Citrus Sinensis ID: 020773

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MDDNLISPKLQSCKDAILHKLMNFARDKAPSEDSVGDQKADLDKGKKKICDDEMWENQVKDASAIDHAKSSSSESIISKIPNSSNSELSYHDEDDNDDNYGNMDDYADDDYEYDDTDMYEDNYATMQSQFDNVDLPPGVEASLPWLKDIASSQDVTSVSSTTSISDLSESKRKATISYLGESKSKLAFVSHSTASVESISDEKEEKEESRVMANIQGFKQFDTVDDFSDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGASD
cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHccccccccccccccHHHHHHHHHHHHHHHcccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEccccccccccEEEEEEEccccccccccEEEEEcccccc
cccccccccHHHHHHHHHHHHHHHHHccccccccEccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccHHHHHHccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccHHcccEEEEccccccHHHcccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHEEccccccccccEEEEEEEccccccccccEEEEEcccccc
mddnlispklqsCKDAILHKLMNfardkapsedsvgdqkadldkgkkkicddemwenqvkdasaidhakssssesiiskipnssnselsyhdeddnddnygnmddyadddyeyddtdmyednyatmqsqfdnvdlppgveaslpwlkdiassqdvtsvssttsisdlseSKRKATISYLGESKSKLAFVSHSTASVESISDEKEEKEESRVMANIqgfkqfdtvddfsdhhynrmgflgeekppknWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVmigpsgtpyhdglfvfdcifppsypneppvVFITIQGASD
mddnlispklqSCKDAILHKLMNFardkapsedsvgdqkadldkgkkkicddEMWENQVKDasaidhakssssesiiskipnssnselsyhdeddnddnyGNMDDYADDDYEYDDTDMYEDNYATMQSQFDNVDLPPGVEASLPWLKDIassqdvtsvssttsisdlseskrKATISYLgesksklafvshstasvesisdekeekEESRVMANIQGFKQFDTVDDFSDHHYNRMgflgeekppknWAKKIQEEWKIleknlpdtIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGASD
MDDNLISPKLQSCKDAILHKLMNFARDKAPSEDSVGDQKADLDKGKKKICDDEMWENQVKDASAIDHAkssssesiiskipnssnseLSYHdeddnddnygnmddyadddyeyddtdmyednyATMQSQFDNVDLPPGVEASLPWLKDIAssqdvtsvssttsisdlsesKRKATISYLGESKSKLAFVSHSTAsvesisdekeekeesRVMANIQGFKQFDTVDDFSDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGASD
***************AILHKL*************************************************************************************************Y***YA****************ASLPWL*******************************************************************NIQGFKQFDTVDDFSDHHYNRMGFLGEE**PKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITI*****
***NLISPKLQS*K*AILHKLMNFARDKAPSE*****************************************************************DNYGNMDDYADDDYEYDDTDMYEDNYATMQSQFDNVDLPPGVEA************************************************************************NIQGFKQFDTVDDFSDHH*******************IQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQG***
MDDNLISPKLQSCKDAILHKLMNFARD******************KKKICDDEMWENQVKDAS**************SKIPNSSNSELSYHDEDDNDDNYGNMDDYADDDYEYDDTDMYEDNYATMQSQFDNVDLPPGVEASLPWLKDIAS*********************KATISYLGESKSKLAFV*********************VMANIQGFKQFDTVDDFSDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGASD
**DNLISPKLQSCKDAILHKLMNFARDKAPSEDSVGDQKADLDKGKKKICDDEMWENQVK***********************************NDDNYGNMDDYADDDYEYDDTDMYEDNYATMQSQFDNVDLPPGVEASLPWLKDIA**********************************************************SRVMANIQGFKQFDTVDDFSDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITI*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDNLISPKLQSCKDAILHKLMNFARDKAPSEDSVGDQKADLDKGKKKICDDEMWENQVKDASAIDHAKSSSSESIISKIPNSSNSELSYHDEDDNDDNYGNMDDYADDDYEYDDTDMYEDNYATMQSQFDNVDLPPGVEASLPWLKDIASSQDVTSVSSTTSISDLSESKRKATISYLGESKSKLAFVSHSTASVESISDEKEEKEESRVMANIQGFKQFDTVDDFSDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGASD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query321 2.2.26 [Sep-21-2011]
Q8GY87 543 Probable ubiquitin-conjug yes no 0.629 0.372 0.339 8e-32
Q9LUQ5 609 Probable ubiquitin-conjug no no 0.327 0.172 0.557 8e-31
Q8VY10 907 Probable ubiquitin-conjug no no 0.295 0.104 0.583 2e-30
Q9ZVX1 1102 Probable ubiquitin-conjug no no 0.292 0.085 0.5 4e-23
Q6ZPJ3 1288 Ubiquitin-conjugating enz yes no 0.246 0.061 0.388 2e-10
Q9C0C9 1292 Ubiquitin-conjugating enz yes no 0.246 0.061 0.376 6e-10
Q9NR09 4857 Baculoviral IAP repeat-co no no 0.514 0.033 0.256 3e-08
O88738 4882 Baculoviral IAP repeat-co no no 0.168 0.011 0.407 2e-07
Q11076 728 Probable ubiquitin-conjug yes no 0.274 0.120 0.326 8e-07
Q7ZY08 192 Ubiquitin-conjugating enz N/A no 0.205 0.343 0.388 5e-06
>sp|Q8GY87|UBC26_ARATH Probable ubiquitin-conjugating enzyme E2 26 OS=Arabidopsis thaliana GN=UBC26 PE=2 SV=2 Back     alignment and function desciption
 Score =  137 bits (346), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 126/265 (47%), Gaps = 63/265 (23%)

Query: 98  DNYGN----MDDYADDDYEYDDTDMYEDNYATMQSQFDNVDLPPGVEASLPW-------- 145
           D YG+      ++A+   + DD  MY+D         D  D+P G E ++PW        
Sbjct: 86  DYYGHKNIPFSEFANQPIDVDDYSMYQD-------VLDPKDVPAGAEVTVPWGLNSSSKG 138

Query: 146 -----------------------------LKDIASSQDVTSVSSTTSISDLSESKRKATI 176
                                        L D    Q   ++ S+ S S +        +
Sbjct: 139 TAKSSISIMRSQSMKGYGTVSLATTNVPQLWDYTLPQQNQAIYSSVSFSAVQPQTPDVVM 198

Query: 177 ---------SYLGESKSKLAFVSHSTASVESISDEKEEKEESRVMANIQGFKQFDTVDDF 227
                    SY   + S     +   +SV+  S+ ++ KEE      ++ FK+FDTV+DF
Sbjct: 199 VTNPTPNPFSYDASASSSHPIAAEPISSVQDSSNARKLKEEF-----LRDFKRFDTVEDF 253

Query: 228 SDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSG 287
           SDHHY   G    ++  KNW KK+Q +WKILE +LP+ I VR CE+RM+LLRAV+IG  G
Sbjct: 254 SDHHYASKG-KSSKQHSKNWVKKVQADWKILENDLPEAISVRACESRMDLLRAVIIGAEG 312

Query: 288 TPYHDGLFVFDCIFPPSYPNEPPVV 312
           TPYHDGLF FD  FP +YP+ PP V
Sbjct: 313 TPYHDGLFFFDIQFPDTYPSVPPNV 337
Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|Q9LUQ5|UBC25_ARATH Probable ubiquitin-conjugating enzyme E2 25 OS=Arabidopsis thaliana GN=UBC25 PE=2 SV=1 Back     alignment and function description
>sp|Q8VY10|UBC24_ARATH Probable ubiquitin-conjugating enzyme E2 24 OS=Arabidopsis thaliana GN=UBC24 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVX1|UBC23_ARATH Probable ubiquitin-conjugating enzyme E2 23 OS=Arabidopsis thaliana GN=UBC23 PE=3 SV=1 Back     alignment and function description
>sp|Q6ZPJ3|UBE2O_MOUSE Ubiquitin-conjugating enzyme E2 O OS=Mus musculus GN=Ube2o PE=1 SV=3 Back     alignment and function description
>sp|Q9C0C9|UBE2O_HUMAN Ubiquitin-conjugating enzyme E2 O OS=Homo sapiens GN=UBE2O PE=1 SV=3 Back     alignment and function description
>sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 Back     alignment and function description
>sp|O88738|BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus GN=Birc6 PE=1 SV=2 Back     alignment and function description
>sp|Q11076|UBC17_CAEEL Probable ubiquitin-conjugating enzyme protein 17 OS=Caenorhabditis elegans GN=ubc-17 PE=3 SV=3 Back     alignment and function description
>sp|Q7ZY08|UBE2T_XENLA Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevis GN=ube2t PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
359485378 511 PREDICTED: probable ubiquitin-conjugatin 0.897 0.563 0.465 1e-61
255553741 521 ubiquitin conjugating enzyme, putative [ 0.909 0.560 0.481 4e-60
118487743 526 unknown [Populus trichocarpa] 0.943 0.576 0.458 4e-59
147852875 532 hypothetical protein VITISV_004820 [Viti 0.897 0.541 0.430 7e-57
356510847 481 PREDICTED: probable ubiquitin-conjugatin 0.523 0.349 0.569 8e-57
302143294 472 unnamed protein product [Vitis vinifera] 0.778 0.529 0.435 4e-54
356528202 474 PREDICTED: probable ubiquitin-conjugatin 0.495 0.335 0.549 8e-50
115465381 509 Os05g0557600 [Oryza sativa Japonica Grou 0.769 0.485 0.363 2e-39
302143011 497 unnamed protein product [Vitis vinifera] 0.691 0.446 0.411 3e-39
125553272 509 hypothetical protein OsI_20939 [Oryza sa 0.769 0.485 0.359 4e-39
>gi|359485378|ref|XP_002274123.2| PREDICTED: probable ubiquitin-conjugating enzyme E2 26-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  243 bits (619), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 148/318 (46%), Positives = 206/318 (64%), Gaps = 30/318 (9%)

Query: 15  DAILHKLMNFARDKAPSEDSVGDQKA--DLDKGKKKICDDEMWENQVKDASAIDHAKSSS 72
           + +L   ++  RD+ P+  S+ ++K     +KGK KI  DE W+NQ + A A D  ++ +
Sbjct: 22  EVVLSDGIHIERDEGPTGLSITEEKVVTGGNKGKSKIDCDETWQNQAQVALAND-VRNPT 80

Query: 73  SESIISKIP----------------NSSNSELSYHDEDDNDDNYGNMDDYADDDYEYDDT 116
           SE+     P                N  NS+LSYHD+D  D    + DD     Y+ +D 
Sbjct: 81  SEAGSEDSPDPLKSFASGSSDLININGFNSDLSYHDDDAID----DDDDDDVSGYDDNDD 136

Query: 117 DMYEDNYATMQSQFDNVDLPPGVEASLPWLKDIASSQDVTSVSSTTSISDL-SESKRKAT 175
            +Y+D+Y  +Q+QFDNVD+PPGVEAS+PWLKD   S+ + +V  T+    L  +  R  +
Sbjct: 137 FLYDDDYLKLQAQFDNVDIPPGVEASVPWLKDPTPSEKMPAVVDTSPTPSLQGQCARVGS 196

Query: 176 ISYLGESKSKLAFVSHSTASVESISDEKEEKEESRVMANIQGFKQFDTVDDFSDHHYNRM 235
            S  GE ++K A  S ST   +S    +++     V+     FKQFDTV+DFSDHH++RM
Sbjct: 197 FSDPGEKETKTAATSSSTVPAQSGDGNQDD-----VLGKYLFFKQFDTVEDFSDHHFSRM 251

Query: 236 GFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLF 295
           GF+GE+ PPKNWAKKIQEEWKILE++LP+TIFVRV EARM+LLRAV++GP+GTPYHDGLF
Sbjct: 252 GFVGEQ-PPKNWAKKIQEEWKILERDLPETIFVRVYEARMDLLRAVIVGPAGTPYHDGLF 310

Query: 296 VFDCIFPPSYPNEPPVVF 313
           VFD +FPP+YP+ PP+V+
Sbjct: 311 VFDVLFPPNYPSVPPMVY 328

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255553741|ref|XP_002517911.1| ubiquitin conjugating enzyme, putative [Ricinus communis] gi|223542893|gb|EEF44429.1| ubiquitin conjugating enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118487743|gb|ABK95695.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147852875|emb|CAN79081.1| hypothetical protein VITISV_004820 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510847|ref|XP_003524145.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26-like [Glycine max] Back     alignment and taxonomy information
>gi|302143294|emb|CBI21855.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356528202|ref|XP_003532694.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26-like [Glycine max] Back     alignment and taxonomy information
>gi|115465381|ref|NP_001056290.1| Os05g0557600 [Oryza sativa Japonica Group] gi|49328017|gb|AAT58718.1| putative ubiquitin-conjugating enzyme [Oryza sativa Japonica Group] gi|113579841|dbj|BAF18204.1| Os05g0557600 [Oryza sativa Japonica Group] gi|222632521|gb|EEE64653.1| hypothetical protein OsJ_19507 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|302143011|emb|CBI20306.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|125553272|gb|EAY98981.1| hypothetical protein OsI_20939 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
TAIR|locus:2090096 609 UBC25 "ubiquitin-conjugating e 0.292 0.154 0.621 2.2e-33
TAIR|locus:2057589 907 PHO2 "AT2G33770" [Arabidopsis 0.292 0.103 0.587 1e-27
TAIR|locus:2039380 1102 UBC23 "AT2G16920" [Arabidopsis 0.292 0.085 0.5 2.2e-21
ASPGD|ASPL0000039397 1070 AN3136 [Emericella nidulans (t 0.305 0.091 0.359 1.1e-10
UNIPROTKB|F1P5I5 1328 UBE2O "Uncharacterized protein 0.271 0.065 0.382 5e-09
UNIPROTKB|F1PG13 1138 UBE2O "Uncharacterized protein 0.246 0.069 0.388 1.1e-08
UNIPROTKB|F1N3I3 1287 UBE2O "Uncharacterized protein 0.246 0.061 0.388 1.4e-08
UNIPROTKB|F1M403 1287 Ube2o "Protein Ube2o" [Rattus 0.246 0.061 0.388 1.4e-08
MGI|MGI:2444266 1288 Ube2o "ubiquitin-conjugating e 0.246 0.061 0.388 1.4e-08
UNIPROTKB|I3L6C1 1294 UBE2O "Uncharacterized protein 0.246 0.061 0.388 1.4e-08
TAIR|locus:2090096 UBC25 "ubiquitin-conjugating enzyme 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 2.2e-33, Sum P(2) = 2.2e-33
 Identities = 59/95 (62%), Positives = 75/95 (78%)

Query:   218 FKQFDTVDDFSDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMEL 277
             FK+FD V+DFSDHHY   G   ++   K+WAK+IQ+EW+ILEK+LP+ IFVR  E+RM+L
Sbjct:   305 FKRFDIVEDFSDHHYASKGTTSKQHS-KDWAKRIQDEWRILEKDLPEMIFVRAYESRMDL 363

Query:   278 LRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVV 312
             LRAV+IG  GTPYHDGLF FD  FP +YP+ PP+V
Sbjct:   364 LRAVIIGAQGTPYHDGLFFFDIFFPDTYPSTPPIV 398
GO:0005634 "nucleus" evidence=ISM
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
TAIR|locus:2057589 PHO2 "AT2G33770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039380 UBC23 "AT2G16920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000039397 AN3136 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5I5 UBE2O "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PG13 UBE2O "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3I3 UBE2O "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1M403 Ube2o "Protein Ube2o" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2444266 Ube2o "ubiquitin-conjugating enzyme E2O" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6C1 UBE2O "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018588001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (337 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 2e-17
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 8e-15
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 7e-11
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 1e-09
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 7e-05
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 2e-04
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information 
 Score = 77.2 bits (191), Expect = 2e-17
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 249 KKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNE 308
           K++Q+E K L+K+ P  I     E  +      + GP  TPY  G+F  D  FP  YP +
Sbjct: 2   KRLQKELKDLKKDPPSGISAEPVEENLLEWHGTIRGPPDTPYEGGIFKLDIEFPEDYPFK 61

Query: 309 PPVV-FITI 316
           PP V F+T 
Sbjct: 62  PPKVRFVTK 70

This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD. Length = 141
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 321
KOG0417148 consensus Ubiquitin-protein ligase [Posttranslatio 99.86
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.85
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.82
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.82
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 99.8
KOG0894 244 consensus Ubiquitin-protein ligase [Posttranslatio 99.8
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.76
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.74
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.71
KOG0426165 consensus Ubiquitin-protein ligase [Posttranslatio 99.71
KOG0418 200 consensus Ubiquitin-protein ligase [Posttranslatio 99.7
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.7
KOG0421175 consensus Ubiquitin-protein ligase [Posttranslatio 99.64
KOG0425171 consensus Ubiquitin-protein ligase [Posttranslatio 99.63
KOG0424158 consensus Ubiquitin-protein ligase [Posttranslatio 99.59
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.56
KOG0428 314 consensus Non-canonical ubiquitin conjugating enzy 99.53
KOG0422153 consensus Ubiquitin-protein ligase [Posttranslatio 99.44
KOG0427161 consensus Ubiquitin conjugating enzyme [Posttransl 99.43
KOG0423 223 consensus Ubiquitin-protein ligase [Posttranslatio 99.39
KOG0416 189 consensus Ubiquitin-protein ligase [Posttranslatio 99.24
KOG0420184 consensus Ubiquitin-protein ligase [Posttranslatio 98.84
KOG0896138 consensus Ubiquitin-conjugating enzyme E2 [Posttra 98.44
KOG0429 258 consensus Ubiquitin-conjugating enzyme-related pro 98.24
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 95.9
smart00591107 RWD domain in RING finger and WD repeat containing 95.28
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 88.27
PF14462122 Prok-E2_E: Prokaryotic E2 family E 80.79
>KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.86  E-value=5.3e-22  Score=173.09  Aligned_cols=74  Identities=27%  Similarity=0.478  Sum_probs=71.6

Q ss_pred             HHHHHHHHHHHHHhCCCCceEEEecCCCcceEEEEEeCCCCCCCCCCEEEEEEECCCCCCCCCCeEEEEcCCCC
Q 020773          247 WAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGAS  320 (321)
Q Consensus       247 a~KRLqKElk~Lqkd~P~gI~V~p~EdnL~~WravI~GPegTPYEGGlF~fdI~FP~dYP~sPPkVrFlT~glr  320 (321)
                      +.+||.||++.|++++|+||.+.+.++|++.|+|+|.||.+||||||.|++.|.||++||++||+|+|+|+.+|
T Consensus         2 a~~RI~kE~~~l~~dp~~~~~~~~~~dnl~~w~a~I~GP~~SpYEgG~F~l~I~~p~~YP~~PPkV~F~TkIyH   75 (148)
T KOG0417|consen    2 ASKRIIKELQDLLRDPPPGCSAGPVGDNLFHWQATILGPPGSPYEGGVFFLEIHFPEDYPFKPPKVRFLTKIYH   75 (148)
T ss_pred             cHHHHHHHHHHHhcCCCCCCccCCCCCceeeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCceEeeccccc
Confidence            35699999999999999999999999999999999999999999999999999999999999999999999887

>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
3ceg_A 323 Crystal Structure Of The Ubc Domain Of Baculoviral 2e-08
1yh2_A169 Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 1e-04
1jas_A152 Hsubc2b Length = 152 1e-04
1tte_A 215 The Structure Of A Class Ii Ubiquitin-Conjugating E 2e-04
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 3e-04
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 5e-04
1fxt_A149 Structure Of A Conjugating Enzyme-Ubiquitin Thioles 5e-04
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 6e-04
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 6e-04
>pdb|3CEG|A Chain A, Crystal Structure Of The Ubc Domain Of Baculoviral Iap Repeat- Containing Protein 6 Length = 323 Back     alignment and structure 
Iteration: 1

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%)
Query: 266 IFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGA 319
           +FVR  E R+++ + ++ GP+ TPY +G F FD  FP  YP+ PP+V +   G 
Sbjct: 100 VFVRCDEERLDIXKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTGG 153
>pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 5e-31
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 4e-14
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 1e-13
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 2e-13
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 3e-13
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 3e-13
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 3e-13
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 3e-13
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 3e-13
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 3e-13
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 4e-13
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 5e-13
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 5e-13
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 7e-13
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 1e-12
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 1e-12
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 1e-12
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 1e-12
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 2e-12
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 2e-12
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 3e-12
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 6e-12
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 7e-12
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 1e-11
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 1e-11
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 1e-11
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 2e-11
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 2e-11
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 2e-11
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 2e-11
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 4e-11
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 4e-11
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 9e-11
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 1e-10
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 1e-10
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 1e-10
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 2e-10
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 2e-10
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 3e-10
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 3e-10
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 4e-10
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 4e-10
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 5e-10
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 5e-10
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 2e-09
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 2e-09
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 5e-09
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 7e-09
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 2e-04
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
 Score =  118 bits (296), Expect = 5e-31
 Identities = 39/148 (26%), Positives = 66/148 (44%), Gaps = 14/148 (9%)

Query: 181 ESKSKLAFVSHSTASVESISDEKEEKEESRVMANIQGFKQFDTVDDFSD--------HHY 232
           E K        +         +  E++   VM  +Q F  F+ V +  D        +HY
Sbjct: 4   EKKLGEYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQ-FDTFEMVSEDEDGKLGFKVNYHY 62

Query: 233 NRMGFLGEEKPPKNWAKKIQEEWKILEKNLP----DTIFVRVCEARMELLRAVMIGPSGT 288
                   +      A+++ +E   L  +LP     ++FVR  E R+++++ ++ GP+ T
Sbjct: 63  MSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADT 122

Query: 289 PYHDGLFVFDCIFPPSYPNEPPVV-FIT 315
           PY +G F FD  FP  YP+ PP+V   T
Sbjct: 123 PYANGCFEFDVYFPQDYPSSPPLVNLET 150
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 99.88
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.87
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.87
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.87
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.87
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.86
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.86
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.86
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.86
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.85
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.85
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 99.85
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.85
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.85
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.85
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.85
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 99.85
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.85
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.85
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.84
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.84
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.84
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.84
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.84
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.84
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.84
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.84
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.83
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.83
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.83
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.83
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.83
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.83
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.82
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.82
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.82
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.81
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.8
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.8
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.8
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.79
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.78
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.78
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.77
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.77
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.77
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.77
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.76
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.76
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 99.72
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.71
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.46
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 98.65
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 97.86
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 96.87
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 96.37
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 94.73
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 94.52
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 94.35
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 92.23
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 91.89
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 87.21
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=1.1e-22  Score=194.85  Aligned_cols=114  Identities=32%  Similarity=0.597  Sum_probs=93.9

Q ss_pred             hhhHHHHHHhhhcCCcceecccCCCC--------CcccccCCCCCCCCChHHHHHHHHHHHHHHhCCCC----ceEEEec
Q 020773          204 EEKEESRVMANIQGFKQFDTVDDFSD--------HHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPD----TIFVRVC  271 (321)
Q Consensus       204 ~~~~e~~v~~~~~~fkqFd~V~~~sD--------Hhf~~~~~~~~~~~ss~a~KRLqKElk~Lqkd~P~----gI~V~p~  271 (321)
                      +++...+.| +..+|.+|++|.+.+|        |||..........++..+.+||++|++.|++++|+    ++++.+.
T Consensus        27 ~~~~y~~~~-~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~kRL~kEl~~L~k~~p~g~~~~i~v~~~  105 (323)
T 3ceg_A           27 LEEKYVAVM-KKLQFDTFEMVSEDEDGKLGFKVNYHYMSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCD  105 (323)
T ss_dssp             HHHHHHHHH-HTTSEEEECCEEECTTSCEEESSCCTTHHHHHTCCCCCCHHHHHHHHHHHHHHHHHCCCCSSCCEEEEEE
T ss_pred             HHHHHHHHH-HHhcCceeeecccccccccccccchHHHhhhhccCCCCCHHHHHHHHHHHHHHHhCCCCCcccceeeccc
Confidence            344444443 3457999999997765        67754322222257889999999999999999887    4567888


Q ss_pred             CCCcceEEEEEeCCCCCCCCCCEEEEEEECCCCCCCCCCeEEEEcCC
Q 020773          272 EARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQG  318 (321)
Q Consensus       272 EdnL~~WravI~GPegTPYEGGlF~fdI~FP~dYP~sPPkVrFlT~g  318 (321)
                      ++|++.|+|+|.||++|||+||+|+|+|.||++||++||+|+|+|++
T Consensus       106 ednl~~w~~~I~GP~~TpYegG~F~l~I~fP~dYP~~PP~V~F~T~~  152 (323)
T 3ceg_A          106 EERLDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTG  152 (323)
T ss_dssp             SSCTTEEEEEEEBCTTSTTBTCEEEEEEECCTTTTTSCCEEEECCST
T ss_pred             CCCccccEEEEeCCCCCCcCCCEEEEEEeCCCCCCCCCCeEEEeccC
Confidence            99999999999999999999999999999999999999999999983
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 321
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 5e-13
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 5e-11
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 6e-11
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-10
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 1e-10
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 3e-10
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 4e-10
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 5e-10
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 1e-09
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 1e-09
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 1e-09
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 5e-09
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 7e-09
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 7e-09
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 8e-09
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 9e-09
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 4e-08
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 5e-08
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 7e-08
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 1e-07
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 1e-07
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 1e-07
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 4e-07
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 8e-07
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 1e-06
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 7e-06
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 3e-05
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 5e-05
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Caenorhabditis elegans, E2 2 [TaxId: 6239]

 Score = 63.7 bits (154), Expect = 5e-13
 Identities = 21/67 (31%), Positives = 33/67 (49%)

Query: 249 KKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNE 308
           K+IQ+E + L ++ P           +   +A ++GP  +PY  G+F     FP  YP +
Sbjct: 4   KRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFK 63

Query: 309 PPVVFIT 315
           PP V  T
Sbjct: 64  PPKVAFT 70
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.86
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.86
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.86
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.85
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.85
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.85
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.84
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.84
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.83
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.83
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.82
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.81
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.81
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.8
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.78
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.78
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.77
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.75
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.74
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.68
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.67
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.67
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 98.83
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 98.09
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 94.7
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 87.13
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 86.96
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 86.51
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 85.91
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 T [TaxId: 9606]

Probab=99.86  E-value=6e-22  Score=166.66  Aligned_cols=75  Identities=29%  Similarity=0.518  Sum_probs=72.8

Q ss_pred             HHHHHHHHHHHHHHhCCCCceEEEecCCCcceEEEEEeCCCCCCCCCCEEEEEEECCCCCCCCCCeEEEEcCCCC
Q 020773          246 NWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPVVFITIQGAS  320 (321)
Q Consensus       246 ~a~KRLqKElk~Lqkd~P~gI~V~p~EdnL~~WravI~GPegTPYEGGlF~fdI~FP~dYP~sPPkVrFlT~glr  320 (321)
                      .+++||++|++.|++++++||+|.+.++|++.|+|+|.||+||||+||+|+|.|.||++||++||+|+|+|+.+|
T Consensus         2 ~~~~Rl~kE~~~l~~~~~~gi~~~p~~~~~~~w~~~I~Gp~~TpY~gg~f~~~i~~p~~YP~~pP~v~f~t~i~H   76 (154)
T d1yh2a1           2 QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYH   76 (154)
T ss_dssp             HHHHHHHHHHHHHHHSCCTTEEEEESSSCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTSSCCEEEESSCCCB
T ss_pred             cHHHHHHHHHHHHHHCcCCCEEEEECCcchhhhhceEeCCCCCCCCCCEEEEEEecCccccCCCceeeccCCCCc
Confidence            578999999999999999999999999999999999999999999999999999999999999999999999876
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure