Citrus Sinensis ID: 020385
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 327 | ||||||
| 224093272 | 442 | predicted protein [Populus trichocarpa] | 0.969 | 0.717 | 0.681 | 1e-115 | |
| 255576776 | 450 | kinetochore protein nuf2, putative [Rici | 0.969 | 0.704 | 0.681 | 1e-115 | |
| 225447975 | 453 | PREDICTED: kinetochore protein Nuf2 [Vit | 0.978 | 0.706 | 0.653 | 1e-106 | |
| 224140705 | 429 | predicted protein [Populus trichocarpa] | 0.932 | 0.710 | 0.659 | 1e-103 | |
| 225430476 | 453 | PREDICTED: probable kinetochore protein | 0.981 | 0.708 | 0.641 | 3e-99 | |
| 147852218 | 473 | hypothetical protein VITISV_036492 [Viti | 0.969 | 0.670 | 0.646 | 4e-99 | |
| 449486560 | 393 | PREDICTED: kinetochore protein Nuf2-like | 0.981 | 0.816 | 0.567 | 3e-91 | |
| 356512606 | 461 | PREDICTED: uncharacterized protein LOC10 | 0.975 | 0.691 | 0.582 | 5e-91 | |
| 449452094 | 446 | PREDICTED: kinetochore protein Nuf2-like | 0.981 | 0.719 | 0.567 | 6e-91 | |
| 145336916 | 440 | kinetochore protein Nuf2 [Arabidopsis th | 0.951 | 0.706 | 0.514 | 8e-79 |
| >gi|224093272|ref|XP_002309861.1| predicted protein [Populus trichocarpa] gi|222852764|gb|EEE90311.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 419 bits (1078), Expect = e-115, Method: Compositional matrix adjust.
Identities = 216/317 (68%), Positives = 262/317 (82%)
Query: 3 LFPFLNLRDTKMNLLRPIAEDLTRLDEQRSELEDKISQLNAEIAAYNEVRERELPLVQEV 62
+ F +D+KMN LRPI E+LT LDEQR LEDKISQLNAEIA YN+ RERELPL QEV
Sbjct: 121 ILNFCLHKDSKMNELRPIGEELTLLDEQRRGLEDKISQLNAEIAEYNDARERELPLAQEV 180
Query: 63 DAKVKELRQTIQDLNKHQVSLRTTLNKLKEKTGALDEKFSQTEFDLVQSVQQNADLRSKI 122
D KVKELRQ I DLN HQ+SLR + KLKE++ +D + S+ EFDLVQSVQ+NA+LRSKI
Sbjct: 181 DGKVKELRQEIADLNNHQMSLRASYRKLKERSSEMDGEISRAEFDLVQSVQENANLRSKI 240
Query: 123 VQSPEKLQRTLEEKKSIREEARDAEKLAMQSFQEKTTTLEVYQKTLKKMSKQSAQMQAIL 182
VQSP+KLQR LEEKKS+REEAR+AE+LAMQSF+ KT LEVY K LKKMSK QMQAI
Sbjct: 241 VQSPDKLQRALEEKKSVREEARNAERLAMQSFEAKTAVLEVYTKALKKMSKHFDQMQAIH 300
Query: 183 EQVNSAKSIEKDYKSLKARLNDDVVLDKSLEAKLIERQGKVEQLDELQQQLEKERNLKSE 242
EQVNSAKSIEKDYK+LKA+L+DD ++DKSL+AKL+E Q K +QL+EL++ LEKER++K E
Sbjct: 301 EQVNSAKSIEKDYKALKAKLSDDGLMDKSLDAKLVELQMKAQQLNELKKLLEKERDMKCE 360
Query: 243 DATRAFENVKLEMESKRQDLEARQKKVEAVVTEVDAITSKTKFVKESGAAKLQELASKAE 302
+AT+ + +K E+ESKR DLEARQ++VEAV++EVDAITSKT V ESGAAK+Q+L SK E
Sbjct: 361 EATKEYNTIKSEVESKRHDLEARQRRVEAVLSEVDAITSKTNMVNESGAAKVQKLVSKRE 420
Query: 303 EIVEKFQQYTNSIGTLL 319
EI E+F++Y NSI LL
Sbjct: 421 EIAEQFKKYKNSIEPLL 437
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255576776|ref|XP_002529275.1| kinetochore protein nuf2, putative [Ricinus communis] gi|223531264|gb|EEF33107.1| kinetochore protein nuf2, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225447975|ref|XP_002269064.1| PREDICTED: kinetochore protein Nuf2 [Vitis vinifera] gi|298204517|emb|CBI23792.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224140705|ref|XP_002323719.1| predicted protein [Populus trichocarpa] gi|222866721|gb|EEF03852.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225430476|ref|XP_002283312.1| PREDICTED: probable kinetochore protein NUF2 [Vitis vinifera] gi|296082133|emb|CBI21138.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147852218|emb|CAN82250.1| hypothetical protein VITISV_036492 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449486560|ref|XP_004157332.1| PREDICTED: kinetochore protein Nuf2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356512606|ref|XP_003525009.1| PREDICTED: uncharacterized protein LOC100815227 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449452094|ref|XP_004143795.1| PREDICTED: kinetochore protein Nuf2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145336916|ref|NP_176296.2| kinetochore protein Nuf2 [Arabidopsis thaliana] gi|19423962|gb|AAL87331.1| unknown protein [Arabidopsis thaliana] gi|22136892|gb|AAM91790.1| unknown protein [Arabidopsis thaliana] gi|332195644|gb|AEE33765.1| kinetochore protein Nuf2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 327 | ||||||
| TAIR|locus:2206071 | 440 | AT1G61000 [Arabidopsis thalian | 0.951 | 0.706 | 0.485 | 6.5e-74 | |
| ZFIN|ZDB-GENE-050208-275 | 2037 | golga4 "golgin A4" [Danio reri | 0.862 | 0.138 | 0.243 | 1.8e-10 | |
| DICTYBASE|DDB_G0286985 | 1024 | zipA "zipper-like domain-conta | 0.886 | 0.283 | 0.235 | 2.9e-10 | |
| ASPGD|ASPL0000042966 | 1153 | AN2480 [Emericella nidulans (t | 0.850 | 0.241 | 0.234 | 1.6e-09 | |
| ZFIN|ZDB-GENE-030131-6206 | 1937 | myhc4 "myosin heavy chain 4" [ | 0.853 | 0.144 | 0.246 | 3e-09 | |
| TAIR|locus:2045412 | 1333 | AT2G32240 "AT2G32240" [Arabido | 0.889 | 0.218 | 0.216 | 3.3e-09 | |
| ZFIN|ZDB-GENE-040426-1121 | 454 | nuf2 "NUF2, NDC80 kinetochore | 0.923 | 0.665 | 0.184 | 3.3e-09 | |
| ZFIN|ZDB-GENE-010328-15 | 1048 | hip1 "huntingtin interacting p | 0.743 | 0.231 | 0.225 | 4.8e-09 | |
| UNIPROTKB|F1SS62 | 1470 | MYH1 "Myosin-1" [Sus scrofa (t | 0.896 | 0.199 | 0.228 | 4.8e-09 | |
| UNIPROTKB|F1SS66 | 1935 | MYH13 "Uncharacterized protein | 0.877 | 0.148 | 0.230 | 5.1e-09 |
| TAIR|locus:2206071 AT1G61000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 746 (267.7 bits), Expect = 6.5e-74, P = 6.5e-74
Identities = 151/311 (48%), Positives = 224/311 (72%)
Query: 10 RDTKMNLLRPIAEDLTRLDEQRSELEDKISQLNAEIAAYNEVRERELPLVQEVDAKVKEL 69
+D+KM+L+RP AE+L LDEQR + E K++QLNAEI ++E ER+LP VQE++A +++L
Sbjct: 128 KDSKMDLIRPKAEELGLLDEQRKQCEAKVAQLNAEIGEFDEAVERDLPFVQELEANIEQL 187
Query: 70 RQTIQDLNKHQVSLRTTLNKLKEKTGALDEKFSQTEFDLVQSVQQNADLRSKIVQSPEKL 129
+ I +LN Q+SLR T K++EK+ +D + S+ EFDLV++VQ+NA+LRS+IVQSP+KL
Sbjct: 188 NKKILELNNQQMSLRATFQKMREKSTQMDNEISKAEFDLVETVQENANLRSQIVQSPDKL 247
Query: 130 QRTLEEKKSIREEARDAEKLAMQSFQEKTTTLEVYQKTLKKMSKQSAQMQAILEQVNSAK 189
Q LEEKK + E + AE+ AM +FQEK LEV++K LKK+ K S+Q+Q I EQV +AK
Sbjct: 248 QGALEEKKLVLGETKKAEQSAMVTFQEKAAILEVFEKALKKILKSSSQLQLINEQVTNAK 307
Query: 190 SIEKDYKSLKARLNDDVVLDKSLEAKLIERQGKVXXXXXXXXXXXXXRNLKSEDATRAFE 249
++EK++K+LK +L++D V KSLEAK++ER+ V + + +D T+
Sbjct: 308 TVEKEFKALKDKLSEDGVAYKSLEAKVVERERIVEQLNESLKQLEKEKAVMFDDWTKQLN 367
Query: 250 NVKLEMESKRQDLEARQKKVEAVVTEVDAITSKTKFVKESGAAKLQELASKAEEIVEKFQ 309
+K+E+ES+R++LE RQ VE+VV VD T+KT V++SG AK+++LA+K EEIV++F
Sbjct: 368 ELKVEVESRRRELETRQTNVESVVAMVDDNTAKTNQVRQSGEAKVKKLAAKYEEIVKQFH 427
Query: 310 QYTNSIGTLLP 320
+YT S LP
Sbjct: 428 EYTVSFDAFLP 438
|
|
| ZFIN|ZDB-GENE-050208-275 golga4 "golgin A4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000042966 AN2480 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6206 myhc4 "myosin heavy chain 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045412 AT2G32240 "AT2G32240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1121 nuf2 "NUF2, NDC80 kinetochore complex component, homolog" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010328-15 hip1 "huntingtin interacting protein 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SS62 MYH1 "Myosin-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SS66 MYH13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 327 | |||
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-05 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.001 | |
| PLN02939 | 977 | PLN02939, PLN02939, transferase, transferring glyc | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.003 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Score = 56.2 bits (136), Expect = 1e-08
Identities = 55/288 (19%), Positives = 125/288 (43%), Gaps = 12/288 (4%)
Query: 33 ELEDKISQLNAEIAAYNEVRERELPLVQEVDAKVKELRQTIQDLNKHQVSLRTTLNKLKE 92
EL +++ +L E+ E E +QE++ K++ELR + +L + L+ L L
Sbjct: 236 ELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALAN 295
Query: 93 KTGALDEKFSQTEFDLVQSVQQNADLRSKIVQSPEKLQRTLEEKKSIREEARDAEKLAMQ 152
+ L+++ L +Q +L +++ + KL EE + E+ + ++ ++
Sbjct: 296 EISRLEQQKQILRERLANLERQLEELEAQLEELESKLDELAEELAELEEKLEELKEE-LE 354
Query: 153 SFQEKTTTLEVYQKTLKKMSKQSAQMQAILEQVNSAKSIEKDYKSLKARLNDDVVLDKSL 212
S + + LE + L+ S+ + + + +E SL + L
Sbjct: 355 SLEAELEELEAELEELE--SRLEELEEQLETLRSKVAQLELQIASLNNEIE-------RL 405
Query: 213 EAKLIERQGKVEQLDELQQQLEKER-NLKSEDATRAFENVKLEMESKRQDLEARQKKVEA 271
EA+L + + E+L + ++L K+ + ++ E ++ E+E +++LE ++ +E
Sbjct: 406 EARLERLEDRRERLQQEIEELLKKLEEAELKELQAELEELEEELEELQEELERLEEALEE 465
Query: 272 VVTEVDAITSKTKFVKESGAAKLQELASKAEEIVEKFQQYTNSIGTLL 319
+ E++ + A L S E + E + ++ + LL
Sbjct: 466 LREELEEAEQALDAAERELAQLQARLDS-LERLQENLEGFSEGVKALL 512
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215507 PLN02939, PLN02939, transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.99 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.93 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.83 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.77 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.68 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.67 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.63 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.63 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.62 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.58 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.48 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.48 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.43 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.42 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.37 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.36 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.32 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.31 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.3 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.27 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.26 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.23 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.17 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.1 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.08 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.04 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.04 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.03 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.01 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 97.97 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.95 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.84 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.83 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.79 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.75 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.67 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.57 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.5 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.49 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.49 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.4 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.4 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.37 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.24 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.18 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.13 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.12 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.04 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.04 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.97 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 96.96 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.95 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.87 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 96.85 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 96.84 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.8 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.79 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.67 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.67 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.59 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.59 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.59 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.46 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.39 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.33 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.32 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.28 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.25 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.22 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.22 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.18 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 96.12 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.07 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.01 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 95.91 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 95.78 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.65 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 95.62 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.6 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 95.58 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.54 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 95.48 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.47 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.38 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.31 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.26 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 95.24 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 95.22 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.2 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.1 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 95.07 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.06 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.03 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.02 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.99 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 94.95 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.89 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.82 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 94.8 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 94.8 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.79 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 94.76 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 94.58 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.46 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.42 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 94.36 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 94.26 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 94.19 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 94.18 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.17 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 94.16 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 93.99 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 93.92 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 93.89 | |
| PRK09039 | 343 | hypothetical protein; Validated | 93.85 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 93.81 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 93.76 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 93.75 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.49 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 93.45 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.4 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 93.32 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 93.23 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 93.16 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 93.09 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 93.02 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 92.87 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 92.72 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 92.67 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 92.65 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 92.47 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.4 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 92.39 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 92.34 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 92.33 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.31 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.3 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 92.16 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 92.13 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 92.11 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 91.77 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 91.71 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.01 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 90.98 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 90.71 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 90.63 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 90.61 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 90.29 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 90.26 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 90.17 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 89.58 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 89.38 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.29 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 89.1 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 88.72 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 88.67 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 88.09 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 88.07 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 87.94 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 87.93 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 87.63 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 87.59 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 87.56 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 87.2 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 87.0 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 86.71 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 86.68 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 86.6 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 86.14 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 85.83 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 85.8 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 85.79 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 84.97 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 84.7 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 84.7 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 84.37 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 83.45 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 83.4 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 82.99 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 82.94 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 82.93 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 82.34 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 82.12 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 82.07 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 81.97 | |
| KOG4438 | 446 | consensus Centromere-associated protein NUF2 [Cell | 80.3 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 80.25 |
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-29 Score=229.96 Aligned_cols=318 Identities=19% Similarity=0.242 Sum_probs=259.6
Q ss_pred cccchhhhhhhchhhhHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHHHHHHHHH
Q 020385 2 LLFPFLNLRDTKMNLLRPIAEDLTRLDEQRSELEDKISQLNAEIAAYNEVRERELPLVQEVDAKVKELRQTIQDLNKHQV 81 (327)
Q Consensus 2 a~INf~~Free~~~~~~~l~~~~e~l~~~~~~l~~~~~~l~~~i~~~k~~~~~~e~~~~~l~~~~~eL~~~i~~l~~~q~ 81 (327)
|||||++|||+||++|+++..+.+++.+.+.++.+.+.++..++..+......++++++++...+.+|.+.+......|.
T Consensus 118 avvNfa~fRe~k~~~~~~~~~q~eslle~~~q~da~~qq~~~ele~~d~~~~~d~ee~kqlEe~ieeL~qsl~kd~~~~~ 197 (446)
T KOG4438|consen 118 AVVNFALFREEKMDLYRPFIQQLESLLELRKQLDAKYQQALKELERFDEDVEEDEEEVKQLEENIEELNQSLLKDFNQQM 197 (446)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHH-HHHHHhhhHHHHHHHHHHHHhchhhhhcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 020385 82 SLRTTLNKLKEKTGA-LDEKFSQTEFDLVQSVQQNADLRSKIVQSPEKLQRTLEEKKSIREEARDAEKLAMQSFQEKTTT 160 (327)
Q Consensus 82 ~l~~~~~~lk~~~~~-l~~~l~~~~~~i~~~~~e~~~L~s~iv~spe~lk~~le~l~~~~~~l~~~e~~~~~~~~~l~~~ 160 (327)
.+..++..++..... ..+.++.+.+.+.++.+....|+++||+||++|++.|++|+....+.++.-..+..+...+..+
T Consensus 198 ~l~~e~n~~k~s~~s~~~k~l~al~llv~tLee~~~~LktqIV~sPeKL~~~leemk~~l~k~k~~~~~l~~K~~iL~ek 277 (446)
T KOG4438|consen 198 SLLAEYNKMKKSSTSEKNKILNALKLLVVTLEENANCLKTQIVQSPEKLKEALEEMKDLLQKEKSAMVELQEKAKILEEK 277 (446)
T ss_pred HHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence 999999999988888 6677888888888899888889999999999999999999995555555555555666999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHH---HHHHhhchhhhhhHHHHHHHHHHHhHHHHHH-HHHHHHHHH
Q 020385 161 LEVYQKTLKKMSKQSAQMQAILEQVNSAKSIEKDYK---SLKARLNDDVVLDKSLEAKLIERQGKVEQLD-ELQQQLEKE 236 (327)
Q Consensus 161 ~e~~~~~e~el~~~~~~l~~~~~el~~~~~~~~~~~---~l~~~l~~~~~~~k~l~~~~~e~~~~~~~l~-~~l~~~~e~ 236 (327)
++.++.++.|+..|.+.+++...+..+.+.....++ .+.+.+.-...+.. .-.-...|..++..+. +.....+..
T Consensus 278 v~~~qti~~e~~~~lk~i~~~~~e~d~~Et~~v~lke~~~Le~q~e~~~~e~~-~lk~~e~~~kqL~~~~kek~~~~Qd~ 356 (446)
T KOG4438|consen 278 VTNLQTIEKELKALLKKISSDGVEYDSLETKVVELKEILELEDQIELNQLELE-KLKMFENLTKQLNELKKEKESRRQDL 356 (446)
T ss_pred hHHHHHHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999977777766333332 33333322111111 1111234444444433 444444444
Q ss_pred HHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHh
Q 020385 237 RNLKSEDATRAFENVKLEMESKRQDLEARQKKVEAVVTEVDAITS--KTKFVKESGAAKLQELASKAEEIVEKFQQYTNS 314 (327)
Q Consensus 237 ~~~~~~~~~~k~~~~~~e~~~~~~el~~~~~~~~~~~~ei~~le~--~i~~~~~~~e~e~~~~~~~~~~L~~~~~~Y~~~ 314 (327)
.++-.+...+.++........+++..+....++.+...++..++. ++...+..++..+.+|..+|..|..||+.|+.+
T Consensus 357 ~~r~~E~v~~~md~~~~~~n~V~~kr~a~~~kie~~~~~ik~~e~~l~~~~~r~e~~~~i~aI~l~~~llk~HV~~y~AE 436 (446)
T KOG4438|consen 357 ENRKTESVKAMMDDNIEKYNVVRQKRNAKVKKIEEKNEEIKKIELFLEIARGREELESQIVAITLECILLKMHVELYEAE 436 (446)
T ss_pred HHhhHHHHHHHHHHHHHHhcccchhhccHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 444455555566777777777777778888888888888888888 999999999999999999999999999999999
Q ss_pred Hhcccc
Q 020385 315 IGTLLP 320 (327)
Q Consensus 315 l~~~~~ 320 (327)
|...|-
T Consensus 437 l~~~m~ 442 (446)
T KOG4438|consen 437 LKRIMI 442 (446)
T ss_pred HHHHHH
Confidence 986654
|
|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG4438 consensus Centromere-associated protein NUF2 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 327 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-14 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 4e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 71.4 bits (175), Expect = 7e-14
Identities = 40/255 (15%), Positives = 103/255 (40%), Gaps = 21/255 (8%)
Query: 17 LRPIAEDLTRLDEQRSELEDKISQLNAEIAAYNEVRERELPLVQEVDAKVKELRQTIQDL 76
+ E +L ++ +++ ++ L ++ R++ D K+K++ I +
Sbjct: 936 IEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIM 995
Query: 77 NKHQVSLRTTLNKLKEKTGALDEKFSQTEFDLVQSVQQNADLRSKIVQSPEKLQRTLEEK 136
L L+E+ L ++ E + + L++K +L+ L+++
Sbjct: 996 EDQNNKLTKERKLLEERVSDLTTNLAEEE----EKAKNLTKLKNKHESMISELEVRLKKE 1051
Query: 137 KSIREEARDAEKLAMQSFQEKTTTLEVYQKTLKKMSKQSAQMQAILEQVNSAKSIEKDYK 196
+ R+E ++ + + ++ Q A+++A L E++ +
Sbjct: 1052 EKSRQELEKI-------KRKLEGESSDLHEQIAELQAQIAELKAQL------AKKEEELQ 1098
Query: 197 SLKARLNDDVVLDKSLEAKLIERQGKVEQLDELQQQLEKERNLKSEDATRAFENVKLEME 256
+ ARL D+ + K+ E + + +LQ+ LE E+ +++ A + ++ E+E
Sbjct: 1099 AALARLEDETSQKNNALKKIRELE---SHISDLQEDLESEKAARNK-AEKQKRDLSEELE 1154
Query: 257 SKRQDLEARQKKVEA 271
+ + +LE
Sbjct: 1155 ALKTELEDTLDTTAT 1169
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.27 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.18 | |
| 2ve7_C | 250 | Kinetochore protein NUF2, kinetochore protein SPC; | 98.38 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.57 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.34 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.11 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.54 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.26 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.23 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 94.95 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.9 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.64 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.55 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.55 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.42 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 94.41 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 94.39 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.36 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.1 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 93.87 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 93.74 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 93.52 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 92.79 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 92.55 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 92.46 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 92.2 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 92.19 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 91.98 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 91.72 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 91.26 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 90.85 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 90.73 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 89.93 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 89.01 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 88.69 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 88.42 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 88.32 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 87.67 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 86.55 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 84.89 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 84.45 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 84.39 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 83.96 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 83.76 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 83.22 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 82.5 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 80.91 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 80.68 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 80.59 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 80.42 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 80.27 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=99.27 E-value=5.8e-07 Score=79.34 Aligned_cols=99 Identities=9% Similarity=0.098 Sum_probs=43.7
Q ss_pred HHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 020385 20 IAEDLTRLDEQRSELEDKISQLNAEIAAYNEVRERELPLVQEVDAKVKELRQTIQDLNKHQVSLRTTLNKLKEKTGALDE 99 (327)
Q Consensus 20 l~~~~e~l~~~~~~l~~~~~~l~~~i~~~k~~~~~~e~~~~~l~~~~~eL~~~i~~l~~~q~~l~~~~~~lk~~~~~l~~ 99 (327)
+...+..+...+..+......+...+..+..........+..+...+..+...+..+......+...+..+......+..
T Consensus 4 ~~~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 83 (284)
T 1c1g_A 4 IKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEA 83 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 33444444444444444444444444444444444444444444444444444444444444444444444444444444
Q ss_pred HHhhhHHHHHHHHHHHHhc
Q 020385 100 KFSQTEFDLVQSVQQNADL 118 (327)
Q Consensus 100 ~l~~~~~~i~~~~~e~~~L 118 (327)
.+..+...+..+..++..+
T Consensus 84 ~~~~~~~~~~~~~~~~~~~ 102 (284)
T 1c1g_A 84 DVASLNRRIQLFEEELDRA 102 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHH
Confidence 4444444444444444443
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 87.97 |
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Prefoldin family: Prefoldin domain: Prefoldin beta subunit species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=87.97 E-value=2.3 Score=29.89 Aligned_cols=43 Identities=16% Similarity=0.179 Sum_probs=34.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHH
Q 020385 157 KTTTLEVYQKTLKKMSKQSAQMQAILEQVNSAKSIEKDYKSLK 199 (327)
Q Consensus 157 l~~~~e~~~~~e~el~~~~~~l~~~~~el~~~~~~~~~~~~l~ 199 (327)
+...+..|..+..++..+...+..+..++.-+..+..++..+.
T Consensus 3 lqe~~~~~q~lq~el~~~~~q~~~le~q~~E~~~vl~eL~~l~ 45 (107)
T d1fxka_ 3 VQHQLAQFQQLQQQAQAISVQKQTVEMQINETQKALEELSRAA 45 (107)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCC
Confidence 4566777888888999999999999998888888777777664
|