Citrus Sinensis ID: 020734

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MGDKSDTSPLIPPSTITEPSEIDLEAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWSPAPLPPEHVQQLKSLGLL
ccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccEEEEEEEccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccccccccccHHHHHHHHHcccc
cccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccEEEEEEcccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHEEEEEEHcHccccccccccEHHHccccccccEEcccccccEEEEccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHEEEEcccccccccccccccccHHHHHHHHHHccc
mgdksdtsplippstitepseidleagpgeqiqcricletdgrdfiapckckgtskyvhrECLDHWRAVREGFAfahcttckapyhlrVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLsgcfitcydrrvrndlaqpcrelclcccqpgicadchlpgtlcmwtdcttcfescastasecgclsgageaglPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLtkeyvvedvdgemtgsdwspaplppehvqqlkslgll
mgdksdtsplippstitepseidleagpGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTgsdwspaplppehvqqlkslgll
MGDKSDTSPLIPPSTITEPSEIDLEAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICgallffallglSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWSPAPLPPEHVQQLKSLGLL
******************************QIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVD***************************
*********************************CRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWSPAPLPPEHVQQLKSLGLL
***********PPSTITEPSEIDLEAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWSPAPLPPEHVQ********
******************************QIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWSPAPLPPEHVQQLKS*GLL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDKSDTSPLIPPSTITEPSEIDLEAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASLAYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQPCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFIMALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWSPAPLPPEHVQQLKSLGLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query322 2.2.26 [Sep-21-2011]
P40318 1319 ERAD-associated E3 ubiqui yes no 0.301 0.073 0.273 4e-06
Q6NZQ8289 E3 ubiquitin-protein liga yes no 0.478 0.532 0.289 1e-05
Q8TCQ1289 E3 ubiquitin-protein liga yes no 0.478 0.532 0.284 2e-05
Q5XH39264 E3 ubiquitin-protein liga N/A no 0.475 0.579 0.252 7e-05
Q28IK8264 E3 ubiquitin-protein liga no no 0.475 0.579 0.270 7e-05
Q80TE3409 E3 ubiquitin-protein liga no no 0.322 0.254 0.247 0.0001
Q86YJ5346 E3 ubiquitin-protein liga no no 0.326 0.303 0.245 0.0001
O60103 1242 ERAD-associated E3 ubiqui yes no 0.201 0.052 0.352 0.0001
Q3TZ87348 E3 ubiquitin-protein liga no no 0.326 0.301 0.245 0.0001
Q9DBD2286 E3 ubiquitin-protein liga no no 0.453 0.510 0.276 0.0002
>sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 9/106 (8%)

Query: 34  CRICL--ETDGRDFIAPCKCKGTSKYVHRECLDHWRA-----VREGFAFAHCTTCKAPYH 86
           CRIC    T+      PCKC+G+ KY+H  CL  W A     + +  A   C  C  P  
Sbjct: 39  CRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICHYPIQ 98

Query: 87  LRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIA-SLAYLVYLV 131
            +  + A+     + F   +++ I++ F   +L +   LA ++Y++
Sbjct: 99  FKT-IYAENMPEKIPFSLLLSKSILTFFEKARLALTIGLAAVLYII 143
E3 ubiquitin-protein ligase which accepts ubiquitin specifically from endoplasmic reticulum-associated UBC6 and UBC7 E2 ligases, and transfers it to substrates promoting their degradation. Mediates the degradation of a broad range of substrates, inluding endoplasmic reticulum membrane proteins (ERQC), soluble nuclear proteins and soluble cytoplasmic proteins (CytoQC). Component of the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains. ERAD-C substrates are ubiquitinated through DOA10 in conjunction with the E2 ubiquitin-conjugating enzymes UBC6 and UBC7-CUE1. Ubiquitinated substrates are then removed to the cytosol via the action of the UFD1-NPL4-CDC48/p97 (UNC) AAA ATPase complex and targeted to the proteasome. Also recognizes the N-terminally acetylated residue of proteins as degradation signal (degron). N-terminally acetylated target proteins include MATALPHA2, TBF1, SLK19, YMR090W, HIS3, HSP104, UBP6 and ARO8.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus musculus GN=March1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Homo sapiens GN=MARCH1 PE=1 SV=1 Back     alignment and function description
>sp|Q5XH39|MARH8_XENLA E3 ubiquitin-protein ligase MARCH8 OS=Xenopus laevis GN=march8 PE=2 SV=2 Back     alignment and function description
>sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xenopus tropicalis GN=march8 PE=2 SV=1 Back     alignment and function description
>sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus musculus GN=March4 PE=2 SV=3 Back     alignment and function description
>sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 Back     alignment and function description
>sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=doa10 PE=1 SV=1 Back     alignment and function description
>sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus musculus GN=March8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
255586586321 protein binding protein, putative [Ricin 0.987 0.990 0.940 1e-168
449451475323 PREDICTED: uncharacterized protein LOC10 0.996 0.993 0.890 1e-168
224083771323 predicted protein [Populus trichocarpa] 0.987 0.984 0.927 1e-167
225438613322 PREDICTED: uncharacterized protein LOC10 1.0 1.0 0.922 1e-167
356567834323 PREDICTED: uncharacterized protein LOC10 1.0 0.996 0.897 1e-164
356540054323 PREDICTED: uncharacterized protein LOC10 1.0 0.996 0.894 1e-164
334184365363 RING/FYVE/PHD zinc finger-containing pro 1.0 0.887 0.854 1e-157
79559917324 RING/FYVE/PHD zinc finger-containing pro 1.0 0.993 0.854 1e-156
297821411324 protein binding protein [Arabidopsis lyr 1.0 0.993 0.851 1e-156
326497791323 predicted protein [Hordeum vulgare subsp 0.978 0.975 0.829 1e-155
>gi|255586586|ref|XP_002533927.1| protein binding protein, putative [Ricinus communis] gi|223526107|gb|EEF28456.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 299/318 (94%), Positives = 307/318 (96%)

Query: 5   SDTSPLIPPSTITEPSEIDLEAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLD 64
            D SPLIPPS ITEPSEIDLEAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLD
Sbjct: 4   DDASPLIPPSPITEPSEIDLEAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLD 63

Query: 65  HWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRFFVTRDIISIFLAVQLVIASL 124
           HWRAVREGFAFAHCTTCKAPYHLRVHVAADR+WRTLKFRFFVTRDI  IFLAVQLVIASL
Sbjct: 64  HWRAVREGFAFAHCTTCKAPYHLRVHVAADRKWRTLKFRFFVTRDIAFIFLAVQLVIASL 123

Query: 125 AYLVYLVDTYQQSWLRLAWGFDSELSFYYICGALLFFALLGLSGCFITCYDRRVRNDLAQ 184
           AYLVYL+D+YQQSWLR  WGFD+ELSFYYICGALLFFALLGLSGCFITCYDRRVR+DLAQ
Sbjct: 124 AYLVYLIDSYQQSWLRHTWGFDNELSFYYICGALLFFALLGLSGCFITCYDRRVRSDLAQ 183

Query: 185 PCRELCLCCCQPGICADCHLPGTLCMWTDCTTCFESCASTASECGCLSGAGEAGLPLLFI 244
           PCRELCLCCCQPG+CADCHLPGTLCMWTDCTTCFESCAS A ECGCL GAGEAGLPLLFI
Sbjct: 184 PCRELCLCCCQPGMCADCHLPGTLCMWTDCTTCFESCASAAGECGCLGGAGEAGLPLLFI 243

Query: 245 MALIVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWS 304
           MAL+VLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWS
Sbjct: 244 MALVVLGLFTVIGIFYSVLVATMVGQRIWQRHYHILAKRMLTKEYVVEDVDGEMTGSDWS 303

Query: 305 PAPLPPEHVQQLKSLGLL 322
           P PLPPEHVQQLK+LGLL
Sbjct: 304 PPPLPPEHVQQLKNLGLL 321

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449451475|ref|XP_004143487.1| PREDICTED: uncharacterized protein LOC101214008 [Cucumis sativus] gi|449496454|ref|XP_004160138.1| PREDICTED: uncharacterized protein LOC101230263 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224083771|ref|XP_002307118.1| predicted protein [Populus trichocarpa] gi|222856567|gb|EEE94114.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225438613|ref|XP_002280917.1| PREDICTED: uncharacterized protein LOC100266317 [Vitis vinifera] gi|296082473|emb|CBI21478.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356567834|ref|XP_003552120.1| PREDICTED: uncharacterized protein LOC100791777 [Glycine max] Back     alignment and taxonomy information
>gi|356540054|ref|XP_003538506.1| PREDICTED: uncharacterized protein LOC100820355 [Glycine max] Back     alignment and taxonomy information
>gi|334184365|ref|NP_001189574.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|330252172|gb|AEC07266.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79559917|ref|NP_179802.2| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|28393273|gb|AAO42065.1| unknown protein [Arabidopsis thaliana] gi|28827342|gb|AAO50515.1| unknown protein [Arabidopsis thaliana] gi|330252171|gb|AEC07265.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297821411|ref|XP_002878588.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297324427|gb|EFH54847.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|326497791|dbj|BAJ94761.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
TAIR|locus:2197434321 AT1G11020 [Arabidopsis thalian 0.565 0.566 0.396 5.4e-51
TAIR|locus:2008056250 AT1G50440 [Arabidopsis thalian 0.409 0.528 0.489 5.3e-45
UNIPROTKB|F1NSN9235 MARCH1 "Uncharacterized protei 0.347 0.476 0.322 2.3e-07
RGD|1305148285 March1 "membrane-associated ri 0.375 0.424 0.328 3.7e-07
MGI|MGI:1920175289 March1 "membrane-associated ri 0.375 0.418 0.328 3.9e-07
ZFIN|ZDB-GENE-070912-276339 si:ch211-283p23.1 "si:ch211-28 0.322 0.306 0.229 4.4e-07
UNIPROTKB|Q8TCQ1289 MARCH1 "E3 ubiquitin-protein l 0.375 0.418 0.320 5e-07
UNIPROTKB|E2RSA2299 MARCH1 "Uncharacterized protei 0.375 0.404 0.320 5.5e-07
UNIPROTKB|F1MM17272 MARCH1 "Uncharacterized protei 0.350 0.415 0.325 1.2e-06
UNIPROTKB|D6REN1141 MARCH1 "E3 ubiquitin-protein l 0.192 0.439 0.415 1.3e-06
TAIR|locus:2197434 AT1G11020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 5.4e-51, Sum P(2) = 5.4e-51
 Identities = 80/202 (39%), Positives = 105/202 (51%)

Query:    20 SEIDLEAGPGEQIQCRICLETD----GRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAF 75
             +E DLE        CRICLE D    G + I+PC CKGT ++VHR CLDHWR+V+EGFAF
Sbjct:    49 AEEDLENDASSAPCCRICLEDDSELLGDELISPCMCKGTQQFVHRSCLDHWRSVKEGFAF 108

Query:    76 AHCTTCKAPYHLRVHVAADRR-WRT-LKFRFFVTRDIISIFLAVQLVIASLAYLVYLVD- 132
             +HCTTCKA +HLRV    D   WR   KFR FV RD++ +FLAVQ VIA +A   Y++D 
Sbjct:   109 SHCTTCKAQFHLRVEPFEDNNSWRRKAKFRLFVARDVLLVFLAVQTVIAVMAGFAYMMDK 168

Query:   133 ------TYQQSWLRLAWGFDSELSFYYICXXXXXXXXXXXSGCFITCYDRRVRNDLAQPC 186
                   ++   W R+       + FYY              G  + C      +     C
Sbjct:   169 DGEFRNSFNDDWDRIL--SKHPIPFYYCIGVISFFVLTGFLGIILHCSALNGNDPRMAGC 226

Query:   187 RELCLCCCQPGICADCHLPGTL 208
             +    CC   G+  DC  P ++
Sbjct:   227 QN---CCYGWGVL-DC-FPASM 243
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2008056 AT1G50440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSN9 MARCH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305148 March1 "membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1920175 March1 "membrane-associated ring finger (C3HC4) 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-276 si:ch211-283p23.1 "si:ch211-283p23.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TCQ1 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSA2 MARCH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM17 MARCH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D6REN1 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_V000091
hypothetical protein (323 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 1e-09
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 1e-08
pfam1290647 pfam12906, RINGv, RING-variant domain 5e-08
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 0.004
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 52.7 bits (127), Expect = 1e-09
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 33 QCRICLE--TDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCK 82
           CRIC +   +G   ++PC+CKG+ KYVH+ECL+ W             TC+
Sbjct: 1  ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINES------GNKTCE 46

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 322
PHA02825162 LAP/PHD finger-like protein; Provisional 99.78
PHA02862156 5L protein; Provisional 99.75
KOG3053293 consensus Uncharacterized conserved protein [Funct 99.62
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.6
KOG1609323 consensus Protein involved in mRNA turnover and st 99.58
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.55
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.53
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 96.34
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.35
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.23
PHA02929238 N1R/p28-like protein; Provisional 95.06
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 94.77
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 94.69
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 94.14
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 92.35
cd0016245 RING RING-finger (Really Interesting New Gene) dom 92.11
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 91.78
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 90.83
PF04120132 Iron_permease: Low affinity iron permease ; InterP 89.67
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 89.49
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 89.27
KOG149384 consensus Anaphase-promoting complex (APC), subuni 88.58
PHA02926242 zinc finger-like protein; Provisional 88.36
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 88.14
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 86.64
PF07010259 Endomucin: Endomucin; InterPro: IPR010740 This fam 85.71
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 85.18
smart0050463 Ubox Modified RING finger domain. Modified RING fi 84.39
PF05478 806 Prominin: Prominin; InterPro: IPR008795 The promin 82.93
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 80.82
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information 
Probab=99.78  E-value=4.3e-19  Score=156.64  Aligned_cols=98  Identities=24%  Similarity=0.532  Sum_probs=74.2

Q ss_pred             cCCCCCCCeeEEeccCCCCccccccccCCCCcccchhHHHHHHHHhcCcCccccccCCCceeeeEeeCcccccccceeeE
Q 020734           25 EAGPGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLRVHVAADRRWRTLKFRF  104 (322)
Q Consensus        25 e~~s~e~~~CRIC~e~e~~~LIsPC~CkGS~kyVH~~CL~~Wi~~s~~~~~~~CElCK~~Y~~~~~~k~~~~W~~lk~~~  104 (322)
                      |+.++.++.||||+++++ ++.+||+|+||++|||++||++|++.++   ...||+|+++|.++...++.++|...+...
T Consensus         2 ~~~s~~~~~CRIC~~~~~-~~~~PC~CkGs~k~VH~sCL~rWi~~s~---~~~CeiC~~~Y~i~~~~kpl~~W~~~~~dc   77 (162)
T PHA02825          2 EDVSLMDKCCWICKDEYD-VVTNYCNCKNENKIVHKECLEEWINTSK---NKSCKICNGPYNIKKNYKKCTKWRCSFRDC   77 (162)
T ss_pred             CCcCCCCCeeEecCCCCC-CccCCcccCCCchHHHHHHHHHHHhcCC---CCcccccCCeEEEEEecCCCccccccCcch
Confidence            456778899999998765 5789999999999999999999999886   578999999999999999999997654321


Q ss_pred             eeechhHHHHHHHHHHHHHhheeEE
Q 020734          105 FVTRDIISIFLAVQLVIASLAYLVY  129 (322)
Q Consensus       105 ~err~Il~ifL~l~~lI~svs~lVy  129 (322)
                         .+...++..+-.+++.+++.+-
T Consensus        78 ---~~~~l~~~llcl~~~~i~~~l~   99 (162)
T PHA02825         78 ---HDSAIVNSLLCLIVGGITYLLV   99 (162)
T ss_pred             ---hhHHHHHHHHHHHHhhhhheee
Confidence               1223333333334444444443

>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF04120 Iron_permease: Low affinity iron permease ; InterPro: IPR007251 Although originally identified as a low-affinity iron(II) permease [, ], Fet4 has since been shown to import several other transition metal ions, including copper [, ] and zinc [] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07010 Endomucin: Endomucin; InterPro: IPR010740 This family consists of several mammalian endomucin proteins Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF05478 Prominin: Prominin; InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 3e-16
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 5e-15
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 71.3 bits (175), Expect = 3e-16
 Identities = 18/59 (30%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 30 EQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLR 88
          +   C IC E  G +    C C G  + VHR CL  W  +        C  C   Y+ R
Sbjct: 5  DVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRN---TACQICGVVYNTR 60
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.74
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.59
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.49
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.18
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.17
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.94
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 96.9
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 96.77
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 96.66
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 96.65
2ysl_A73 Tripartite motif-containing protein 31; ring-type 96.55
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.55
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 96.53
2ect_A78 Ring finger protein 126; metal binding protein, st 96.52
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 96.5
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.28
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.22
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 96.19
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.13
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 96.08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 95.99
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 95.85
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 95.82
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.76
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 95.7
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 95.69
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 95.44
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 95.44
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.08
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 94.68
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 94.68
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 94.67
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 94.61
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 94.42
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 94.4
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 94.32
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 94.32
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 94.22
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 94.16
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 94.11
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 94.0
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 93.15
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 93.09
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 92.81
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 92.32
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 92.18
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 91.9
1z6u_A150 NP95-like ring finger protein isoform B; structura 91.88
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 91.51
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 91.38
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 90.51
2ea5_A68 Cell growth regulator with ring finger domain prot 89.19
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 88.63
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 87.59
1weu_A91 Inhibitor of growth family, member 4; structural g 87.39
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 84.27
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 84.19
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 83.95
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 83.87
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 82.64
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 82.47
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.74  E-value=3.7e-19  Score=132.17  Aligned_cols=58  Identities=31%  Similarity=0.721  Sum_probs=51.8

Q ss_pred             CCCCCeeEEeccCCCCccccccccCCCCcccchhHHHHHHHHhcCcCccccccCCCceeee
Q 020734           28 PGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLR   88 (322)
Q Consensus        28 s~e~~~CRIC~e~e~~~LIsPC~CkGS~kyVH~~CL~~Wi~~s~~~~~~~CElCK~~Y~~~   88 (322)
                      ++++++||||+++++++++.||+|+||++|||++||++|++.++   ...||+|+++|+++
T Consensus         3 ~~~~~~CrIC~~~~~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~---~~~C~~C~~~~~~r   60 (60)
T 1vyx_A            3 DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISR---NTACQICGVVYNTR   60 (60)
T ss_dssp             TCSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHT---CSBCTTTCCBCCCC
T ss_pred             CCCCCEeEEeecCCCCceecCcCCCCchhhhHHHHHHHHHHhCC---CCccCCCCCeeecC
Confidence            34678999999877778999999999999999999999999886   37999999999864
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 322
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-06
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 43.3 bits (101), Expect = 1e-06
 Identities = 18/59 (30%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 30 EQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLR 88
          +   C IC E  G +    C C G  + VHR CL  W  +        C  C   Y+ R
Sbjct: 5  DVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTI---SRNTACQICGVVYNTR 60

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.47
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.41
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.28
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.08
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.98
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 96.86
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 96.26
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.1
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 95.58
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 94.75
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 93.41
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 91.13
d2c2la280 STIP1 homology and U box-containing protein 1, STU 85.54
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 83.48
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.47  E-value=5.9e-15  Score=106.65  Aligned_cols=58  Identities=31%  Similarity=0.721  Sum_probs=51.6

Q ss_pred             CCCCCeeEEeccCCCCccccccccCCCCcccchhHHHHHHHHhcCcCccccccCCCceeee
Q 020734           28 PGEQIQCRICLETDGRDFIAPCKCKGTSKYVHRECLDHWRAVREGFAFAHCTTCKAPYHLR   88 (322)
Q Consensus        28 s~e~~~CRIC~e~e~~~LIsPC~CkGS~kyVH~~CL~~Wi~~s~~~~~~~CElCK~~Y~~~   88 (322)
                      +++.++|+||+++.+++++.||.|+|+..++|+.||++|++.++   ..+|++|+++|+++
T Consensus         3 ded~~~C~IC~~~~~~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~---~~~CP~Cr~~~~~k   60 (60)
T d1vyxa_           3 DEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISR---NTACQICGVVYNTR   60 (60)
T ss_dssp             TCSCCEETTTTEECSCCCCCSCCCSSGGGSCCHHHHHHHHHHHT---CSBCTTTCCBCCCC
T ss_pred             CCCCCCCccCCccCCCceeEecccCCCCCEEcHHHHHHHHhhCC---CCCCcccCCeeecC
Confidence            34678999999987778999999999999999999999999886   36899999999864
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure