~y~~~~~~  160 (361)
T PTZ00434         81 VNGHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTEHH  160 (361)
T ss_pred             ECCEEEEEEEecCChhhCchhhcCCCEEEeCceeeccHHHHhhhhhcCCCEEEECCCCCCCCceEEEcCChHHcCcccCc
Confidence            999999986 99999999999999999999999999999999999999999999999887 689999999999998 578


Q ss_pred             EEecCCchhhhHHHHHHHH-hhhcCeeEEEEEEEeecCCCCCCccCCCCCCCCcccccccccccCCccchhhhhc-CCCC
Q 019933          233 IVSNASCTTNCLAPLAKVV-HEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKVKYR-YPVF  310 (334)
Q Consensus       233 IVSnASCTTncLAPvlKvL-~d~fGI~~g~mTTVHA~T~~Q~~~D~~~~kd~R~~RaA~~NIIPtsTGAAkAv~k-~P~l  310 (334)
                      ||||||||||||||++|+| ||+|||++|+|||||+||++|+++|+||+|||||+|+|++|||||+||||||+++ +|+|
T Consensus       161 IiSnASCTTNcLAP~~kvL~~~~fGI~~g~mTTVHayT~~Q~~~D~~~~kD~Rr~Raaa~nIIPtsTGAAkAv~~VlP~L  240 (361)
T PTZ00434        161 VVSNASCTTNCLAPIVHVLTKEGFGIETGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPST  240 (361)
T ss_pred             EEECCChHHHhhHHHHHHhhcCCcceEEEEEEEEecccCCcccccCcCcccccccccccccCccCCcchhhhhceecccc
Confidence            9999999999999999999 7999999999999999999999999996689999999999999999999999999 9999


Q ss_pred             CCCC
Q 019933          311 ADIH  314 (334)
Q Consensus       311 ~~~~  314 (334)
                      +|+-
T Consensus       241 ~GKl  244 (361)
T PTZ00434        241 KGKL  244 (361)
T ss_pred             CCce
Confidence            9974

>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 4e-73
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 4e-73
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 6e-73
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 1e-72
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 2e-72
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 2e-72
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 2e-72
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 4e-72
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 4e-71
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 4e-70
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 4e-70
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 3e-65
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 1e-64
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-64
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 5e-64
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 5e-64
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 8e-64
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 8e-64
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 1e-62
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 5e-61
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 5e-61
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 6e-61
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 9e-60
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 8e-59
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 6e-57
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 9e-57
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 1e-56
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 5e-53
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 9e-53
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 1e-50
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 7e-50
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 8e-50
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 2e-49
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 6e-47
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 5e-46
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 6e-46
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 7e-46
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 2e-45
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-45
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 1e-44
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 6e-44
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 8e-44
2pkr_O 365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 8e-44
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 1e-43
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 3e-43
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 3e-43
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 4e-43
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 4e-43
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 4e-43
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 3e-42
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 6e-42
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 6e-42
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 1e-41
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 1e-41
2pkq_O 368 Crystal Structure Of The Photosynthetic A2b2-Glycer 3e-41
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-40
1cer_O331 Determinants Of Enzyme Thermostability Observed In 7e-40
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 8e-40
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 2e-39
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 1e-38
2d2i_A 380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 3e-38
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 3e-38
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 9e-38
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 1e-37
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 4e-35
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 1e-29
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 2e-29
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 5e-27
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure 
Iteration: 1

 Score =  271 bits (692), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 134/213 (62%), Positives = 154/213 (72%), Gaps = 2/213 (0%)
Query: 90  TKVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVV 149
           +K+GINGFGRIGRL                NDPFI  +YM YMFKYDSTHGVFKG + + 
Sbjct: 2   SKIGINGFGRIGRLVLRAALSCGAQVVAV-NDPFIALEYMVYMFKYDSTHGVFKGEVKM- 59
Query: 150 DDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVIS 209
           +D  L ++GK I VF++  P  IPW   G +Y+VES+GVFTTI KASAH KGGAKKVVIS
Sbjct: 60  EDGALVVDGKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVVIS 119
Query: 210 APSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMXXXXXXX 269
           APSADAPMFV GVN + Y  +M +VSNASCTTNCLAP+AKV+HE F I+EGLM       
Sbjct: 120 APSADAPMFVCGVNLEKYSKDMTVVSNASCTTNCLAPVAKVLHENFEIVEGLMTTVHAVT 179
Query: 270 XXXXXXDGPSMKDWRGGRGASQNIIPSSTGAAK 302
                 DGPS KDWRGGRGA+QNIIPSSTGAAK
Sbjct: 180 ATQKTVDGPSAKDWRGGRGAAQNIIPSSTGAAK 212
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 1e-160
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 1e-160
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 1e-158
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 1e-158
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 1e-156
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 1e-156
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 1e-155
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 1e-151
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1e-138
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 1e-136
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 1e-133
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 1e-131
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 1e-130
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 1e-130
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 1e-129
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 1e-126
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 1e-126
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 1e-125
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 1e-118
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 1e-113
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 1e-113
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 2e-84
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 1e-82
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 3e-80
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 2e-47
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
 Score =  451 bits (1162), Expect = e-160
 Identities = 137/212 (64%), Positives = 167/212 (78%), Gaps = 1/212 (0%)

Query: 91  KVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVD 150
           +V INGFGRIGRLV+R+A  R +V+VVA+NDPFI   Y AYMFKYDSTHG + G ++  D
Sbjct: 3   RVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSH-D 61

Query: 151 DSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISA 210
           D  + ++GK I  + +RDPA +PWG   VD  ++S+GVF  +  A  H+  GAKKVVI+A
Sbjct: 62  DKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITA 121

Query: 211 PSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTA 270
           PS+ APMFV+GVNE+ Y  ++ IVSNASCTTNCLAPLAKV+++ FGI EGLMTTVH+ TA
Sbjct: 122 PSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTA 181

Query: 271 TQKTVDGPSMKDWRGGRGASQNIIPSSTGAAK 302
           TQKTVDGPS KDWRGGR AS NIIPSSTGAAK
Sbjct: 182 TQKTVDGPSHKDWRGGRTASGNIIPSSTGAAK 213
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 100.0
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 100.0
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 100.0
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 100.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 100.0
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 100.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 100.0
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 100.0
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 100.0
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 99.97
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 99.97
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 99.96
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 99.94
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 99.94
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 99.91
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 99.91
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 99.91
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 99.91
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 99.9
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 99.9
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 99.88
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 99.75
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 98.18
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.08
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.93
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 97.71
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 97.7
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.59
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 97.58
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 97.58
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.57
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.54
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 97.54
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.53
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.49
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.47
4had_A 350 Probable oxidoreductase protein; structural genomi 97.45
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 97.45
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.44
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 97.41
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 97.4
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.39
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.38
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.36
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.36
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.35
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.35
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.35
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 97.34
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.34
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.34
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.32
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.32
1ydw_A 362 AX110P-like protein; structural genomics, protein 97.31
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 97.3
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.29
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.28
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.25
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.24
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.23
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.22
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.2
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.19
4h3v_A 390 Oxidoreductase domain protein; structural genomics 97.12
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 97.06
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.03
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.0
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 96.98
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 96.98
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 96.9
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 96.89
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.88
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.88
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 96.79
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 96.6
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 96.59
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 96.57
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.56
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.54
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 96.52
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 96.52
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 96.52
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.5
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 96.36
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 96.15
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 96.12
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 95.75
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.28
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 95.23
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 95.0
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 94.68
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 94.55
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 94.25
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 94.03
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 93.91
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 93.69
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 93.61
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.52
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 93.44
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 93.41
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 93.08
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 92.85
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 92.51
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 92.45
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 92.38
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 91.95
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 91.82
2duw_A145 Putative COA-binding protein; ligand binding prote 91.65
1vpd_A299 Tartronate semialdehyde reductase; structural geno 91.49
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.46
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 91.18
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 91.18
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 91.02
2d59_A144 Hypothetical protein PH1109; COA binding, structur 90.6
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 90.58
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 90.53
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 90.45
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 90.44
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 90.38
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 90.35
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.28
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 90.25
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 90.17
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 90.17
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 90.17
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 90.16
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 90.11
1lss_A140 TRK system potassium uptake protein TRKA homolog; 89.97
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 89.9
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 89.87
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 89.76
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 89.73
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 89.68
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 89.68
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 89.59
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 89.47
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.45
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 89.42
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 89.37
1id1_A153 Putative potassium channel protein; RCK domain, E. 89.35
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 89.33
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 89.3
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 89.18
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 89.12
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 89.06
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 89.03
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 88.95
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 88.94
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 88.9
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 88.79
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 88.67
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 88.43
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 88.36
3qha_A296 Putative oxidoreductase; seattle structural genomi 88.35
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.34
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 88.3
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 88.23
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 88.16
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 88.02
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 88.01
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 87.95
4ezb_A317 Uncharacterized conserved protein; structural geno 87.92
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 87.79
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 87.75
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 87.74
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 87.7
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 87.47
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 87.47
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 87.43
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 87.42
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 87.41
1yb4_A295 Tartronic semialdehyde reductase; structural genom 87.23
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 87.14
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 87.14
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 87.08
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 87.08
1iuk_A140 Hypothetical protein TT1466; structural genomics, 87.07
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 86.87
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 86.62
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 86.52
3l6d_A306 Putative oxidoreductase; structural genomics, prot 86.52
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 86.35
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 86.16
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 85.97
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 85.94
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 85.98
2rir_A300 Dipicolinate synthase, A chain; structural genomic 85.83
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 85.81
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 85.29
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 85.26
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 85.21
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 84.95
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 84.68
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 84.51
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.43
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 84.18
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 84.15
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 84.14
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 83.91
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 83.7
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 83.7
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 83.46
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 83.46
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 83.45
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 83.35
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 83.19
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 83.19
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 83.17
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 83.13
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 83.05
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 83.01
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 82.77
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 82.75
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 82.58
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 82.56
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 82.47
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 82.02
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 81.95
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 81.88
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 81.7
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 81.64
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 81.43
1q0q_A 406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 81.3
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 81.29
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 81.18
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 81.14
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 81.03
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 80.98
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 80.96
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 80.85
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 80.77
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 80.7
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 80.61
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 80.53
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 80.24
4g65_A 461 TRK system potassium uptake protein TRKA; structur 80.2
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 80.1
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 80.07
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
Probab=100.00  E-value=2.1e-84  Score=628.46  Aligned_cols=223  Identities=61%  Similarity=1.014  Sum_probs=218.7

Q ss_pred             eeEEEEcCChhHHHHHHHHHcCCCceEEEEeCCCCCHHHHhhhhccccccccCCCeEEEeCCCeEEECCEEEEEEeccCC
Q 019933           90 TKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDP  169 (334)
Q Consensus        90 ikVgINGfGrIGR~vlRal~~~~d~eiVAIND~~~d~~~~ayLlkYDSthGkf~~~v~~e~~~~L~inGk~I~V~~~~dP  169 (334)
                      +||||||||||||+++|+++++++++||||||+++|++||+|||||||+||+|++++++++ ++|.||||+|+|++++||
T Consensus         2 ~kv~INGfGrIGr~v~R~~~~~~~~~ivaiNd~~~d~~~~a~l~kyDS~hG~f~~~v~~~~-~~l~i~Gk~I~v~~e~dp   80 (332)
T 3pym_A            2 VRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDD-KHIIVDGKKIATYQERDP   80 (332)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHSTTCEEEEEECTTCCHHHHHHHHHCCTTTCSCSSCEEECS-SEEEETTEEEEEECCSSG
T ss_pred             eEEEEECCCcHHHHHHHHHHhCCCcEEEEEeCCCCCHHHHHHHhcccCCCCCCCCcEEEcC-CEEEECCEEEEEEeeccc
Confidence            7999999999999999999999899999999998999999999999999999999999975 699999999999999999


Q ss_pred             CCCCCCccCccEEEeccCCCCCHHHHHHHHHcCCCEEEEeCCCCCCCeEEeecCccccCCCCCEEecCCchhhhHHHHHH
Q 019933          170 AEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAK  249 (334)
Q Consensus       170 ~~i~W~~~gvDiVvEsTG~f~t~e~a~~hl~aGaKkVIISaPs~D~p~~V~GVN~~~y~~~~~IVSnASCTTncLAPvlK  249 (334)
                      +++||+++|+||||||||.|+++|+|++|+++||||||||+|++|+|||||||||+.|+++++||||||||||||+|++|
T Consensus        81 ~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d~p~vV~gVN~~~~~~~~~IISnasCTTn~Lap~lk  160 (332)
T 3pym_A           81 ANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAK  160 (332)
T ss_dssp             GGSCTTTTTCSEEEECSSSSCSHHHHHHHHHTTCSEEEESSCCSSSCBCCTTTTGGGCCTTCCEEECCCHHHHHHHHHHH
T ss_pred             ccCCccccCccEEEEecccccCHHHHHHHHHcCCCEEEECCCCCCCCeEeeccchhhcCccccEEecCcchhhhhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999888999999999999999999


Q ss_pred             HHhhhcCeeEEEEEEEeecCCCCCCccCCCCCCCCcccccccccccCCccchhhhhc-CCCCCCC
Q 019933          250 VVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKVKYR-YPVFADI  313 (334)
Q Consensus       250 vL~d~fGI~~g~mTTVHA~T~~Q~~~D~~~~kd~R~~RaA~~NIIPtsTGAAkAv~k-~P~l~~~  313 (334)
                      +|||+|||++++||||||+|++|+++|+|++||||++|++++||||++||+||+++| +|+|+|+
T Consensus       161 vL~d~fGI~~g~mTTvha~T~~Q~~vDg~~~kd~r~~r~aa~NiIP~~tGaakav~kVlPeL~gk  225 (332)
T 3pym_A          161 VINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGK  225 (332)
T ss_dssp             HHHHHHCEEEEEEEEEEECCTTSCSSSCCCTTCTGGGSCGGGCCEEEECSHHHHHHHHSGGGTTS
T ss_pred             HHHHhcCeEEEEEEEEeeccccchhccCCCcccCccccchhhcccCCCCChHHHHHHhhhhhcCC
Confidence            999999999999999999999999999998899999999999999999999999999 9999986
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 334
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 5e-76
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 1e-74
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 2e-68
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 4e-67
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 9e-67
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 2e-61
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 3e-61
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 7e-59
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 2e-53
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 2e-51
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 5e-50
d2czca2172 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp 4e-47
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 8e-43
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 2e-34
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 8e-33
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 6e-31
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 3e-30
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 3e-30
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 2e-24
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 9e-18
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 1e-17
d1nvmb1157 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge 6e-04
d1f06a1170 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid de 0.001
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: South China Sea lobster (Palinurus versicolor) [TaxId: 150436]

 Score =  229 bits (584), Expect = 5e-76
 Identities = 97/168 (57%), Positives = 118/168 (70%), Gaps = 2/168 (1%)

Query: 90  TKVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVV 149
           +K+GINGFGRIGRLVLR AA      VVAVNDPFI  +YM YMFKYDSTHG+FKG +   
Sbjct: 1   SKIGINGFGRIGRLVLR-AALEMGAQVVAVNDPFIALEYMVYMFKYDSTHGMFKGEVKA- 58

Query: 150 DDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVIS 209
           +D  L ++GK I VF++  P  IPW   G +Y+VES+GVFTTI KASAH KGGAKKV+IS
Sbjct: 59  EDGALVVDGKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIIS 118

Query: 210 APSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGI 257
           APSADAPMFV GVN + Y  +M +VSNAS        +  ++     +
Sbjct: 119 APSADAPMFVCGVNLEKYSKDMKVVSNASNEFGYSQRVIDLIKHMQKV 166
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.97
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.62
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.59
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.42
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.38
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.31
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.22
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.18
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.13
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.1
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.02
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.32
d1mb4a2 222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.79
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.79
d1t4ba2 221 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.76
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.72
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.7
d2gz1a2 202 Aspartate beta-semialdehyde dehydrogenase {Strepto 97.57
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.5
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.42
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.41
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.26
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.23
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.15
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.84
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 96.63
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.41
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.81
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 95.58
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.5
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.7
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 94.51
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.23
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.13
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 93.99
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.9
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.86
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 93.57
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 93.29
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.16
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.14
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.11
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.03
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.84
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 91.8
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.8
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 91.4
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 91.12
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.1
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.88
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 90.78
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.5
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 90.1
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 89.04
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 89.02
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.92
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 88.86
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 88.73
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 88.71
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 88.24
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 88.2
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 88.01
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 88.01
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 87.8
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 87.46
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 87.22
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 87.13
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 86.06
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 85.87
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 85.81
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 85.74
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 85.66
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 85.52
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 85.44
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 85.03
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 84.47
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 84.37
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 83.82
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 83.17
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 83.06
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 83.03
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 82.87
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 82.1
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 81.71
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 81.69
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 81.66
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 81.42
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 81.35
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 81.28
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 81.02
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 80.95
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 80.27
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: South China Sea lobster (Palinurus versicolor) [TaxId: 150436]

Probab=100.00  E-value=1.3e-62  Score=434.82  Aligned_cols=167  Identities=57%  Similarity=0.920  Sum_probs=162.2

Q ss_pred             eEEEEcCChhHHHHHHHHHcCCCceEEEEeCCCCCHHHHhhhhccccccccCCCeEEEeCCCeEEECCEEEEEEeccCCC
Q 019933           91 KVGINGFGRIGRLVLRVAAFRDDVDVVAVNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPA  170 (334)
Q Consensus        91 kVgINGfGrIGR~vlRal~~~~d~eiVAIND~~~d~~~~ayLlkYDSthGkf~~~v~~e~~~~L~inGk~I~V~~~~dP~  170 (334)
                      ||||||||||||+++|++++++ +++|+|||+..++++++|||+|||+||+|+.+++.++ +.|.+||+.|+++++++|+
T Consensus         2 kIgINGfGRIGR~~~R~~~~~~-~~ivaINd~~~~~~~~~yLlkyDS~hG~~~~~i~~~~-~~l~ing~~I~~~~~~~p~   79 (169)
T d1dssg1           2 KIGINGFGRIGRLVLRAALEMG-AQVVAVNDPFIALEYMVYMFKYDSTHGMFKGEVKAED-GALVVDGKKITVFNEMKPE   79 (169)
T ss_dssp             CEEEECCSHHHHHHHHHHHHHT-CCEEEEECTTSCHHHHHHHHHCCTTTCCCSSCEEEET-TEEEETTEEEEEECCSSGG
T ss_pred             eEEEECCcHHHHHHHHHHHhCC-CcEEEECCCCcCHHHHHHHHhcccccCCcCCeEEEeC-CEEEECCEEEEEEecCChH
Confidence            8999999999999999999885 9999999988999999999999999999999999975 6999999999999999999


Q ss_pred             CCCCCccCccEEEeccCCCCCHHHHHHHHHcCCCEEEEeCCCCCCCeEEeecCccccCCCCCEEecCCchhhhHHHHHHH
Q 019933          171 EIPWGDYGVDYVVESSGVFTTIAKASAHMKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKV  250 (334)
Q Consensus       171 ~i~W~~~gvDiVvEsTG~f~t~e~a~~hl~aGaKkVIISaPs~D~p~~V~GVN~~~y~~~~~IVSnASCTTncLAPvlKv  250 (334)
                      ++||+++|+||||||||.|.+++.++.|+++||||||||+|++|+|+|||||||++|+++++||||||||||||||++|+
T Consensus        80 ~i~W~~~gvD~ViEcTG~f~~~~~~~~hl~~gakkViisaP~~d~~~iV~GVN~~~~~~~~~IIS~aSCTtn~laP~~k~  159 (169)
T d1dssg1          80 NIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPSADAPMFVCGVNLEKYSKDMKVVSNASNEFGYSQRVIDL  159 (169)
T ss_dssp             GCCHHHHTCCEEEECSSSCCSHHHHGGGGTTTCSEEEESSCCSSSCBCCTTTSGGGCCTTCCEEECCCTTHHHHHHHHHH
T ss_pred             HCCccccCCCEEEecCceEcCHHHHHHHHhcCCceEeecCCccccceeeecccccccCCCCCEEEChhHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999998889999999999999999999


Q ss_pred             HhhhcCeeE
Q 019933          251 VHEEFGILE  259 (334)
Q Consensus       251 L~d~fGI~~  259 (334)
                      |||+|||++
T Consensus       160 l~~~fgIe~  168 (169)
T d1dssg1         160 IKHMQKVDS  168 (169)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHhcCccc
Confidence            999999975
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure