Citrus Sinensis ID: 020063

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MVPYYYISTSRGWGWGWGWRWGWGWGRRWHKGANSSGVYSREALDAPFCSSEICSNSQRAEGAKQESKMREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVLF
cccEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHcHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccEEEcccccccccccccccEEEEEEEccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHccccEEEEEccccccccEEEEEcccccEEEEEEEcHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHccccEEEccccccccccccEEEEEccccccccEEEEEEccccccccccccc
cccEEEEEccccccccccccccccccccccccccccccccHHHccccccccHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccEEEcccccccccccccccccEEEEEEccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHccccEEEEEEccccccEEEccccccccEEEEEEEcccHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccEEEEEcccccccccccEEEEEEcccccccEEEEEccHHHHHHHHHHHc
MVPYYYIStsrgwgwgwgwrwgwgwgrrwhkganssgvysrealdapfcsseicsnsqraegakQESKMREKFLMKFLIIYLNLCFVVSLSSAtlvwkplslhfpdlpakfavdvnssgtcgalhvadpadacsplsnpvasndadhiNFVLIVRGQCIFEDKIRNAQAAGYRAAIVyndrekgslVSMTASHEGVKVHAIFVSLETGvylkehargetgeccifpesnrgsWSVLMVSVFSLIVVFALFAVAfitprpwrpwpgqnqplsrrldskvvealpcflfssasssqchggetcaicledyqdgeklKVLSCKHGRFLLLLVLF
MVPYYYIStsrgwgwgwGWRWGWGWGRRWHKGANSSGVYSREALDAPFCSseicsnsqraegakqesKMREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFitprpwrpwpGQNQPLSRRLDSKVVEALPCFLfssasssqchGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVLF
MVPYYYISTSrgwgwgwgwrwgwgwgrrwHKGANSSGVYSREALDAPFCSSEICSNSQRAEGAKQESKMREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVLF
**PYYYISTSRGWGWGWGWRWGWGWGRRWHKGANSSGVYSREALDAPFC**********************KFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVL*
*VPYYYISTSRGWGWGWGWRWGWGWGRRWH*****************************************KFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQ**********VEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVLF
MVPYYYISTSRGWGWGWGWRWGWGWGRRWHKGANSSGVYSREALDAPFCSSEIC*************KMREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVLF
MVPYYYISTSRGWGWGWGWRWGWGWGRRWHKGANSS*VYSREALDAPFCSSEICSNSQRAEGAKQESKMREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVLF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPYYYISTSRGWGWGWGWRWGWGWGRRWHKGANSSGVYSREALDAPFCSSEICSNSQRAEGAKQESKMREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query331 2.2.26 [Sep-21-2011]
Q90972 381 E3 ubiquitin-protein liga yes no 0.631 0.548 0.290 5e-17
Q0VD51 380 E3 ubiquitin-protein liga yes no 0.643 0.560 0.269 5e-17
O54965 381 E3 ubiquitin-protein liga no no 0.634 0.551 0.273 8e-17
Q66HG0 380 E3 ubiquitin-protein liga yes no 0.634 0.552 0.273 1e-16
Q91XF4347 E3 ubiquitin-protein liga no no 0.637 0.608 0.271 1e-16
Q5RCV8 381 E3 ubiquitin-protein liga yes no 0.643 0.559 0.269 1e-16
O43567 381 E3 ubiquitin-protein liga yes no 0.643 0.559 0.269 1e-16
Q9H6Y7350 E3 ubiquitin-protein liga no no 0.640 0.605 0.277 1e-14
Q5XIL0349 E3 ubiquitin-protein liga no no 0.637 0.604 0.271 6e-14
Q8WWF5429 Zinc/RING finger protein no no 0.637 0.491 0.308 6e-14
>sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 111/224 (49%), Gaps = 15/224 (6%)

Query: 104 FPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDK 163
           F DLPA+F   + + G  G L  + P +AC P++ P   +++     VLI R +C F+ K
Sbjct: 48  FDDLPARFGYRLPAEGLKGFLINSKPENACEPIAPPPLRDNSSTAFIVLIRRLECNFDIK 107

Query: 164 IRNAQAAGYRAAIVYNDREKGSLVSMTASH----EGVKVHAIFVSLETGVYLKEHARGET 219
           + NAQ AGY+AAIV+N  +   L+SM ++     + + + ++F+   +   LKE    E 
Sbjct: 108 VLNAQRAGYKAAIVHN-VDSDDLISMGSNDIEILKKIDIPSVFIGEASANSLKEEFTYEK 166

Query: 220 -GECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWRPWPGQNQPLSRRLDSKV 278
            G   + PE +      L+  +  + +   L  +  IT    +    +++    RL    
Sbjct: 167 GGHVVLIPEFSLPLEYYLIPFLIIVGICLILIVIFMIT----KFVQDRHRARRNRLRKDQ 222

Query: 279 VEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHG 322
           ++ LP   F           + CAICL++Y+DG+KL++L C H 
Sbjct: 223 LKKLPVHKFKKGDEY-----DVCAICLDEYEDGDKLRILPCSHA 261
E3 ubiquitin-protein ligase. May play a role in controlling cell proliferation, including that of muscle cells.
Gallus gallus (taxid: 9031)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 Back     alignment and function description
>sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 Back     alignment and function description
>sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 Back     alignment and function description
>sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 Back     alignment and function description
>sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 Back     alignment and function description
>sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 Back     alignment and function description
>sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 Back     alignment and function description
>sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 Back     alignment and function description
>sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
224133660311 predicted protein [Populus trichocarpa] 0.749 0.797 0.517 2e-69
255577542 577 zinc finger protein, putative [Ricinus c 0.716 0.410 0.510 1e-58
297734999352 unnamed protein product [Vitis vinifera] 0.712 0.670 0.495 2e-58
225431110294 PREDICTED: E3 ubiquitin-protein ligase R 0.712 0.802 0.495 3e-58
297797773308 hypothetical protein ARALYDRAFT_497000 [ 0.712 0.766 0.443 2e-54
42573810290 receptor homology-transmembrane-ring H2 0.703 0.803 0.449 1e-53
15239276310 receptor homology-transmembrane-ring H2 0.703 0.751 0.449 1e-53
225470792 446 PREDICTED: E3 ubiquitin-protein ligase R 0.761 0.565 0.402 7e-46
255586465 434 zinc finger protein, putative [Ricinus c 0.737 0.562 0.385 3e-44
296081075424 unnamed protein product [Vitis vinifera] 0.703 0.549 0.409 3e-43
>gi|224133660|ref|XP_002327649.1| predicted protein [Populus trichocarpa] gi|222836734|gb|EEE75127.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/253 (51%), Positives = 176/253 (69%), Gaps = 5/253 (1%)

Query: 69  MREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVAD 128
           MRE   +   + Y  +  ++  SSAT++ KP S+ FPDLPAK A+ +N S  CG+LHVA+
Sbjct: 1   MREGLFLILSLFYAIM--IIEGSSATVLIKPSSISFPDLPAKSALSLNGSSVCGSLHVAN 58

Query: 129 PADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVS 188
           P DACSPL N    N++    F LIVRG+C FEDKI+NAQ+AG+RAAIV++D++  +L+ 
Sbjct: 59  PLDACSPLRNRFEFNESG--RFALIVRGECAFEDKIKNAQSAGFRAAIVFDDKDNRNLIY 116

Query: 189 MTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFA 248
           M  + EG+KVHA+FV+   G  LK+ ARG+ GECCI+      +W+VL +S+ S++V+  
Sbjct: 117 MMVNPEGIKVHAVFVTKYAGEILKDRARGKEGECCIYSSRTDAAWTVLAISLISVVVILG 176

Query: 249 LFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDY 308
           L  + F+TPR W  W   N    + +DSK+VEALPCF F +AS SQCH GETCAICLEDY
Sbjct: 177 LLILVFVTPRHWLHWQRTNNR-CKSVDSKMVEALPCFTFRNASLSQCHVGETCAICLEDY 235

Query: 309 QDGEKLKVLSCKH 321
           +DGE LKVL C H
Sbjct: 236 KDGEVLKVLPCHH 248

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255577542|ref|XP_002529649.1| zinc finger protein, putative [Ricinus communis] gi|223530875|gb|EEF32736.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297734999|emb|CBI17361.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225431110|ref|XP_002265670.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297797773|ref|XP_002866771.1| hypothetical protein ARALYDRAFT_497000 [Arabidopsis lyrata subsp. lyrata] gi|297312606|gb|EFH43030.1| hypothetical protein ARALYDRAFT_497000 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42573810|ref|NP_975001.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] gi|332010783|gb|AED98166.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15239276|ref|NP_201417.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] gi|6942147|gb|AAF32325.1|AF218807_1 ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|10177131|dbj|BAB10421.1| ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|14334832|gb|AAK59594.1| putative ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|15293205|gb|AAK93713.1| putative ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|332010784|gb|AED98167.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225470792|ref|XP_002269731.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255586465|ref|XP_002533876.1| zinc finger protein, putative [Ricinus communis] gi|223526177|gb|EEF28507.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296081075|emb|CBI18269.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
TAIR|locus:2156872310 RMR1 "receptor homology region 0.709 0.758 0.45 5.5e-54
TAIR|locus:2016044 448 AT1G71980 [Arabidopsis thalian 0.734 0.542 0.365 2.6e-40
TAIR|locus:2014726318 AT1G35630 [Arabidopsis thalian 0.728 0.757 0.36 4.4e-36
TAIR|locus:2133697 448 AT4G09560 [Arabidopsis thalian 0.743 0.549 0.371 7.2e-36
TAIR|locus:2199665 422 AT1G22670 [Arabidopsis thalian 0.734 0.575 0.342 6.2e-30
UNIPROTKB|F1MFJ1350 F1MFJ1 "Uncharacterized protei 0.640 0.605 0.297 1.3e-20
UNIPROTKB|F1NUJ3272 RNF13 "E3 ubiquitin-protein li 0.628 0.764 0.291 1.2e-19
UNIPROTKB|Q0VD51 380 RNF13 "E3 ubiquitin-protein li 0.703 0.613 0.281 1.3e-19
UNIPROTKB|I3LG86 381 RNF13 "Ring finger protein 13" 0.703 0.611 0.281 1.3e-19
UNIPROTKB|F1NA38 380 RNF13 "E3 ubiquitin-protein li 0.628 0.547 0.291 2.2e-19
TAIR|locus:2156872 RMR1 "receptor homology region transmembrane domain ring H2 motif protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 558 (201.5 bits), Expect = 5.5e-54, P = 5.5e-54
 Identities = 108/240 (45%), Positives = 154/240 (64%)

Query:    84 LCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASN 143
             L  ++ +S AT+V   +S  F DLPAKF   V  +G CGAL+VADP D CSPL +  ASN
Sbjct:    16 LSSLLRVSLATVVLNSISASFADLPAKFDGSVTKNGICGALYVADPLDGCSPLLHAAASN 75

Query:   144 DADH--INFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAI 201
                H    F LI+RG+C FEDK+ NAQ +G++A IVY++ +   L+ M  + + + V A+
Sbjct:    76 WTQHRTTKFALIIRGECSFEDKLLNAQNSGFQAVIVYDNIDNEDLIVMKVNPQDITVDAV 135

Query:   202 FVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWR 261
             FVS   G  L+++ARG  GECC+ P     +W+VL +S FSL+++     +AF  PR W 
Sbjct:   136 FVSNVAGEILRKYARGRDGECCLNPPDRGSAWTVLAISFFSLLLIVTFLLIAFFAPRHWT 195

Query:   262 PWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKH 321
              W G++   + RLD+K+V  LPCF F+ ++  +   GETCAICLEDY+ GE L++L C+H
Sbjct:   196 QWRGRHTR-TIRLDAKLVHTLPCFTFTDSAHHKA--GETCAICLEDYRFGESLRLLPCQH 252
GO:0005576 "extracellular region" evidence=ISM
GO:0008233 "peptidase activity" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0000306 "extrinsic to vacuolar membrane" evidence=IDA
GO:0006886 "intracellular protein transport" evidence=IDA
GO:0006869 "lipid transport" evidence=RCA
GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0010351 "lithium ion transport" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
TAIR|locus:2016044 AT1G71980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014726 AT1G35630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133697 AT4G09560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199665 AT1G22670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFJ1 F1MFJ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUJ3 RNF13 "E3 ubiquitin-protein ligase RNF13" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VD51 RNF13 "E3 ubiquitin-protein ligase RNF13" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LG86 RNF13 "Ring finger protein 13" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA38 RNF13 "E3 ubiquitin-protein ligase RNF13" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00570065
hypothetical protein (311 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
cd02123153 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-a 1e-40
cd04818118 cd04818, PA_subtilisin_1, PA_subtilisin_1: Proteas 5e-16
cd00538126 cd00538, PA, PA: Protease-associated (PA) domain 5e-15
cd02133143 cd02133, PA_C5a_like, PA_C5a_like: Protease-associ 2e-11
pfam0222596 pfam02225, PA, PA domain 7e-11
cd02127118 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease- 4e-10
cd04813117 cd04813, PA_1, PA_1: Protease-associated (PA) doma 2e-09
cd02122138 cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-a 5e-09
cd02132139 cd02132, PA_GO-like, PA_GO-like: Protease-associat 6e-09
cd02126126 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease as 7e-09
cd02130122 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-as 4e-08
cd02124129 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-asso 7e-08
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-06
cd04816122 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease- 2e-06
cd02125127 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) 0.001
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 0.001
>gnl|CDD|239038 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like Back     alignment and domain information 
 Score =  139 bits (351), Expect = 1e-40
 Identities = 59/128 (46%), Positives = 78/128 (60%), Gaps = 4/128 (3%)

Query: 100 LSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCI 159
           L+  F DLPA F      SG  G L VA+P +ACSP+ NP  +++A     VLI RG C 
Sbjct: 20  LTDEFDDLPANFGPIPPGSGLKGVLVVAEPLNACSPIENPPLNSNASGSFIVLIRRGNCS 79

Query: 160 FEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHE---GVKVHAIFVSLETGVYLKEHAR 216
           FE K+RNAQ AGY+AAIVYND E   L+SM+ + +   G+ + ++FV   TG  LK++A 
Sbjct: 80  FETKVRNAQRAGYKAAIVYND-ESNDLISMSGNDQEIKGIDIPSVFVGKSTGEILKKYAS 138

Query: 217 GETGECCI 224
            E G   I
Sbjct: 139 YEKGVILI 146

This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Length = 153
>gnl|CDD|240122 cd04818, PA_subtilisin_1, PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 Back     alignment and domain information
>gnl|CDD|238300 cd00538, PA, PA: Protease-associated (PA) domain Back     alignment and domain information
>gnl|CDD|239048 cd02133, PA_C5a_like, PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase Back     alignment and domain information
>gnl|CDD|216938 pfam02225, PA, PA domain Back     alignment and domain information
>gnl|CDD|239042 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) Back     alignment and domain information
>gnl|CDD|240117 cd04813, PA_1, PA_1: Protease-associated (PA) domain subgroup 1 Back     alignment and domain information
>gnl|CDD|239037 cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like Back     alignment and domain information
>gnl|CDD|239047 cd02132, PA_GO-like, PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 Back     alignment and domain information
>gnl|CDD|239041 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins Back     alignment and domain information
>gnl|CDD|239045 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) Back     alignment and domain information
>gnl|CDD|239039 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-associated (PA) domain PoS1-like Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240120 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) Back     alignment and domain information
>gnl|CDD|239040 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
cd02126126 PA_EDEM3_like PA_EDEM3_like: protease associated d 99.9
cd02123153 PA_C_RZF_like PA_C-RZF_ like: Protease-associated 99.9
cd02125127 PA_VSR PA_VSR: Protease-associated (PA) domain-con 99.89
cd02127118 PA_hPAP21_like PA_hPAP21_like: Protease-associated 99.88
cd02122138 PA_GRAIL_like PA _GRAIL_like: Protease-associated 99.88
cd02132139 PA_GO-like PA_GO-like: Protease-associated domain 99.88
cd04813117 PA_1 PA_1: Protease-associated (PA) domain subgrou 99.84
cd04818118 PA_subtilisin_1 PA_subtilisin_1: Protease-associat 99.81
cd02129120 PA_hSPPL_like PA_hSPPL_like: Protease-associated d 99.79
cd04816122 PA_SaNapH_like PA_SaNapH_like: Protease-associated 99.78
cd02130122 PA_ScAPY_like PA_ScAPY_like: Protease-associated d 99.75
cd04817139 PA_VapT_like PA_VapT_like: Protease-associated dom 99.67
cd02124129 PA_PoS1_like PA_PoS1_like: Protease-associated (PA 99.62
KOG3920193 consensus Uncharacterized conserved protein, conta 99.57
PF02225101 PA: PA domain; InterPro: IPR003137 The PA (Proteas 99.57
KOG2442 541 consensus Uncharacterized conserved protein, conta 99.54
cd00538126 PA PA: Protease-associated (PA) domain. The PA dom 99.46
cd02133143 PA_C5a_like PA_C5a_like: Protease-associated domai 99.36
cd04819127 PA_2 PA_2: Protease-associated (PA) domain subgrou 99.2
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.15
cd04815134 PA_M28_2 PA_M28_2: Protease-associated (PA) domain 99.14
cd02120126 PA_subtilisin_like PA_subtilisin_like: Protease-as 99.01
cd02128183 PA_TfR PA_TfR: Protease-associated domain containi 98.96
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.79
PHA02929238 N1R/p28-like protein; Provisional 98.3
cd02121220 PA_GCPII_like PA_GCPII_like: Protease-associated d 98.29
cd04822151 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) do 98.25
cd04820137 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) do 98.06
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.06
cd04814142 PA_M28_1 PA_M28_1: Protease-associated (PA) domain 98.0
cd02131153 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-asso 97.64
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.5
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 97.4
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.24
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.24
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.23
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.16
PF1463444 zf-RING_5: zinc-RING finger domain 97.14
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.01
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.62
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.62
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.5
PHA02926242 zinc finger-like protein; Provisional 96.28
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.16
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.41
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 95.33
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.95
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 94.75
KOG4445 368 consensus Uncharacterized conserved protein, conta 94.72
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.69
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.63
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 94.25
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 94.0
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.95
cd04821157 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) do 92.52
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 92.31
KOG149384 consensus Anaphase-promoting complex (APC), subuni 92.28
smart0050463 Ubox Modified RING finger domain. Modified RING fi 92.16
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 88.51
KOG1941 518 consensus Acetylcholine receptor-associated protei 88.35
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 86.82
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 86.39
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 86.38
COG52191525 Uncharacterized conserved protein, contains RING Z 86.04
KOG0825 1134 consensus PHD Zn-finger protein [General function 85.78
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 85.07
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 83.65
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 82.68
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-47  Score=363.86  Aligned_cols=231  Identities=37%  Similarity=0.628  Sum_probs=198.8

Q ss_pred             cCCceeeccccCCCCCcCCCCCeEEEEEeCCCCCCCCCCCCCCCCCCCCCCeEEEEEcCCCCHHHHHHHHHHcCCcEEEE
Q 020063           98 KPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIV  177 (331)
Q Consensus        98 ~~~~~~f~~~~A~FG~~~~~~~~~G~L~~~~P~~aC~~~~~~~~~~~~~~~~IvLV~RG~CsF~~Kv~~Aq~aGA~avIV  177 (331)
                      ++.+.+|.+.+|.||+++..++..|.++.++|.+||+|+.+.+...+....+++||+||+|+|++|+++||++|++|+||
T Consensus        30 ~n~S~sf~d~~a~f~~s~~~e~~~G~l~~~ep~~aC~~i~~~p~~~~~~~~~laLI~Rg~CsFe~Kv~~AQ~aGfkaaIV  109 (348)
T KOG4628|consen   30 RNTSLSFADLPALFGPSLPSEGNLGVLVVAEPLNACNPITNFPEHSTRSTSFLALIRRGGCSFEDKVLNAQRAGFKAAIV  109 (348)
T ss_pred             ccccccccCCccccCCccccccceeeeecCCCccccCccccCccCCCCCcceEEEEEccCCchHHHHhhcccccCceEEE
Confidence            57888999999999999999999999999999999999998544333445899999999999999999999999999999


Q ss_pred             eccCCCCcccccccCCCCceEEEEEEeccchHHHHHHhcCCcceEEEec-CCCCCccceeeehhhhHHHHHHHHHhhhhc
Q 020063          178 YNDREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFP-ESNRGSWSVLMVSVFSLIVVFALFAVAFIT  256 (331)
Q Consensus       178 ~n~~~~~~~~~m~~~~~~i~IP~v~Is~~~G~~L~~~l~~~~v~v~I~p-~~~~~~w~~l~I~fi~llvi~~v~l~~~~~  256 (331)
                      ||+.+.+.++.|..+..++.|+++|++...|+.|+++.......+...+ +.....|.++.++++.++++..+++++|++
T Consensus       110 ynn~~~~~lv~~~~~~~~v~i~~~~vs~~~ge~l~~~~~~~~~~~~~~~~~~~~~~ws~~~~~~i~~l~v~~il~~~f~i  189 (348)
T KOG4628|consen  110 YNNVGSEDLVAMASNPSKVDIHIVFVSVFSGELLSSYAGRTEFECLLIPLGFDTSPWSILAISLISLLTVVAILVTCFFI  189 (348)
T ss_pred             ecCCCCchheeeccCCccceeEEEEEeeehHHHHHHhhcccceeeeeccccccCCcchhhhhhhhhHHHHHHHHHHHHHH
Confidence            9998767788898889999999999999999999997765555555444 788889998888888888888888877777


Q ss_pred             cCCCCCCCCCCCCcCCCCChhhhccCCeEEEccCCCCCCCCCccccccccccCCCceEEEecCCCccCcccccc
Q 020063          257 PRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHGRFLLLLVL  330 (331)
Q Consensus       257 ~r~~~~~~~~~~~~~~~l~~~~i~~LP~~~y~~~~~~~~~~~~~CaICLedf~~gd~vRvLPC~H~FH~~Cl~~  330 (331)
                      +++++.++.+++++++++.++.++++|+.+|+..+++...  ++||||||||++||+||+|||+|.||..|+=.
T Consensus       190 ~~~~~~~~~r~~~~~~r~~k~~l~~~p~~~f~~~~~~~~~--~~CaIClEdY~~GdklRiLPC~H~FH~~CIDp  261 (348)
T KOG4628|consen  190 YRIRRLIRARNRLRRNRLIKRLLKKLPVRTFTKGDDEDAT--DTCAICLEDYEKGDKLRILPCSHKFHVNCIDP  261 (348)
T ss_pred             HHHHHHHHHHhHhhhhhhHHHHHhhCCcEEeccccccCCC--ceEEEeecccccCCeeeEecCCCchhhccchh
Confidence            7766555444433478899999999999999997665433  79999999999999999999999999999843

>cd02126 PA_EDEM3_like PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins Back     alignment and domain information
>cd02123 PA_C_RZF_like PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like Back     alignment and domain information
>cd02125 PA_VSR PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) Back     alignment and domain information
>cd02127 PA_hPAP21_like PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) Back     alignment and domain information
>cd02122 PA_GRAIL_like PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like Back     alignment and domain information
>cd02132 PA_GO-like PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 Back     alignment and domain information
>cd04813 PA_1 PA_1: Protease-associated (PA) domain subgroup 1 Back     alignment and domain information
>cd04818 PA_subtilisin_1 PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 Back     alignment and domain information
>cd02129 PA_hSPPL_like PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like Back     alignment and domain information
>cd04816 PA_SaNapH_like PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) Back     alignment and domain information
>cd02130 PA_ScAPY_like PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) Back     alignment and domain information
>cd04817 PA_VapT_like PA_VapT_like: Protease-associated domain containing proteins like VapT from Vibrio metschnikovii strain RH530 Back     alignment and domain information
>cd02124 PA_PoS1_like PA_PoS1_like: Protease-associated (PA) domain PoS1-like Back     alignment and domain information
>KOG3920 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] Back     alignment and domain information
>PF02225 PA: PA domain; InterPro: IPR003137 The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [] Back     alignment and domain information
>KOG2442 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] Back     alignment and domain information
>cd00538 PA PA: Protease-associated (PA) domain Back     alignment and domain information
>cd02133 PA_C5a_like PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase Back     alignment and domain information
>cd04819 PA_2 PA_2: Protease-associated (PA) domain subgroup 2 Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04815 PA_M28_2 PA_M28_2: Protease-associated (PA) domain, peptidase family M28, subfamily-2 Back     alignment and domain information
>cd02120 PA_subtilisin_like PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases Back     alignment and domain information
>cd02128 PA_TfR PA_TfR: Protease-associated domain containing proteins like transferrin receptor (TfR) Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd02121 PA_GCPII_like PA_GCPII_like: Protease-associated domain containing protein, glutamate carboxypeptidase II (GCPII)-like Back     alignment and domain information
>cd04822 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 3 Back     alignment and domain information
>cd04820 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 1 Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd04814 PA_M28_1 PA_M28_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1 Back     alignment and domain information
>cd02131 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-associated domain containing proteins like human N-acetylated alpha-linked acidic dipeptidase-like 2 protein (hNAALADL2) Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
3eif_A 936 1.9 Angstrom Crystal Structure Of The Active Form O 4e-04
>pdb|3EIF|A Chain A, 1.9 Angstrom Crystal Structure Of The Active Form Of The C5a Peptidase From Streptococcus Pyogenes (Scpa) Length = 936 Back     alignment and structure 
Iteration: 1

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%), Gaps = 3/67 (4%)
Query: 150 FVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAIFVSLETGV 209
             LI RG   F+DKI NA+ AG    ++Y++++KG  + +    +   + A F+S + G+
Sbjct: 292 IALIERGDIDFKDKIANAKKAGAVGVLIYDNQDKGFPIELPNVDQ---MPAAFISRKDGL 348
Query: 210 YLKEHAR 216
            LK++++
Sbjct: 349 LLKDNSK 355

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
3icu_A194 E3 ubiquitin-protein ligase RNF128; E3 ligase, ene 2e-22
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 4e-11
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-11
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-09
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 5e-08
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-07
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-07
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 4e-05
2ek8_A 421 Aminopeptidase; metalloproteinase, hydrolase; 1.80 6e-04
>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Length = 194 Back     alignment and structure
 Score = 91.8 bits (227), Expect = 2e-22
 Identities = 35/162 (21%), Positives = 57/162 (35%), Gaps = 14/162 (8%)

Query: 81  YLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHV---ADPADACSPLS 137
           YLN+ + V  +         ++        +  D       G L         +AC+P +
Sbjct: 36  YLNVSWRVPHTGV-----NRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHT 90

Query: 138 N---PVASNDADHINFV-LIVRGQ-CIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTAS 192
           N   P        ++++ LI RG  C F DKI  A   G   A+++N     + V   + 
Sbjct: 91  NFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSH 150

Query: 193 HEGVKVHAIFVSLETGVYLKEH-ARGETGECCIFPESNRGSW 233
              V + AI +    G  + +   RG      I      G W
Sbjct: 151 PGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPW 192
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
3icu_A194 E3 ubiquitin-protein ligase RNF128; E3 ligase, ene 99.9
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.23
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.13
2ek8_A 421 Aminopeptidase; metalloproteinase, hydrolase; 1.80 98.89
3iib_A 444 Peptidase M28; YP_926796.1, structural genomics, J 98.88
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.76
2ect_A78 Ring finger protein 126; metal binding protein, st 98.74
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.74
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.71
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.55
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.53
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.52
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.47
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.43
3fed_A 707 Glutamate carboxypeptidase III; metallopeptidase, 98.43
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.26
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.25
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.24
3kas_A 640 Transferrin receptor protein 1; transferrin recept 98.22
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.2
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.19
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.12
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.1
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.01
3i6s_A 649 Subtilisin-like protease; PA-domain, FN3-domain, h 97.92
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.9
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.85
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 97.8
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.8
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.76
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.73
1y9z_A441 Alkaline serine protease; subtilisin-like alpha/be 97.68
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.65
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.63
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.59
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.59
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.56
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.54
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.5
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.47
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.46
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.45
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.36
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.35
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.33
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.32
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.3
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.25
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.23
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.17
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.07
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.79
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.78
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.59
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.53
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.49
2ea5_A68 Cell growth regulator with ring finger domain prot 96.37
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.37
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.19
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.99
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 94.45
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 94.41
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 94.29
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 93.89
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 93.62
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 93.44
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 92.97
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 92.11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 91.64
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 90.06
2f42_A179 STIP1 homology and U-box containing protein 1; cha 85.71
2yt5_A66 Metal-response element-binding transcription facto 85.49
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 81.22
3vta_A 621 Cucumisin; subtilisin-like fold, serine protease, 80.9
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 80.19
>3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
Probab=99.90  E-value=6.9e-24  Score=188.30  Aligned_cols=133  Identities=23%  Similarity=0.350  Sum_probs=109.6

Q ss_pred             ceeeccccCCCCCcCCCCCeEEEEEeCC---CCCCCCCCCCCCCCC----CCCCCeEEEEEcCC-CCHHHHHHHHHHcCC
Q 020063          101 SLHFPDLPAKFAVDVNSSGTCGALHVAD---PADACSPLSNPVASN----DADHINFVLIVRGQ-CIFEDKIRNAQAAGY  172 (331)
Q Consensus       101 ~~~f~~~~A~FG~~~~~~~~~G~L~~~~---P~~aC~~~~~~~~~~----~~~~~~IvLV~RG~-CsF~~Kv~~Aq~aGA  172 (331)
                      +.++.+.+|+||.+.+..+++|.|+.+.   |.+||++.+.+....    ....++||||+||+ |+|.+|++|||++||
T Consensus        51 t~~~~~e~a~FG~~~p~~~v~G~lv~~~~~~~~~GC~~~~~~~~~~~~~~~~~~gkIaLV~RG~~CsF~~Kv~nAq~aGA  130 (194)
T 3icu_A           51 TVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGA  130 (194)
T ss_dssp             EEEEEEEEEEECTTSCCSCEEEEEECBSSTTCTTCCSTTCCBCCCBCTTSSCBCCEEEEEESCTTCCHHHHHHHHHHTTC
T ss_pred             eeeecccccccCCCCCCCCcEEEEEecCCCCCcCCCCCCccccCCcccccccCCCeEEEEECCCCcCHHHHHHHHHHCCC
Confidence            3458899999999999999999998864   789999987653211    01248999999999 999999999999999


Q ss_pred             cEEEEeccC-CCCcccccccCCCCceEEEEEEeccchHHHHHHhc-CCcceEEEecCCCCCccc
Q 020063          173 RAAIVYNDR-EKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHAR-GETGECCIFPESNRGSWS  234 (331)
Q Consensus       173 ~avIV~n~~-~~~~~~~m~~~~~~i~IP~v~Is~~~G~~L~~~l~-~~~v~v~I~p~~~~~~w~  234 (331)
                      +||||||+. +++....|..+. ..+||++||++.+|+.|+++++ |.+|+++|..+.++.+|.
T Consensus       131 ~avIIyNn~~~g~~~~~m~~~~-~~~IPsv~Is~~~G~~L~~~L~~G~~Vtvti~vg~~h~pw~  193 (194)
T 3icu_A          131 SGAVIFNFPGTRNEVIPMSHPG-AVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWV  193 (194)
T ss_dssp             SEEEEECCTTCTTCCCCCCCTT-CCSSEEEEECHHHHHHHHHHHHTTCCEEEEEEEEEEECCCC
T ss_pred             cEEEEEeCCCCCCceeeecCCC-CCceeEEEECHHHHHHHHHHHHCCCeEEEEEECCCccCCCC
Confidence            999999985 333456676543 3579999999999999999986 889999998888888884
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Back     alignment and structure
>3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-04
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 35.2 bits (81), Expect = 6e-04
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 1/25 (4%)

Query: 298 GETCAICLEDYQDGEKLKVL-SCKH 321
           G  CA+CL + +DGE+ + L  C H
Sbjct: 5   GVECAVCLAELEDGEEARFLPRCGH 29
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.01
d1de4c2193 Transferrin receptor ectodomain, apical domain {Hu 98.54
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.45
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.44
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.43
d3bi1a2233 Glutamate carboxypeptidase II {Human (Homo sapiens 98.33
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.21
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.14
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.01
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.93
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.47
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.29
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.12
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 96.72
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.5
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 95.48
d2c2la280 STIP1 homology and U box-containing protein 1, STU 95.21
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 89.58
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 81.24
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.01  E-value=3.9e-11  Score=83.52  Aligned_cols=35  Identities=34%  Similarity=0.792  Sum_probs=31.6

Q ss_pred             CCccccccccccCCCceEEEec-CCCccCccccccC
Q 020063          297 GGETCAICLEDYQDGEKLKVLS-CKHGRFLLLLVLF  331 (331)
Q Consensus       297 ~~~~CaICLedf~~gd~vRvLP-C~H~FH~~Cl~~~  331 (331)
                      ++.+|+|||++|++||.++.+| |+|.||..|+-.|
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~W   39 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMW   39 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHT
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHH
Confidence            4578999999999999999997 9999999998755
>d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3bi1a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure