Citrus Sinensis ID: 020105

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MGNVGGVGASMRLSVELQTKTSLPHLLTTPQCCKQKYRDLERRFNDDPQPHNNNNHNVHVPWLEHLRKVRVDELKRELQRCDLSILSLQLQVKKLEEEREKPDLEIEKTRSLNDNDKTDDPQKSERRPVKEVFNNRFLVSPAEEESNRSVNESNSTGFNPKHLLPKSEPEPAGGQSPVLSRSKGELGDSVTPLSSDVQSSASFGIGTERKRGSAAAGGHIIEGTYAESEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKRTKR
cccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccccccccccccccccHHHHcccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcc
cccccccccHHHHHHHHHHcccccccEccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHcccccHcccccHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcc
mgnvggvgasMRLSVELQtktslphllttpqccKQKYRDLerrfnddpqphnnnnhnvhvpWLEHLRKVRVDELKRELQRCDLSILSLQLQVKKLEeerekpdleiektrslndndktddpqkserrpvkevfnnrflvspaeeesnrsvnesnstgfnpkhllpksepepaggqspvlsrskgelgdsvtplssdvqssasfgigterkrgsaaagghiiegtyaesepLIRLLDLIRthnhhlpslFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIvyfpkaslesEAAHQLRNLVSNEIKRTKR
MGNVGGVGASMRLSVELQtktslphllttpqcCKQKYRDLERRFnddpqphnnnnhnvhvpwLEHLRKVRVDELKRELQRCDLSILSLQlqvkkleeerekpdleiektrslndndktddpqkserrpvkevfnnrflvspaeeesnrsvnesnsTGFNPKHLLPKSEPEPAGGQSPVLSRSKGELgdsvtplssdvqssasfgigterkrgsaaagghiiegtyaeSEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASleseaahqlrnlvsneikrtkr
MGNVGGVGASMRLSVELQTKTSLPHLLTTPQCCKQKYRDLERRFNDDPQPhnnnnhnvhvPWLEHLRKVRVDELKRELQRCDLSILSLQLQVKKLEEEREKPDLEIEKTRSLNDNDKTDDPQKSERRPVKEVFNNRFLVSPAeeesnrsvnesnsTGFNPKHLLPKSEPEPAGGQSPVLSRSKGELGDSVTPLSSDVQSSASFGIGTERKRGSAAAGGHIIEGTYAESEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKRTKR
**********************LPHLLTTPQCCKQKY*******************NVHVPWLEHLRKVRVDELKRELQRCDLSILSLQLQV****************************************************************************************************************************GGHIIEGTYAESEPLIRLLDLIRTHNHHLPSLFE**********YKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKA***********************
*****GV*ASMRLSVELQTKTSLPHLLTTPQCCKQKYRD***********************************************************************************************************************************************************************************************LIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKR***
MGNVGGVGASMRLSVELQTKTSLPHLLTTPQCCKQKYRDLERRFNDDPQPHNNNNHNVHVPWLEHLRKVRVDELKRELQRCDLSILSLQLQVKKLEEEREKPDLEIEKTRSLND************RPVKEVFNNRFLVS*****************FNPKHLLPK********************************SSASFGIGT*********GGHIIEGTYAESEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKRTKR
*******************KTSLPHLLTTPQCCKQKYRDLERRFNDD*********NVHVPWLEHLRKVRVDELKRELQRCDLSILSLQLQVKKLEEE***************************************************************************************************************************EGTYAESEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNVGGVGASMRLSVELQTKTSLPHLLTTPQCCKQKYRDLERRFNDDPQPHNNNNHNVHVPWLEHLRKVRxxxxxxxxxxxxxxxxxxxxxxxxxxxxREKPDLEIEKTRSLNDNDKTDDPQKSERRPVKEVFNNRFLVSPAEEESNRSVNESNSTGFNPKHLLPKSEPEPAGGQSPVLSRSKGELGDSVTPLSSDVQSSASFGIGTERKRGSAAAGGHIIEGTYAESEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKRTKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query331 2.2.26 [Sep-21-2011]
Q338B9511 Histone acetyltransferase no no 0.271 0.176 0.252 0.0007
>sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 Back     alignment and function desciption
 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 237 LIRTHNHHLPSL-FERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLL 295
           L++  N H  +  F+  + S++  +Y ++++  +DL+T+  RVE   Y   +  F  D+ 
Sbjct: 410 LLKNMNEHPDAWPFKEPVDSRDVPDYYDIIKDPIDLKTMSKRVESEQYYVTLEMFVADMK 469

Query: 296 LLFNNAIVYFPKASLESEAAHQLRNLVSNEI 326
            +F+NA  Y    ++  + A +L +  SN++
Sbjct: 470 RMFSNAKTYNSPDTIYYKCASRLESFFSNKV 500
Acetylates histone H3. Acetylation of histones gives a specific tag for epigenetic transcription activation. Operates in concert with certain DNA-binding transcriptional activators. Acts via the formation of large multiprotein complexes that modify the chromatin.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
255542185 641 DNA binding protein, putative [Ricinus c 0.891 0.460 0.488 2e-59
225450325 686 PREDICTED: uncharacterized protein LOC10 0.936 0.451 0.418 8e-59
297741222 583 unnamed protein product [Vitis vinifera] 0.803 0.456 0.427 7e-57
15224877 646 DNA-binding bromodomain-containing prote 0.924 0.473 0.409 2e-52
449519334 688 PREDICTED: uncharacterized protein LOC10 0.957 0.460 0.401 6e-52
297824459 651 hypothetical protein ARALYDRAFT_483567 [ 0.900 0.457 0.391 7e-52
224121050 643 bromodomain protein [Populus trichocarpa 0.882 0.454 0.431 8e-52
449436657 703 PREDICTED: uncharacterized protein LOC10 0.957 0.450 0.393 1e-50
224104539 632 bromodomain protein [Populus trichocarpa 0.915 0.479 0.446 1e-50
297817306 643 hypothetical protein ARALYDRAFT_907533 [ 0.891 0.458 0.385 2e-49
>gi|255542185|ref|XP_002512156.1| DNA binding protein, putative [Ricinus communis] gi|223548700|gb|EEF50190.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  235 bits (600), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 174/356 (48%), Positives = 223/356 (62%), Gaps = 61/356 (17%)

Query: 13  LSVELQTKTSLPHLLTTPQCCKQKYRDLERRF----NDDPQPH-----NNNNH--NVHVP 61
           +S+ELQT+TSLPH LT+ + C+QKY DL RRF    ND  QP      NN+N   ++H+P
Sbjct: 46  VSMELQTRTSLPHFLTSARNCQQKYHDLHRRFTTSKNDFVQPQEEEDENNSNKVASIHIP 105

Query: 62  WLEHLRKVRVDELKRELQRCDLSILSLQLQVKKLEEEREK---------PDLEIEKTRSL 112
           WLE LRK+RV ELK+E+ R D+SI SLQL+VK+LEEEREK         PDLE  ++   
Sbjct: 106 WLEELRKLRVAELKQEVHRYDISIHSLQLKVKRLEEEREKGNQNDDVTIPDLEQPQS--- 162

Query: 113 NDNDKTDDPQKSERRPVKEVFNNRFLVSPAEEESNRSVNESNSTGFNPKHLLPKSEPEPA 172
                  D ++ E    +E      +     +  NRSVNESNSTG         SE E  
Sbjct: 163 -------DKKEEEEEEEEESEQKESVSGDESDRENRSVNESNSTG---------SEGEKK 206

Query: 173 G---------GQSPVLSRSKG------ELGDSVTPLSSDVQSSASFGIGTERKRGSA--- 214
           G          ++PVLS S        EL DSVT LSS+VQSSAS G   +RK       
Sbjct: 207 GVAKPSVQEDEEAPVLSGSSSKSVESHELADSVTQLSSEVQSSASLGGKRKRKGRKRREE 266

Query: 215 -AAGGHIIEG-TYAESEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLE 272
            AAGG  I+G    +SEPLI LL+ IR HNH   SLFE  LK+QE++ YK ++RQH+DLE
Sbjct: 267 IAAGGDGIKGRMMVKSEPLIALLESIRAHNH--ASLFEGPLKTQETDVYKNMIRQHLDLE 324

Query: 273 TIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKR 328
           TIQT++E+GSYS+  L  YRDLLLLFNNAIV+F K+S ES AA++LR++VSN++K+
Sbjct: 325 TIQTKLEQGSYSSSNLLCYRDLLLLFNNAIVFFSKSSNESTAAYELRSVVSNQMKK 380

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225450325|ref|XP_002268328.1| PREDICTED: uncharacterized protein LOC100263099 [Vitis vinifera] gi|147768907|emb|CAN75881.1| hypothetical protein VITISV_024454 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741222|emb|CBI32173.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15224877|ref|NP_181971.1| DNA-binding bromodomain-containing protein [Arabidopsis thaliana] gi|3128185|gb|AAC16089.1| unknown protein [Arabidopsis thaliana] gi|21539425|gb|AAM53265.1| unknown protein [Arabidopsis thaliana] gi|32306497|gb|AAP78932.1| At2g44430 [Arabidopsis thaliana] gi|330255325|gb|AEC10419.1| DNA-binding bromodomain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449519334|ref|XP_004166690.1| PREDICTED: uncharacterized protein LOC101228284 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297824459|ref|XP_002880112.1| hypothetical protein ARALYDRAFT_483567 [Arabidopsis lyrata subsp. lyrata] gi|297325951|gb|EFH56371.1| hypothetical protein ARALYDRAFT_483567 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224121050|ref|XP_002330891.1| bromodomain protein [Populus trichocarpa] gi|222872713|gb|EEF09844.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449436657|ref|XP_004136109.1| PREDICTED: uncharacterized protein LOC101208443 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224104539|ref|XP_002313471.1| bromodomain protein [Populus trichocarpa] gi|222849879|gb|EEE87426.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297817306|ref|XP_002876536.1| hypothetical protein ARALYDRAFT_907533 [Arabidopsis lyrata subsp. lyrata] gi|297322374|gb|EFH52795.1| hypothetical protein ARALYDRAFT_907533 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
TAIR|locus:2050574 646 AT2G44430 [Arabidopsis thalian 0.800 0.410 0.4 1.9e-44
TAIR|locus:2101477 641 AT3G60110 [Arabidopsis thalian 0.918 0.474 0.360 1e-43
TAIR|locus:2060040 631 AT2G42150 [Arabidopsis thalian 0.465 0.244 0.378 1.1e-37
TAIR|locus:2095878 632 AT3G57980 [Arabidopsis thalian 0.480 0.251 0.359 1.8e-37
TAIR|locus:1006230673 475 BRD4 "AT1G61215" [Arabidopsis 0.326 0.227 0.339 2.8e-16
TAIR|locus:2050574 AT2G44430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 468 (169.8 bits), Expect = 1.9e-44, P = 1.9e-44
 Identities = 112/280 (40%), Positives = 157/280 (56%)

Query:    61 PWLEHLRKVRVDELKRELQRCDLSILSLQLQVKKLEEERE----KPDLEIEKTRSLNDND 116
             PWLE LR +RV EL+RE++R D SILSLQL+VKKLEEERE    KPDLE E+    ++ND
Sbjct:   131 PWLEQLRNLRVAELRREVERYDCSILSLQLKVKKLEEEREVGEEKPDLENERKEERSEND 190

Query:   117 KTDDPQKSERRPVKEVFNNRFLVSPAXXXXXXXXXXXXXTGFNPKHLLPKS-------EP 169
              ++   + +     E  +                      G  P              +P
Sbjct:   191 GSESEHREKAVSAAEESDRENRSMNESNSTATAGEEERVCGDEPSQTREDDSGNDKNPDP 250

Query:   170 EPAGGQSPVLSRSKGELG-DSVTPLSSDVQSSASFGIGTERKRGSAAAGGHIIEGTYAES 228
             +P    +      +G +   S    S ++  S +     +RKR      G I     ++S
Sbjct:   251 DPVNKDATAAEEEEGSVSRGSEASHSDELGESGTSESKWKRKRRKQGGAGEI-RSAESKS 309

Query:   229 EPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACIL 288
             +PLI LLDLIR+H     SLFERRL+SQE+ +YK +V+QH+D+ETIQ ++++GSY +  L
Sbjct:   310 QPLISLLDLIRSHPRG--SLFERRLRSQEAKDYKSMVKQHLDIETIQRKLKQGSYDSSSL 367

Query:   289 TFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKR 328
              FYRDL LLF NAIV+FP +S ES AAH+LR +VS E+++
Sbjct:   368 IFYRDLQLLFTNAIVFFPLSSSESMAAHELRAVVSQEMRK 407
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2101477 AT3G60110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060040 AT2G42150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095878 AT3G57980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230673 BRD4 "AT1G61215" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
smart00297107 smart00297, BROMO, bromo domain 8e-16
cd0436999 cd04369, Bromodomain, Bromodomain 8e-16
pfam0043984 pfam00439, Bromodomain, Bromodomain 5e-10
cd05492109 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like 4e-06
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 3e-05
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 5e-05
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-04
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 7e-04
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 8e-04
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 0.001
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 0.002
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 0.004
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 0.004
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 0.004
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information 
 Score = 71.9 bits (177), Expect = 8e-16
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 226 AESEPLIRLLDLIRT--HNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSY 283
              + L  LL  +     +H L   F + +  +E+ +Y +++++ +DL+TI+ ++E G Y
Sbjct: 3   KLQKKLQELLKAVLDKLDSHPLSWPFLKPVSRKEAPDYYDIIKKPMDLKTIKKKLENGKY 62

Query: 284 SACILTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKR 328
           S  +  F  D  L+F+NA  Y    S   + A +L      +++ 
Sbjct: 63  S-SVEEFVADFNLMFSNARTYNGPDSEVYKDAKKLEKFFEKKLRE 106

Length = 107
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.96
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.96
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.96
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.96
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.95
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.95
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.95
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.95
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.94
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.94
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.94
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.94
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.94
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.94
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.94
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.94
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.94
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.93
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.93
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.93
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.93
KOG1474 640 consensus Transcription initiation factor TFIID, s 99.93
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.93
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.93
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.92
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.92
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.92
smart00297107 BROMO bromo domain. 99.92
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.92
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.91
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.91
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.9
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.9
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.9
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.89
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.88
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.79
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.78
COG5076 371 Transcription factor involved in chromatin remodel 99.74
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.64
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.38
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 99.29
KOG00081563 consensus Transcription initiation factor TFIID, s 99.12
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 99.08
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 98.91
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 98.86
KOG0008 1563 consensus Transcription initiation factor TFIID, s 98.85
KOG1472 720 consensus Histone acetyltransferase SAGA/ADA, cata 98.8
KOG1474 640 consensus Transcription initiation factor TFIID, s 98.68
KOG1828 418 consensus IRF-2-binding protein CELTIX-1, contains 98.67
KOG1828 418 consensus IRF-2-binding protein CELTIX-1, contains 98.41
COG5076371 Transcription factor involved in chromatin remodel 97.92
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 96.79
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 95.91
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 94.81
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 92.73
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 92.1
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 92.09
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 91.94
KOG06441113 consensus Uncharacterized conserved protein, conta 90.08
smart0059589 MADF subfamily of SANT domain. 85.87
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information 
Probab=99.96  E-value=6.9e-29  Score=206.21  Aligned_cols=102  Identities=22%  Similarity=0.383  Sum_probs=97.5

Q ss_pred             cchhHHHHHHHHHHhc-CCCCCccccccCCcc--cchhHHHhhccCCCHHHHHHHHhcCCccCcHHHHHHHHHHHHHHHh
Q 020105          226 AESEPLIRLLDLIRTH-NHHLPSLFERRLKSQ--ESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAI  302 (331)
Q Consensus       226 ~~~q~L~~iL~~L~~h-k~~~a~~F~~PVd~~--e~PdY~~iIk~PMDL~TIk~KL~~g~Y~S~~~EF~rDl~Lmf~NA~  302 (331)
                      ...+.|+.+|+.|.+| +.  ||+|.+||++.  ++||||++|++||||+||++||++|.|.++. +|..||.|||+||+
T Consensus         3 ~l~~~~~~il~~l~~~~~~--s~~F~~PV~~~~~~~pdY~~iIk~PmDL~tI~~kL~~~~Y~s~~-ef~~D~~li~~Na~   79 (108)
T cd05495           3 ELRQALMPTLEKLYKQDPE--SLPFRQPVDPKLLGIPDYFDIVKNPMDLSTIRRKLDTGQYQDPW-QYVDDVWLMFDNAW   79 (108)
T ss_pred             HHHHHHHHHHHHHHHcCcc--cchhcCCCCccccCCCcHHHHhCCCCCHHHHHHHHhcCCCCCHH-HHHHHHHHHHHHHH
Confidence            4456799999999999 99  99999999986  7999999999999999999999999999999 99999999999999


Q ss_pred             hhCCCCCHHHHHHHHHHHHHHHHHHhhc
Q 020105          303 VYFPKASLESEAAHQLRNLVSNEIKRTK  330 (331)
Q Consensus       303 ~YN~~~S~~~~~A~~Lr~l~~k~m~k~~  330 (331)
                      .||+++|.+|.+|..|+++|.++|+..|
T Consensus        80 ~yN~~~s~i~~~a~~l~~~F~~~~~~~~  107 (108)
T cd05495          80 LYNRKTSRVYKYCTKLAEVFEQEIDPVM  107 (108)
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999999999999876

Cbp (CREB binding protein or CREBBP) is an acetyltransferase acting on histone, which gives a specific tag for transcriptional activation and also acetylates non-histone proteins. CREBBP binds specifically to phosphorylated CREB protein and augments the activity of phosphorylated CREB to activate transcription of cAMP-responsive genes. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 6e-12
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-11
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-10
2dat_A123 Possible global transcription activator SNF2L2; br 7e-10
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 9e-10
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-09
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-08
2grc_A129 Probable global transcription activator SNF2L4; br 5e-08
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 7e-08
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 8e-08
2d9e_A121 Peregrin; four-helix bundle, transcription activat 1e-07
3rcw_A135 Bromodomain-containing protein 1; transcription, s 2e-07
3d7c_A112 General control of amino acid synthesis protein 5; 2e-07
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 4e-07
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 7e-07
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-06
3nxb_A116 CAT eye syndrome critical region protein 2; struct 2e-06
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 3e-06
2r0y_A311 Chromatin structure-remodeling complex protein RSC 3e-06
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-06
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 5e-06
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 1e-04
3aad_A292 Transcription initiation factor TFIID subunit 1; p 6e-06
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 4e-04
2r10_A361 Chromatin structure-remodeling complex protein RSC 7e-06
2r10_A 361 Chromatin structure-remodeling complex protein RSC 5e-04
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 9e-06
4alg_A154 Bromodomain-containing protein 2; signaling protei 3e-05
3p1f_A119 CREB-binding protein; structural genomics consorti 4e-05
3dai_A130 ATPase family AAA domain-containing protein 2; anc 4e-05
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 5e-05
3fkm_X166 Signaling protein; bromodomain, malaria, structura 5e-05
3uv4_A158 Second bromodomain of human transcription initiat 6e-05
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 7e-05
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 9e-05
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 3e-04
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
 Score = 61.2 bits (149), Expect = 6e-12
 Identities = 24/103 (23%), Positives = 42/103 (40%), Gaps = 7/103 (6%)

Query: 233 RLLDLIRTH----NHHLPSLFERRLKSQESN-EYKELVRQHVDLETIQTRVERGSYSACI 287
            + D I ++       L +     L  ++ N +Y E +   +DL TI+ ++  G Y   +
Sbjct: 16  EICDGIISYKDSSRQALAAPLLN-LPPKKKNADYYEKISDPLDLITIEKQILTGYYK-TV 73

Query: 288 LTFYRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIKRTK 330
             F  D+L +F NA  Y+ + S       +LR    N      
Sbjct: 74  EAFDADMLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARHEAS 116
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.96
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.96
3d7c_A112 General control of amino acid synthesis protein 5; 99.96
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.96
2dat_A123 Possible global transcription activator SNF2L2; br 99.96
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.96
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.95
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.95
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.95
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.95
3p1f_A119 CREB-binding protein; structural genomics consorti 99.95
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.95
2grc_A129 Probable global transcription activator SNF2L4; br 99.95
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.95
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.95
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.95
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.95
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.95
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.95
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.95
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.95
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.95
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.95
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.94
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.94
3uv4_A158 Second bromodomain of human transcription initiat 99.94
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.94
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.93
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 99.92
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.92
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.91
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.91
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 99.9
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.9
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.89
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.89
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.89
2r10_A 361 Chromatin structure-remodeling complex protein RSC 99.85
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 99.84
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.77
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.62
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 95.44
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 95.14
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 94.69
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 94.43
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 93.75
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 92.72
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 92.65
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 92.56
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 92.5
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 91.83
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 91.8
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 91.16
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 88.91
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 88.49
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 88.14
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 88.12
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 87.97
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 87.64
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 87.41
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 85.79
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 84.72
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 84.32
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 83.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 83.54
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 83.15
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 81.98
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 81.51
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 80.19
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
Probab=99.96  E-value=7.8e-30  Score=211.64  Aligned_cols=103  Identities=21%  Similarity=0.302  Sum_probs=98.7

Q ss_pred             ccchhHHHHHHHHHHhcCCCCCccccccCCcccchhHHHhhccCCCHHHHHHHHhcCCccCcHHHHHHHHHHHHHHHhhh
Q 020105          225 YAESEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVY  304 (331)
Q Consensus       225 ~~~~q~L~~iL~~L~~hk~~~a~~F~~PVd~~e~PdY~~iIk~PMDL~TIk~KL~~g~Y~S~~~EF~rDl~Lmf~NA~~Y  304 (331)
                      ....+.|..||+.|..|+.  +|+|.+||++..+||||++|++||||+||++||++|.|.++. +|..||.|||.||+.|
T Consensus        12 ~~~~~~c~~il~~l~~~~~--s~~F~~pv~~~~~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~-~f~~D~~li~~Na~~y   88 (117)
T 3g0l_A           12 SKDLALCSMILTEMETHED--AWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLE-TFALDVRLVFDNCETF   88 (117)
T ss_dssp             TTHHHHHHHHHHHHHTSTT--CGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHH-HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhCCC--chhhcCcCChhhcCChHHHcCCCCCHHHHHHHHhCCCCCCHH-HHHHHHHHHHHHHHHH
Confidence            4556779999999999999  999999999999999999999999999999999999999999 9999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHhhc
Q 020105          305 FPKASLESEAAHQLRNLVSNEIKRTK  330 (331)
Q Consensus       305 N~~~S~~~~~A~~Lr~l~~k~m~k~~  330 (331)
                      |+++|.+|.+|..|+++|.+.|.+.+
T Consensus        89 N~~~s~~~~~A~~L~~~f~~~~~~~~  114 (117)
T 3g0l_A           89 NEDDSDIGRAGHNMRKYFEKKWTDTF  114 (117)
T ss_dssp             SCSSSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999998765
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 4e-11
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 9e-11
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 2e-10
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 4e-10
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-09
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 3e-08
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.9 bits (137), Expect = 4e-11
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 3/97 (3%)

Query: 231 LIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTF 290
           L  LL  I++H    P  F   +K  E+ +Y E++R  +DL+T+  R+    Y      F
Sbjct: 7   LKNLLAQIKSHPSAWP--FMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYV-TRKLF 63

Query: 291 YRDLLLLFNNAIVYFPKASLESEAAHQLRNLVSNEIK 327
             DL  +  N   Y P  S     A  L      ++K
Sbjct: 64  VADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLK 100
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.96
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.95
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.95
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.94
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.94
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 96.55
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 95.46
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 95.22
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 95.16
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 94.57
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 94.42
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 93.39
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 92.72
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 91.5
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 90.59
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 88.43
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 86.93
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1.2e-29  Score=204.58  Aligned_cols=98  Identities=27%  Similarity=0.351  Sum_probs=94.8

Q ss_pred             hhHHHHHHHHHHhcCCCCCccccccCCcccchhHHHhhccCCCHHHHHHHHhcCCccCcHHHHHHHHHHHHHHHhhhCCC
Q 020105          228 SEPLIRLLDLIRTHNHHLPSLFERRLKSQESNEYKELVRQHVDLETIQTRVERGSYSACILTFYRDLLLLFNNAIVYFPK  307 (331)
Q Consensus       228 ~q~L~~iL~~L~~hk~~~a~~F~~PVd~~e~PdY~~iIk~PMDL~TIk~KL~~g~Y~S~~~EF~rDl~Lmf~NA~~YN~~  307 (331)
                      .+.|..||+.|.+|+.  ++||..||++.++|+|+++|++||||+||++||++|.|.++. +|..||.|||.||+.||++
T Consensus         4 ~~~l~~il~~l~~~~~--s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~-~f~~D~~li~~Na~~yN~~   80 (102)
T d3d7ca1           4 YTTLKNLLAQIKSHPS--AWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRK-LFVADLQRVIANCREYNPP   80 (102)
T ss_dssp             HHHHHHHHHHHHHSGG--GGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHH-HHHHHHHHHHHHHHHHSCT
T ss_pred             HHHHHHHHHHHHhCCC--CCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHH-HHHHHHHHHHHHHHHHCCC
Confidence            3568999999999999  999999999999999999999999999999999999999999 9999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHh
Q 020105          308 ASLESEAAHQLRNLVSNEIKR  328 (331)
Q Consensus       308 ~S~~~~~A~~Lr~l~~k~m~k  328 (331)
                      +|++|.+|..|+++|.++|++
T Consensus        81 ~s~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          81 DSEYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             TSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHhc
Confidence            999999999999999999875
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure