Citrus Sinensis ID: 020794

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MPLLRRLSSSLQQVVKFTNRSFKSLKFPGEPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELML
cccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccEEEccccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHccccccEEEccccccccEEEEEEEccccHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHcccEEEEccccccccccccHHHHHHHHcccEEccccccccccccccccEEEEEEEccccccHHccc
cccEEEEcccccHHEEccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccEEEccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEccccHHHHHHHHHHccccccEEEEEEEcccccccccHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEEHccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHccccEEEEEcccccccccccHHHHHHHHcccEEEEEEEEcccccccccEEEEEEEEEcccccHHHcc
MPLLRRLSSSLQQVVKFTNRsfkslkfpgepiessvsptlthgihvfhcpdeVGIVAKLSECIAsrggnilaadvfvpekknvfysrsefifdpikwpreqmdEDFFKLSKMFNAMRsvvrvpdidpkYKVAVLASKQEHCLVDFLygwqegklpvEITCVisnhdrgpnshVIRFLErhgipyhylcaKENEREEELLELVQNTDFLVLARYmqpvplqkeAYLGYKLLESlsskgsltSYFNMILSGKFLRSYGkdvinihhgllpsfkggkpakQAFDAGVKLIgatshfvteeldagpIIEQMLELLAISFATELML
mpllrrlsssLQQVVKFTnrsfkslkfpgePIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSefifdpikwprEQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELML
MPllrrlssslQQVVKFTNRSFKSLKFPGEPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKenereeellelVQNTDFLVLARYMQPVPLQKEAylgyklleslsskgsltsyFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELML
***************************************LTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFAT****
*******************************************IHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAIS***ELML
MPLLRRLSSSLQQVVKFTNRSFKSLKFPGEPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELML
*PLLRRLSSSLQQVVKFTNRSFK****************LTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLLRRLSSSLQQVVKFTNRSFKSLKFPGEPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query321 2.2.26 [Sep-21-2011]
O34990300 Formyltetrahydrofolate de yes no 0.694 0.743 0.344 3e-36
Q55135284 Formyltetrahydrofolate de N/A no 0.682 0.771 0.338 5e-32
P0A5T6310 Formyltetrahydrofolate de yes no 0.688 0.712 0.342 6e-30
P0A5T7310 Formyltetrahydrofolate de yes no 0.688 0.712 0.342 6e-30
Q03432278 Formyltetrahydrofolate de yes no 0.704 0.812 0.326 1e-27
P37051280 Formyltetrahydrofolate de N/A no 0.700 0.803 0.279 4e-27
P0A441280 Formyltetrahydrofolate de yes no 0.700 0.803 0.279 4e-27
P0A440280 Formyltetrahydrofolate de yes no 0.700 0.803 0.279 4e-27
Q46339286 Formyltetrahydrofolate de N/A no 0.700 0.786 0.317 2e-26
P218721003 Trifunctional purine bios yes no 0.473 0.151 0.324 3e-12
>sp|O34990|PURU_BACSU Formyltetrahydrofolate deformylase OS=Bacillus subtilis (strain 168) GN=purU PE=3 SV=2 Back     alignment and function desciption
 Score =  152 bits (385), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 143/267 (53%), Gaps = 44/267 (16%)

Query: 49  CPDEVGIVAKLSECIASRGGNILAADVFVPE-KKNVFYSRSEFIFDPIKWPREQMDEDFF 107
           CPD+ GIV+ +S  +   G NI+ ++ +  + +   F+ R EF    I+  +  +   F 
Sbjct: 26  CPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCAGIREKKSSLQAAFA 85

Query: 108 KLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDR 167
            +++ F+   S+    ++    +VA+  SK+ HCL + ++ WQ G L  EI  VISNH+ 
Sbjct: 86  SVAEKFDMTWSLTLASELK---RVAIFVSKELHCLHELIWEWQTGNLMAEIAVVISNHEE 142

Query: 168 GPNSHVIRFLERHGIPYHYLCAKENER---EEELLELVQ--NTDFLVLARYMQPVPLQKE 222
                    +ER  IP+HY+ A ++ R   E++ LEL++  + D +VLARYMQ       
Sbjct: 143 AR-----ELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDVDVIVLARYMQ------- 190

Query: 223 AYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDA 282
                                  IL+  F+ ++   +INIHH  LP+F G  P K+A++ 
Sbjct: 191 -----------------------ILTPDFVSAHPNRIINIHHSFLPAFIGANPYKRAYER 227

Query: 283 GVKLIGATSHFVTEELDAGPIIEQMLE 309
           GVKLIGATSH+VT +LD GPIIEQ +E
Sbjct: 228 GVKLIGATSHYVTNDLDEGPIIEQDIE 254

Bacillus subtilis (strain 168) (taxid: 224308)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 0
>sp|Q55135|PURU_SYNY3 Formyltetrahydrofolate deformylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purU PE=3 SV=1 Back     alignment and function description
>sp|P0A5T6|PURU_MYCTU Formyltetrahydrofolate deformylase OS=Mycobacterium tuberculosis GN=purU PE=3 SV=1 Back     alignment and function description
>sp|P0A5T7|PURU_MYCBO Formyltetrahydrofolate deformylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=purU PE=3 SV=1 Back     alignment and function description
>sp|Q03432|PURU_HAEIN Formyltetrahydrofolate deformylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purU PE=3 SV=2 Back     alignment and function description
>sp|P37051|PURU_ECOLI Formyltetrahydrofolate deformylase OS=Escherichia coli (strain K12) GN=purU PE=1 SV=1 Back     alignment and function description
>sp|P0A441|PURU_SHIFL Formyltetrahydrofolate deformylase OS=Shigella flexneri GN=purU PE=3 SV=1 Back     alignment and function description
>sp|P0A440|PURU_ECOL6 Formyltetrahydrofolate deformylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purU PE=3 SV=1 Back     alignment and function description
>sp|Q46339|PURU_CORS1 Formyltetrahydrofolate deformylase OS=Corynebacterium sp. (strain P-1) GN=purU PE=3 SV=1 Back     alignment and function description
>sp|P21872|PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus GN=GART PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
255579631341 phosphoribosylamine-glycine ligase, puta 0.890 0.838 0.701 1e-127
359495984329 PREDICTED: formyltetrahydrofolate deform 0.869 0.848 0.718 1e-127
449458970326 PREDICTED: formyltetrahydrofolate deform 0.878 0.865 0.677 1e-120
224074167317 formyltetrahydrofolate deformylase [Popu 0.831 0.842 0.690 1e-118
358248700316 uncharacterized protein LOC100780134 [Gl 0.847 0.860 0.680 1e-118
356563338316 PREDICTED: formyltetrahydrofolate deform 0.847 0.860 0.674 1e-117
224138620317 formyltetrahydrofolate deformylase [Popu 0.788 0.798 0.687 1e-113
357502477324 Formyltetrahydrofolate deformylase [Medi 0.859 0.851 0.663 1e-113
388513597322 unknown [Medicago truncatula] 0.859 0.857 0.663 1e-113
217071818324 unknown [Medicago truncatula] 0.859 0.851 0.663 1e-113
>gi|255579631|ref|XP_002530656.1| phosphoribosylamine-glycine ligase, putative [Ricinus communis] gi|223529789|gb|EEF31725.1| phosphoribosylamine-glycine ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 258/318 (81%), Gaps = 32/318 (10%)

Query: 5   RRLSSSLQQVVKFTNRSFKSLKFPGEPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIA 64
           RR+SS + QV  F NRSFKSLK PGE ++SS SP LTHGIHVFHCPD VGIVAKLS+CIA
Sbjct: 6   RRISSVIPQVFGFANRSFKSLKTPGEFLDSS-SPCLTHGIHVFHCPDAVGIVAKLSDCIA 64

Query: 65  SRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPD 124
           SRGGNIL ADVFVPE KNVFYSRSEF+ D IKWPR Q+DEDF KLSKMF+AM+SVVRVPD
Sbjct: 65  SRGGNILGADVFVPENKNVFYSRSEFVCDRIKWPRAQIDEDFLKLSKMFHAMKSVVRVPD 124

Query: 125 IDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPY 184
           +DPK+K+AVLASKQEHCL+D L+ WQ+G+ P+EITCVISNH+RGPN+H+IRFLER+GIPY
Sbjct: 125 LDPKFKIAVLASKQEHCLIDLLHRWQDGRFPIEITCVISNHERGPNTHLIRFLERNGIPY 184

Query: 185 HYLC-AKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYF 243
           HYLC  KEN+RE E+L+LV++TDFLVLARYMQ                            
Sbjct: 185 HYLCTTKENKREMEILDLVKDTDFLVLARYMQ---------------------------- 216

Query: 244 NMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPI 303
             ILSG FLRSYGKD+INIHHGLLPSFKGG P+KQAFDAGVKLIGAT+HFVTEELDAGPI
Sbjct: 217 --ILSGNFLRSYGKDIINIHHGLLPSFKGGHPSKQAFDAGVKLIGATTHFVTEELDAGPI 274

Query: 304 IEQMLELLAISFATELML 321
           IEQML ++ + ++  L+ 
Sbjct: 275 IEQMLLVIGVEYSCLLLF 292

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359495984|ref|XP_003635126.1| PREDICTED: formyltetrahydrofolate deformylase-like [Vitis vinifera] gi|297744389|emb|CBI37363.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458970|ref|XP_004147219.1| PREDICTED: formyltetrahydrofolate deformylase-like [Cucumis sativus] gi|449504944|ref|XP_004162337.1| PREDICTED: formyltetrahydrofolate deformylase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224074167|ref|XP_002304283.1| formyltetrahydrofolate deformylase [Populus trichocarpa] gi|222841715|gb|EEE79262.1| formyltetrahydrofolate deformylase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358248700|ref|NP_001240181.1| uncharacterized protein LOC100780134 [Glycine max] gi|255636588|gb|ACU18632.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356563338|ref|XP_003549921.1| PREDICTED: formyltetrahydrofolate deformylase-like [Glycine max] Back     alignment and taxonomy information
>gi|224138620|ref|XP_002326648.1| formyltetrahydrofolate deformylase [Populus trichocarpa] gi|222833970|gb|EEE72447.1| formyltetrahydrofolate deformylase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357502477|ref|XP_003621527.1| Formyltetrahydrofolate deformylase [Medicago truncatula] gi|355496542|gb|AES77745.1| Formyltetrahydrofolate deformylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388513597|gb|AFK44860.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217071818|gb|ACJ84269.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
TAIR|locus:2130893328 AT4G17360 [Arabidopsis thalian 0.619 0.606 0.675 2e-100
TAIR|locus:505006677323 AT5G47435 [Arabidopsis thalian 0.601 0.597 0.664 1.4e-99
UNIPROTKB|G4MX54284 MGG_08008 "Formyltetrahydrofol 0.205 0.232 0.560 2.7e-31
TIGR_CMR|CPS_4357286 CPS_4357 "formyltetrahydrofola 0.520 0.583 0.3 6.6e-30
TIGR_CMR|DET_1237284 DET_1237 "formyltetrahydrofola 0.504 0.570 0.300 6.6e-30
TIGR_CMR|CPS_3620292 CPS_3620 "formyltetrahydrofola 0.227 0.25 0.465 1e-27
TIGR_CMR|CPS_2482292 CPS_2482 "formyltetrahydrofola 0.208 0.229 0.492 1.3e-27
TIGR_CMR|CPS_4036292 CPS_4036 "formyltetrahydrofola 0.208 0.229 0.492 1.3e-27
UNIPROTKB|Q9KQK6277 VC_1992 "Formyltetrahydrofolat 0.190 0.220 0.540 3.1e-26
TIGR_CMR|VC_1992277 VC_1992 "formyltetrahydrofolat 0.190 0.220 0.540 3.1e-26
TAIR|locus:2130893 AT4G17360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 727 (261.0 bits), Expect = 2.0e-100, Sum P(2) = 2.0e-100
 Identities = 135/200 (67%), Positives = 160/200 (80%)

Query:    17 FTNRSFKSLKFPGEPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVF 76
             FT  SFKS +F GE ++SSVSP L  G HVFHCPD VGIVAKLS+CIA++GGNIL  DVF
Sbjct:    19 FTKWSFKSSQFHGESLDSSVSPLLIPGFHVFHCPDVVGIVAKLSDCIAAKGGNILGYDVF 78

Query:    77 VPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLAS 136
             VPE KNVFYSRSEFIFDP+KWPR QMDEDF  +++ F+A+ SVVRVP +DPKYK+A+L S
Sbjct:    79 VPENKNVFYSRSEFIFDPVKWPRRQMDEDFQTIAQKFSALSSVVRVPSLDPKYKIALLLS 138

Query:   137 KQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYL-CAKXXXXX 195
             KQ+HCLV+ L+ WQ+GKLPV+ITCVISNH+R PN+HV+RFL+RHGI YHYL         
Sbjct:   139 KQDHCLVEMLHKWQDGKLPVDITCVISNHERAPNTHVMRFLQRHGISYHYLPTTDQNKIE 198

Query:   196 XXXXXXVQNTDFLVLARYMQ 215
                   V+ TDFLVLARYMQ
Sbjct:   199 EEILELVKGTDFLVLARYMQ 218
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008864 "formyltetrahydrofolate deformylase activity" evidence=IEA;ISS
GO:0009058 "biosynthetic process" evidence=IEA;ISS
GO:0009152 "purine ribonucleotide biosynthetic process" evidence=ISS
GO:0016742 "hydroxymethyl-, formyl- and related transferase activity" evidence=IEA;ISS
GO:0009853 "photorespiration" evidence=IMP
GO:0046653 "tetrahydrofolate metabolic process" evidence=IMP
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
TAIR|locus:505006677 AT5G47435 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4MX54 MGG_08008 "Formyltetrahydrofolate deformylase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4357 CPS_4357 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1237 DET_1237 "formyltetrahydrofolate deformylase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3620 CPS_3620 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2482 CPS_2482 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4036 CPS_4036 "formyltetrahydrofolate deformylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQK6 VC_1992 "Formyltetrahydrofolate deformylase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1992 VC_1992 "formyltetrahydrofolate deformylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
PLN02828268 PLN02828, PLN02828, formyltetrahydrofolate deformy 1e-160
PRK06027286 PRK06027, purU, formyltetrahydrofolate deformylase 4e-84
COG0788287 COG0788, PurU, Formyltetrahydrofolate hydrolase [N 2e-79
cd08648196 cd08648, FMT_core_Formyl-FH4-Hydrolase_C, Formylte 5e-75
TIGR00655280 TIGR00655, PurU, formyltetrahydrofolate deformylas 8e-65
PRK13011286 PRK13011, PRK13011, formyltetrahydrofolate deformy 1e-59
PRK13010289 PRK13010, purU, formyltetrahydrofolate deformylase 6e-53
cd08645183 cd08645, FMT_core_GART, Phosphoribosylglycinamide 4e-35
COG0299200 COG0299, PurN, Folate-dependent phosphoribosylglyc 4e-31
PRK05647200 PRK05647, purN, phosphoribosylglycinamide formyltr 3e-29
pfam00551181 pfam00551, Formyl_trans_N, Formyl transferase 1e-27
TIGR00639190 TIGR00639, PurN, phosphoribosylglycinamide formylt 2e-22
cd08369173 cd08369, FMT_core, Formyltransferase, catalytic co 3e-22
cd0487574 cd04875, ACT_F4HF-DF, N-terminal ACT domain of for 2e-17
PLN02331207 PLN02331, PLN02331, phosphoribosylglycinamide form 2e-09
COG0223 307 COG0223, Fmt, Methionyl-tRNA formyltransferase [Tr 2e-08
TIGR00460 313 TIGR00460, fmt, methionyl-tRNA formyltransferase 4e-08
PLN02285 334 PLN02285, PLN02285, methionyl-tRNA formyltransfera 2e-07
cd08653152 cd08653, FMT_core_like_3, Formyl transferase catal 4e-07
cd08823177 cd08823, FMT_core_like_5, Formyl transferase catal 4e-06
cd08644203 cd08644, FMT_core_ArnA_N, ArnA, N-terminal formylt 6e-06
PRK06988 312 PRK06988, PRK06988, putative formyltransferase; Pr 6e-05
cd08646204 cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA f 1e-04
PRK08125 660 PRK08125, PRK08125, bifunctional UDP-glucuronic ac 3e-04
PRK07579245 PRK07579, PRK07579, hypothetical protein; Provisio 9e-04
PRK00005 309 PRK00005, fmt, methionyl-tRNA formyltransferase; R 0.001
cd0211660 cd02116, ACT, ACT domains are commonly involved in 0.003
>gnl|CDD|178422 PLN02828, PLN02828, formyltetrahydrofolate deformylase Back     alignment and domain information 
 Score =  446 bits (1149), Expect = e-160
 Identities = 180/252 (71%), Positives = 205/252 (81%), Gaps = 31/252 (12%)

Query: 59  LSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNAMRS 118
           LS+CIASRGGNIL  DVFVPE KNVFYSRSEFIFDP+KWPR QMDEDF ++SK F A++S
Sbjct: 1   LSDCIASRGGNILGVDVFVPENKNVFYSRSEFIFDPVKWPRAQMDEDFQEISKHFKALKS 60

Query: 119 VVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLE 178
           VVRVP +DPKYK+AVLASKQ+HCL+D L+ WQ+G+LPV+ITCVISNH+RGPN+HV+RFLE
Sbjct: 61  VVRVPGLDPKYKIAVLASKQDHCLIDLLHRWQDGRLPVDITCVISNHERGPNTHVMRFLE 120

Query: 179 RHGIPYHYLC-AKENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKG 237
           RHGIPYHYL   KEN+RE+E+LELV+ TDFLVLARYMQ                      
Sbjct: 121 RHGIPYHYLPTTKENKREDEILELVKGTDFLVLARYMQ---------------------- 158

Query: 238 SLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEE 297
                   ILSG FL+ YGKD+INIHHGLLPSFKGG P+KQAFDAGVKLIGATSHFVTEE
Sbjct: 159 --------ILSGNFLKGYGKDIINIHHGLLPSFKGGNPSKQAFDAGVKLIGATSHFVTEE 210

Query: 298 LDAGPIIEQMLE 309
           LDAGPIIEQM+E
Sbjct: 211 LDAGPIIEQMVE 222

Length = 268
>gnl|CDD|235676 PRK06027, purU, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|223859 COG0788, PurU, Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|187717 cd08648, FMT_core_Formyl-FH4-Hydrolase_C, Formyltetrahydrofolate deformylase (Formyl-FH4 hydrolase), C-terminal hydrolase domain Back     alignment and domain information
>gnl|CDD|233074 TIGR00655, PurU, formyltetrahydrofolate deformylase Back     alignment and domain information
>gnl|CDD|237266 PRK13011, PRK13011, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|139334 PRK13010, purU, formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|187714 cd08645, FMT_core_GART, Phosphoribosylglycinamide formyltransferase (GAR transformylase, GART) Back     alignment and domain information
>gnl|CDD|223376 COG0299, PurN, Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|235544 PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|144222 pfam00551, Formyl_trans_N, Formyl transferase Back     alignment and domain information
>gnl|CDD|161973 TIGR00639, PurN, phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>gnl|CDD|187712 cd08369, FMT_core, Formyltransferase, catalytic core domain Back     alignment and domain information
>gnl|CDD|153147 cd04875, ACT_F4HF-DF, N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>gnl|CDD|177965 PLN02331, PLN02331, phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>gnl|CDD|223301 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232983 TIGR00460, fmt, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|215159 PLN02285, PLN02285, methionyl-tRNA formyltransferase Back     alignment and domain information
>gnl|CDD|187721 cd08653, FMT_core_like_3, Formyl transferase catalytic core domain found in a group of proteins with unknown functions Back     alignment and domain information
>gnl|CDD|187725 cd08823, FMT_core_like_5, Formyl transferase catalytic core domain found in a group of proteins with unknown functions Back     alignment and domain information
>gnl|CDD|187713 cd08644, FMT_core_ArnA_N, ArnA, N-terminal formyltransferase domain Back     alignment and domain information
>gnl|CDD|235902 PRK06988, PRK06988, putative formyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|187715 cd08646, FMT_core_Met-tRNA-FMT_N, Methionyl-tRNA formyltransferase, N-terminal hydrolase domain Back     alignment and domain information
>gnl|CDD|236156 PRK08125, PRK08125, bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>gnl|CDD|236058 PRK07579, PRK07579, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|234567 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 321
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 100.0
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 100.0
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 100.0
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 100.0
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 100.0
PLN02828268 formyltetrahydrofolate deformylase 100.0
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 100.0
TIGR00639190 PurN phosphoribosylglycinamide formyltransferase, 100.0
PLN02331207 phosphoribosylglycinamide formyltransferase 100.0
PRK05647200 purN phosphoribosylglycinamide formyltransferase; 100.0
KOG3076206 consensus 5'-phosphoribosylglycinamide formyltrans 100.0
PLN02285 334 methionyl-tRNA formyltransferase 100.0
PF00551181 Formyl_trans_N: Formyl transferase; InterPro: IPR0 100.0
COG0223 307 Fmt Methionyl-tRNA formyltransferase [Translation, 100.0
PRK06988 312 putative formyltransferase; Provisional 100.0
TIGR00460 313 fmt methionyl-tRNA formyltransferase. The top-scor 100.0
PRK00005 309 fmt methionyl-tRNA formyltransferase; Reviewed 100.0
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.97
PRK07579245 hypothetical protein; Provisional 99.96
KOG3082 338 consensus Methionyl-tRNA formyltransferase [Transl 99.8
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 99.76
COG383090 ACT domain-containing protein [Signal transduction 99.72
KOG2452 881 consensus Formyltetrahydrofolate dehydrogenase [Nu 99.67
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 99.65
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 99.61
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 99.59
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 99.58
PRK0019490 hypothetical protein; Validated 99.57
PRK11589190 gcvR glycine cleavage system transcriptional repre 99.55
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 99.52
PRK11589190 gcvR glycine cleavage system transcriptional repre 99.07
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 98.96
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.64
COG2716176 GcvR Glycine cleavage system regulatory protein [A 98.54
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.27
COG2716176 GcvR Glycine cleavage system regulatory protein [A 98.14
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 98.09
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 97.96
PRK08577136 hypothetical protein; Provisional 97.91
CHL00100174 ilvH acetohydroxyacid synthase small subunit 97.84
PRK04435147 hypothetical protein; Provisional 97.83
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 97.81
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 97.74
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 97.73
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 97.67
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.66
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 97.65
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 97.58
PRK03381774 PII uridylyl-transferase; Provisional 97.58
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 97.55
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 97.53
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 97.5
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 97.42
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 97.41
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 97.39
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 97.27
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 97.21
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 97.18
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 97.12
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 97.11
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 97.06
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 97.06
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 97.04
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 97.01
cd0211660 ACT ACT domains are commonly involved in specifica 96.97
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.95
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 96.93
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 96.87
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 96.85
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 96.84
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 96.8
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 96.69
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 96.68
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.67
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 96.66
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 96.54
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 96.42
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 96.22
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 96.02
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 95.97
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 95.95
PRK07334403 threonine dehydratase; Provisional 95.79
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 95.6
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 95.6
COG4492150 PheB ACT domain-containing protein [General functi 95.57
PRK05092931 PII uridylyl-transferase; Provisional 95.49
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 95.3
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 95.3
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 95.25
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 94.89
COG1707218 ACT domain-containing protein [General function pr 94.81
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- 94.8
PRK03381774 PII uridylyl-transferase; Provisional 94.75
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 94.67
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 94.43
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 94.17
PRK05092931 PII uridylyl-transferase; Provisional 93.88
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 93.87
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 93.65
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 93.44
PLN02342348 ornithine carbamoyltransferase 93.44
cd0489265 ACT_AK-like_2 ACT domains C-terminal to the cataly 93.12
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 93.05
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 93.04
PRK03059856 PII uridylyl-transferase; Provisional 92.96
PRK04374869 PII uridylyl-transferase; Provisional 92.91
PRK08198404 threonine dehydratase; Provisional 92.66
PRK04374869 PII uridylyl-transferase; Provisional 92.57
PRK01759854 glnD PII uridylyl-transferase; Provisional 92.55
PRK05007884 PII uridylyl-transferase; Provisional 92.4
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 92.08
PRK08818370 prephenate dehydrogenase; Provisional 92.03
PRK05007884 PII uridylyl-transferase; Provisional 92.02
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona 91.87
PRK04284332 ornithine carbamoyltransferase; Provisional 91.74
PRK00275895 glnD PII uridylyl-transferase; Provisional 91.58
PRK06382406 threonine dehydratase; Provisional 91.51
COG4747142 ACT domain-containing protein [General function pr 91.33
PRK01759854 glnD PII uridylyl-transferase; Provisional 91.17
KOG2663309 consensus Acetolactate synthase, small subunit [Am 91.05
COG2150167 Predicted regulator of amino acid metabolism, cont 90.98
PRK00275895 glnD PII uridylyl-transferase; Provisional 90.98
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 90.74
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 90.58
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 90.56
cd0493764 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela 90.46
PRK06545359 prephenate dehydrogenase; Validated 90.36
PRK03059856 PII uridylyl-transferase; Provisional 90.33
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to th 90.3
cd0492466 ACT_AK-Arch_2 ACT domains of a monofunctional aspa 89.96
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 89.73
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 89.49
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal 89.38
PRK01713334 ornithine carbamoyltransferase; Provisional 89.29
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 89.2
cd0491865 ACT_AK1-AT_2 ACT domains located C-terminal to the 89.05
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 88.84
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 88.82
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter 88.06
PRK08526403 threonine dehydratase; Provisional 87.69
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 87.69
PRK02255338 putrescine carbamoyltransferase; Provisional 87.29
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 87.19
PRK11899279 prephenate dehydratase; Provisional 87.19
PRK00779304 ornithine carbamoyltransferase; Provisional 87.07
PRK13376 525 pyrB bifunctional aspartate carbamoyltransferase c 87.05
cd0491666 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal 86.78
COG2102223 Predicted ATPases of PP-loop superfamily [General 86.5
PRK06349426 homoserine dehydrogenase; Provisional 86.45
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 85.65
cd0486860 ACT_AK-like ACT domains C-terminal to the catalyti 85.3
cd0491566 ACT_AK-Ectoine_2 ACT domains located C-terminal to 84.57
cd0493663 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine- 84.3
PRK08192338 aspartate carbamoyltransferase; Provisional 84.16
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- 83.84
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 83.58
PLN02527306 aspartate carbamoyltransferase 82.84
cd0492363 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine- 82.45
PRK14805302 ornithine carbamoyltransferase; Provisional 82.28
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 82.21
PRK06291465 aspartate kinase; Provisional 81.46
cd0492180 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunc 81.09
TIGR00289222 conserved hypothetical protein TIGR00289. Homologo 80.98
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK 80.91
PF01902218 ATP_bind_4: ATP-binding region; InterPro: IPR00276 80.78
PRK10622386 pheA bifunctional chorismate mutase/prephenate deh 80.32
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.4e-66  Score=479.31  Aligned_cols=247  Identities=43%  Similarity=0.713  Sum_probs=232.7

Q ss_pred             CCCCcccEEEEEEcCCccchHHHHHHHHHhcCCeEeEeeeeccCCCCeEEEEEEEEeCCCCCChHHHHHHHHHHHHHhhh
Q 020794           36 VSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDEDFFKLSKMFNA  115 (321)
Q Consensus        36 ~~~~~~~~Iltv~G~Dr~GIVA~VS~~La~~G~NI~d~~q~~~~l~g~F~Mr~~v~~~~~~~~~~~L~~~L~~la~~lg~  115 (321)
                      |++.+++++||+.|||++||||+||++|+++||||++++|+.|...|+||||+++.....+.+.++|+++|++++++|||
T Consensus         1 m~~~~~~~~LtvsCpd~~GiVaais~~l~~~g~NI~~~~qf~D~~~g~FFmR~~f~~~~~~~~~~~l~~~f~~~a~~f~m   80 (287)
T COG0788           1 MSNEPDTFILTVSCPDQPGIVAAISGFLAEHGCNIVDSDQFDDPETGRFFMRVEFEGEGGPLDREALRAAFAPLAEEFGM   80 (287)
T ss_pred             CCCCccceEEEEecCCCCCcHHHHHHHHHHcCCceeecccccccccCeEEEEEEEecCCCcccHHHHHHHHHHHHHhhCc
Confidence            45666899999999999999999999999999999999999988899999999999888778899999999999999996


Q ss_pred             ccceeeeCCCCCCeeEEEEEeCCchhHHHHHHhhhcCCcCeeEEEEEeCCCCCCCchHHHHHHHcCCCEEEEc-CCcc--
Q 020794          116 MRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLC-AKEN--  192 (321)
Q Consensus       116 ~~~~~r~~~~~~~~rIavl~S~~g~~l~~lL~~~~~~~l~~~i~~Vis~~~~~~~~~v~~~a~~~gIP~~~~~-~~~~--  192 (321)
                         .|++.+.+.++||++|+|+++|||.+||.+|+.|+|+++|++|||||+     .+...++++|||+++++ .+++  
T Consensus        81 ---~~~~~~~~~~~ri~i~VSK~~HCL~DLL~r~~~g~L~~eI~~VIsNH~-----dl~~~v~~~~IPfhhip~~~~~k~  152 (287)
T COG0788          81 ---DWRLHDAAQRKRIAILVSKEDHCLGDLLYRWRIGELPAEIVAVISNHD-----DLRPLVERFDIPFHHIPVTKENKA  152 (287)
T ss_pred             ---eeEEeccccCceEEEEEechHHHHHHHHHHHhcCCcCCceEEEEcCCH-----HHHHHHHHcCCCeeeccCCCCcch
Confidence               478889999999999999999999999999999999999999999996     47899999999999999 4554  


Q ss_pred             hhHHHHHHHhc--CCCEEEEEeeccccchhhHhhhhhhhhhhhcccCcccccccccCChhHHhhcCCCeEEecCCCCCCC
Q 020794          193 EREEELLELVQ--NTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSF  270 (321)
Q Consensus       193 ~~~~~~~~~l~--~~Dlivlag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~~~~l~~~~~~~INiHpslLP~y  270 (321)
                      +.++.++++++  ++|++|||+|||                              ||+++|++++++++|||||||||+|
T Consensus       153 e~E~~~~~ll~~~~~DlvVLARYMq------------------------------ILS~d~~~~~~g~iINIHHSFLPaF  202 (287)
T COG0788         153 EAEARLLELLEEYGADLVVLARYMQ------------------------------ILSPDFVERFPGKIINIHHSFLPAF  202 (287)
T ss_pred             HHHHHHHHHHHHhCCCEEeehhhHh------------------------------hCCHHHHHhccCcEEEecccccccC
Confidence            34567888887  799999999999                              9999999999999999999999999


Q ss_pred             CCChHHHHHHHhCCCeeEEEEEEecCCCCCCCeEEEEEEecCCCCChhhh
Q 020794          271 KGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELM  320 (321)
Q Consensus       271 rG~~pi~~Ai~~G~~~~G~TvH~v~~~~D~G~Ii~Q~~~~I~~~~t~~~L  320 (321)
                      +|++||+||.++|+|.+|+|.|||++++|+||||.|..++++|.+|+++|
T Consensus       203 ~GA~PY~QA~eRGVKlIGATAHYVT~dLDeGPIIeQdv~rV~H~~s~ed~  252 (287)
T COG0788         203 IGANPYHQAYERGVKLIGATAHYVTADLDEGPIIEQDVIRVDHAYSVEDL  252 (287)
T ss_pred             CCCChHHHHHhcCCeEeeeeeeeccCCCCCCCceeeeeeecCccCCHHHH
Confidence            99999999999999999999999999999999999999999999999997

>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PLN02828 formyltetrahydrofolate deformylase Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>PLN02331 phosphoribosylglycinamide formyltransferase Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>KOG3076 consensus 5'-phosphoribosylglycinamide formyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02285 methionyl-tRNA formyltransferase Back     alignment and domain information
>PF00551 Formyl_trans_N: Formyl transferase; InterPro: IPR002376 A number of formyl transferases belong to this group Back     alignment and domain information
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>TIGR00460 fmt methionyl-tRNA formyltransferase Back     alignment and domain information
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK07579 hypothetical protein; Provisional Back     alignment and domain information
>KOG3082 consensus Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 Back     alignment and domain information
>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>cd04915 ACT_AK-Ectoine_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway Back     alignment and domain information
>cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>TIGR00289 conserved hypothetical protein TIGR00289 Back     alignment and domain information
>cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein Back     alignment and domain information
>PF01902 ATP_bind_4: ATP-binding region; InterPro: IPR002761 This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N-terminal Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
3o1l_A302 Crystal Structure Of A Formyltetrahydrofolate Defor 8e-35
3obi_A288 Crystal Structure Of A Formyltetrahydrofolate Defor 1e-28
3nrb_A287 Crystal Structure Of A Formyltetrahydrofolate Defor 3e-26
3lou_A292 Crystal Structure Of Formyltetrahydrofolate Deformy 4e-25
3n0v_A286 Crystal Structure Of A Formyltetrahydrofolate Defor 1e-22
3kcq_A215 Crystal Structure Of Phosphoribosylglycinamide Form 2e-12
1zly_A203 The Structure Of Human Glycinamide Ribonucleotide T 1e-11
1meo_A209 Human Glycinamide Ribonucleotide Transformylase At 1e-11
1zlx_A203 The Apo Structure Of Human Glycinamide Ribonucleoti 1e-11
1mej_B223 Human Glycinamide Ribonucleotide Transformylase Dom 1e-11
3p9x_A211 Crystal Structure Of Phosphoribosylglycinamide Form 8e-11
2ywr_A216 Crystal Structure Of Gar Transformylase From Aquife 1e-10
3auf_A229 Crystal Structure Of Glycinamide Ribonucleotide Tra 2e-10
4ds3_A209 Crystal Structure Of Phosphoribosylglycinamide Form 3e-10
1cdd_A212 Structures Of Apo And Complexed Escherichia Coli Gl 5e-08
1grc_A212 Crystal Structure Of Glycinamide Ribonucleotide Tra 5e-08
2gar_A212 A Ph-dependent Stablization Of An Active Site Loop 5e-08
1c3e_A209 New Insights Into Inhibitor Design From The Crystal 5e-08
3av3_A212 Crystal Structure Of Glycinamide Ribonucleotide Tra 7e-08
3tqr_A215 Structure Of The Phosphoribosylglycinamide Formyltr 1e-06
3da8_A215 Crystal Structure Of Purn From Mycobacterium Tuberc 2e-06
4iqf_A 317 Crystal Structure Of Methyionyl-trna Formyltransfer 4e-05
>pdb|3O1L|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Pspto_4314) From Pseudomonas Syringae Pv. Tomato Str. Dc3000 At 2.20 A Resolution Length = 302 Back     alignment and structure 
Iteration: 1

 Score =  144 bits (362), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 123/266 (46%), Gaps = 43/266 (16%)
Query: 46  VFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFDPIKWPREQMDED 105
           V  CPD VGIVAK+S  +AS  G I  A          F+ R E   D + +  +   E 
Sbjct: 26  VIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFXRHEIRADTLPFDLDGFREA 85
Query: 106 FFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNH 165
           F  +++ F+      R+ D   K +V + AS++ HCL D L+ W   +L  +I CVISNH
Sbjct: 86  FTPIAEEFSXD---WRITDSAQKKRVVLXASRESHCLADLLHRWHSDELDCDIACVISNH 142
Query: 166 DRGPNSHVIRFLERHGIPYHYLCAKXXXXXXXXXXXVQ-----NTDFLVLARYMQPVPLQ 220
                  +   +E H IPY+++               +       D +VLARY Q +P Q
Sbjct: 143 -----QDLRSXVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYXQILPPQ 197
Query: 221 KEAXXXXXXXXXXXXXXXXXXXFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAF 280
                                           R Y   VINIHH  LPSF G KP  QA 
Sbjct: 198 ------------------------------LCREYAHQVINIHHSFLPSFVGAKPYHQAS 227
Query: 281 DAGVKLIGATSHFVTEELDAGPIIEQ 306
             GVKLIGAT H+VTEELDAGPIIEQ
Sbjct: 228 LRGVKLIGATCHYVTEELDAGPIIEQ 253
>pdb|3OBI|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Np_949368) From Rhodopseudomonas Palustris Cga009 At 1.95 A Resolution Length = 288 Back     alignment and structure
>pdb|3NRB|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A Resolution Length = 287 Back     alignment and structure
>pdb|3LOU|A Chain A, Crystal Structure Of Formyltetrahydrofolate Deformylase (yp_105254.1) From Burkholderia Mallei Atcc 23344 At 1.90 A Resolution Length = 292 Back     alignment and structure
>pdb|3N0V|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase (Pp_0327) From Pseudomonas Putida Kt2440 At 2.25 A Resolution Length = 286 Back     alignment and structure
>pdb|3KCQ|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Anaplasma Phagocytophilum Length = 215 Back     alignment and structure
>pdb|1ZLY|A Chain A, The Structure Of Human Glycinamide Ribonucleotide Transformylase In Complex With Alpha,beta-n- (hydroxyacetyl)-d-ribofuranosylamine And 10-formyl-5,8, Dideazafolate Length = 203 Back     alignment and structure
>pdb|1MEO|A Chain A, Human Glycinamide Ribonucleotide Transformylase At Ph 4.2 Length = 209 Back     alignment and structure
>pdb|1ZLX|A Chain A, The Apo Structure Of Human Glycinamide Ribonucleotide Transformylase Length = 203 Back     alignment and structure
>pdb|1MEJ|B Chain B, Human Glycinamide Ribonucleotide Transformylase Domain At Ph 8.5 Length = 223 Back     alignment and structure
>pdb|3P9X|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Bacillus Halodurans Length = 211 Back     alignment and structure
>pdb|2YWR|A Chain A, Crystal Structure Of Gar Transformylase From Aquifex Aeolicus Length = 216 Back     alignment and structure
>pdb|3AUF|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase 1 From Symbiobacterium Toebii Length = 229 Back     alignment and structure
>pdb|4DS3|A Chain A, Crystal Structure Of Phosphoribosylglycinamide Formyltransferase From Brucella Melitensis Length = 209 Back     alignment and structure
>pdb|1CDD|A Chain A, Structures Of Apo And Complexed Escherichia Coli Glycinamide Ribonucleotide Transformylase Length = 212 Back     alignment and structure
>pdb|1GRC|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase From Escherichia Coli At 3.0 Angstroms Resolution: A Target Enzyme For Chemotherapy Length = 212 Back     alignment and structure
>pdb|2GAR|A Chain A, A Ph-dependent Stablization Of An Active Site Loop Observed From Low And High Ph Crystal Structures Of Mutant Monomeric Glycinamide Ribonucleotide Transformylase Length = 212 Back     alignment and structure
>pdb|1C3E|A Chain A, New Insights Into Inhibitor Design From The Crystal Structure And Nmr Studies Of E. Coli Gar Transformylate In Complex With Beta-Gar And 10-Formyl-5,8,10-Trideazafolic Acid. Length = 209 Back     alignment and structure
>pdb|3AV3|A Chain A, Crystal Structure Of Glycinamide Ribonucleotide Transformylase 1 From Geobacillus Kaustophilus Length = 212 Back     alignment and structure
>pdb|3TQR|A Chain A, Structure Of The Phosphoribosylglycinamide Formyltransferase (Purn) In Complex With Ches From Coxiella Burnetii Length = 215 Back     alignment and structure
>pdb|3DA8|A Chain A, Crystal Structure Of Purn From Mycobacterium Tuberculosis Length = 215 Back     alignment and structure
>pdb|4IQF|A Chain A, Crystal Structure Of Methyionyl-trna Formyltransferase From Bacillus Anthracis Length = 317 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 1e-103
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 1e-102
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 1e-102
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 1e-101
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT 1e-97
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 6e-34
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 2e-33
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 2e-33
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 4e-33
3av3_A212 Phosphoribosylglycinamide formyltransferase; struc 4e-33
1meo_A209 Phosophoribosylglycinamide formyltransferase; puri 5e-33
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase 6e-33
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 8e-33
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 1e-32
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 1e-32
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collab 3e-08
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 9e-05
2bln_A 305 Protein YFBG; transferase, formyltransferase, L-AR 2e-04
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Length = 302 Back     alignment and structure
 Score =  304 bits (780), Expect = e-103
 Identities = 101/285 (35%), Positives = 134/285 (47%), Gaps = 43/285 (15%)

Query: 30  EPIESSVSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSE 89
              E+     +     V  CPD VGIVAK+S  +AS  G I  A          F+ R E
Sbjct: 10  HHHENLYFQGMRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHE 69

Query: 90  FIFDPIKWPREQMDEDFFKLSKMFNAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGW 149
              D + +  +   E F  +++ F+      R+ D   K +V ++AS++ HCL D L+ W
Sbjct: 70  IRADTLPFDLDGFREAFTPIAEEFSM---DWRITDSAQKKRVVLMASRESHCLADLLHRW 126

Query: 150 QEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYL-CAKEN--EREEELLELVQ--N 204
              +L  +I CVISNH       +   +E H IPY+++    ++      E+  LV    
Sbjct: 127 HSDELDCDIACVISNHQ-----DLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQ 181

Query: 205 TDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHH 264
            D +VLARYMQ                              IL  +  R Y   VINIHH
Sbjct: 182 ADVVVLARYMQ------------------------------ILPPQLCREYAHQVINIHH 211

Query: 265 GLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLE 309
             LPSF G KP  QA   GVKLIGAT H+VTEELDAGPIIEQ + 
Sbjct: 212 SFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVV 256
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Length = 288 Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Length = 292 Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Length = 286 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Length = 287 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} Length = 215 Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Length = 211 Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Length = 229 Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Length = 209 Back     alignment and structure
>3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Length = 212 Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Length = 209 Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Length = 212 Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Length = 216 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Length = 215 Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} Length = 215 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory FO structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum} SCOP: b.46.1.1 c.65.1.1 Length = 260 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Length = 305 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 100.0
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 100.0
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 100.0
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 100.0
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT 100.0
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 100.0
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 100.0
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 100.0
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 100.0
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 100.0
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase 100.0
1meo_A209 Phosophoribosylglycinamide formyltransferase; puri 100.0
3av3_A212 Phosphoribosylglycinamide formyltransferase; struc 100.0
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 100.0
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 100.0
1fmt_A 314 Methionyl-tRNA FMet formyltransferase; initiator t 100.0
2bln_A 305 Protein YFBG; transferase, formyltransferase, L-AR 100.0
3q0i_A 318 Methionyl-tRNA formyltransferase; structural genom 100.0
3tqq_A 314 Methionyl-tRNA formyltransferase; protein synthesi 100.0
3rfo_A 317 Methionyl-tRNA formyltransferase; structural genom 100.0
2bw0_A 329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase 100.0
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 100.0
1zgh_A260 Methionyl-tRNA formyltransferase; southeast collab 99.93
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 99.73
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 99.51
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.51
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.5
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.48
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.4
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 98.26
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 97.51
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 97.24
1y7p_A223 Hypothetical protein AF1403; structural genomics, 97.01
2re1_A167 Aspartokinase, alpha and beta subunits; structural 97.0
2pc6_A165 Probable acetolactate synthase isozyme III (small; 96.97
2f06_A144 Conserved hypothetical protein; structural genomic 96.93
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 96.8
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 96.77
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 95.87
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 95.79
2f06_A144 Conserved hypothetical protein; structural genomic 95.74
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 95.45
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 95.06
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 94.8
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 94.58
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 94.43
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 93.9
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 93.32
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 92.71
2re1_A167 Aspartokinase, alpha and beta subunits; structural 92.2
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 92.02
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 91.87
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 91.82
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 91.43
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 90.93
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 90.67
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 88.31
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 87.62
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 87.34
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 87.05
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 86.52
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 85.9
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 85.47
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 85.45
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 85.39
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 84.96
3rjz_A237 N-type ATP pyrophosphatase superfamily; structural 84.42
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 83.46
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 82.97
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 82.94
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 82.91
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
Probab=100.00  E-value=2.6e-66  Score=492.44  Aligned_cols=247  Identities=33%  Similarity=0.584  Sum_probs=222.7

Q ss_pred             CCCCcccEEEEEEcCCccchHHHHHHHHHhcCCeEeEeeeeccCCCCeEEEEEEEEeC--CCCCChHHHHHHHHHHHHHh
Q 020794           36 VSPTLTHGIHVFHCPDEVGIVAKLSECIASRGGNILAADVFVPEKKNVFYSRSEFIFD--PIKWPREQMDEDFFKLSKMF  113 (321)
Q Consensus        36 ~~~~~~~~Iltv~G~Dr~GIVA~VS~~La~~G~NI~d~~q~~~~l~g~F~Mr~~v~~~--~~~~~~~~L~~~L~~la~~l  113 (321)
                      |+...++++||++||||+||||+||++|+++||||+|++|+.+..+|.||||++++.+  +...+.++|+++|+++++++
T Consensus         4 ~~~~~~~~vLtv~c~Dr~GIVa~Vs~~La~~g~NI~d~~q~~d~~~g~Ffmr~~~~~~~~~~~~~~~~L~~~f~~la~~~   83 (292)
T 3lou_A            4 VPQRPHQFVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVDALRREFEPIAERF   83 (292)
T ss_dssp             ----CCEEEEEEEEESCSCHHHHHHHHHHHTTEEEEEEEEEEETTTTEEEEEEEEEECC----CCHHHHHHHHHHHHHHH
T ss_pred             CcCCCCcEEEEEEcCCCCCHHHHHHHHHHHCCCCEEeeEEEecCCCCceEEEEEEEccCcccCCCHHHHHHHHHHHHHhc
Confidence            5556678999999999999999999999999999999999988889999999999987  43468999999999999999


Q ss_pred             hhccceeeeCCCCCCeeEEEEEeCCchhHHHHHHhhhcCCcCeeEEEEEeCCCCCCCchHHHHHHHcCCCEEEEcCCcch
Q 020794          114 NAMRSVVRVPDIDPKYKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKENE  193 (321)
Q Consensus       114 g~~~~~~r~~~~~~~~rIavl~S~~g~~l~~lL~~~~~~~l~~~i~~Vis~~~~~~~~~v~~~a~~~gIP~~~~~~~~~~  193 (321)
                      +|   .|++.+.++++||+||+||+||||++||++++.|+++++|++|+||+++     +..+|+++|||+++++.+...
T Consensus        84 ~m---~~~l~~~~~~~ri~vl~Sg~g~~l~~ll~~~~~g~l~~~i~~Visn~~~-----~~~~A~~~gIp~~~~~~~~~~  155 (292)
T 3lou_A           84 RM---QWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVSNHPD-----FAPLAAQHGLPFRHFPITADT  155 (292)
T ss_dssp             TC---EEEEEETTSCCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSST-----THHHHHHTTCCEEECCCCSSC
T ss_pred             Cc---EEEeeccCCCCEEEEEEcCCCcCHHHHHHHHHcCCCCcEEEEEEeCcHH-----HHHHHHHcCCCEEEeCCCcCC
Confidence            86   3667777889999999999999999999999999999999999999953     356799999999988743222


Q ss_pred             ---hHHHHHHHhc--CCCEEEEEeeccccchhhHhhhhhhhhhhhcccCcccccccccCChhHHhhcCCCeEEecCCCCC
Q 020794          194 ---REEELLELVQ--NTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLP  268 (321)
Q Consensus       194 ---~~~~~~~~l~--~~Dlivlag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~~~~l~~~~~~~INiHpslLP  268 (321)
                         .++++++.++  ++|++|+|||||                              |||+++++.|++++||+||||||
T Consensus       156 r~~~~~~~~~~l~~~~~Dlivla~y~~------------------------------il~~~~l~~~~~~~iNiHpSlLP  205 (292)
T 3lou_A          156 KAQQEAQWLDVFETSGAELVILARYMQ------------------------------VLSPEASARLANRAINIHHSFLP  205 (292)
T ss_dssp             HHHHHHHHHHHHHHHTCSEEEESSCCS------------------------------CCCHHHHHHTTTSEEEEEEECSS
T ss_pred             HHHHHHHHHHHHHHhCCCEEEecCchh------------------------------hCCHHHHhhhcCCeEEeCCCcCc
Confidence               2457888886  899999999999                              99999999999999999999999


Q ss_pred             CCCCChHHHHHHHhCCCeeEEEEEEecCCCCCCCeEEEEEEecCCCCChhhh
Q 020794          269 SFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELM  320 (321)
Q Consensus       269 ~yrG~~pi~~Ai~~G~~~~G~TvH~v~~~~D~G~Ii~Q~~~~I~~~~t~~~L  320 (321)
                      +|||++|++||+++|++.+|+|+|+|++++|+||||.|+.++|.++||+++|
T Consensus       206 ~~rG~~p~~~Ai~~G~~~~G~Tvh~v~~~lD~G~Ii~Q~~v~i~~~dt~~~L  257 (292)
T 3lou_A          206 GFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHSYRPEQL  257 (292)
T ss_dssp             CCCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECCTTCCHHHH
T ss_pred             CCCCccHHHHHHHcCCCeEEEEEEEEcCCCcCCCEEEEEEEEcCCCCCHHHH
Confidence            9999999999999999999999999999999999999999999999999987
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* 3r8x_A Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Back     alignment and structure
>3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} Back     alignment and structure
>3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory FO structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum} SCOP: b.46.1.1 c.65.1.1 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 321
d1meoa_205 c.65.1.1 (A:) Glycinamide ribonucleotide transform 5e-13
d1jkxa_209 c.65.1.1 (A:) Glycinamide ribonucleotide transform 1e-10
d1u8sa293 d.58.18.5 (A:88-180) putative transcriptional repr 4e-06
d1u8sa186 d.58.18.5 (A:2-87) putative transcriptional repres 1e-05
d1zpva183 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Strepto 7e-05
d1zgha2164 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransf 2e-04
>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Formyltransferase
superfamily: Formyltransferase
family: Formyltransferase
domain: Glycinamide ribonucleotide transformylase, GART
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.9 bits (157), Expect = 5e-13
 Identities = 48/177 (27%), Positives = 68/177 (38%), Gaps = 27/177 (15%)

Query: 130 KVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCA 189
           +VAVL S     L   +   +E     +I  VISN                    ++   
Sbjct: 2   RVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLY 61

Query: 190 KENEREEELLELVQNTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSG 249
           K     +  +                             +LE  S      + F  ILSG
Sbjct: 62  KNRVEFDSAI---------------------------DLVLEEFSIDIVCLAGFMRILSG 94

Query: 250 KFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDAGVKLIGATSHFVTEELDAGPIIEQ 306
            F++ +   ++NIH  LLPSFKG    +QA + GV + G T HFV E++DAG II Q
Sbjct: 95  PFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQ 151
>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 93 Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86 Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Length = 83 Back     information, alignment and structure
>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
d1jkxa_209 Glycinamide ribonucleotide transformylase, GART {E 100.0
d1meoa_205 Glycinamide ribonucleotide transformylase, GART {H 100.0
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 100.0
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 100.0
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 100.0
d1zgha2164 Methionyl-tRNAfmet formyltransferase {Clostridium 99.89
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 99.78
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 99.66
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 99.63
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.98
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 97.82
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 97.58
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 97.35
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 97.19
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 96.57
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 96.43
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 96.39
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 21 95.2
d2hmfa3100 Aspartokinase {Methanococcus jannaschii [TaxId: 21 94.44
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 93.42
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 93.09
d2cdqa375 Aspartokinase {Thale cress (Arabidopsis thaliana) 93.02
d2cdqa291 Aspartokinase {Thale cress (Arabidopsis thaliana) 92.24
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 91.92
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 88.87
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 86.79
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus h 85.68
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 84.75
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 84.7
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 84.34
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 83.83
d1zhva266 Hypothetical protein Atu0741 {Agrobacterium tumefa 82.79
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 82.1
>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Formyltransferase
superfamily: Formyltransferase
family: Formyltransferase
domain: Glycinamide ribonucleotide transformylase, GART
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.2e-39  Score=291.06  Aligned_cols=159  Identities=30%  Similarity=0.457  Sum_probs=146.1

Q ss_pred             eeEEEEEeCCchhHHHHHHhhhcCCcCeeEEEEEeCCCCCCCchHHHHHHHcCCCEEEEcCCc----chhHHHHHHHhc-
Q 020794          129 YKVAVLASKQEHCLVDFLYGWQEGKLPVEITCVISNHDRGPNSHVIRFLERHGIPYHYLCAKE----NEREEELLELVQ-  203 (321)
Q Consensus       129 ~rIavl~S~~g~~l~~lL~~~~~~~l~~~i~~Vis~~~~~~~~~v~~~a~~~gIP~~~~~~~~----~~~~~~~~~~l~-  203 (321)
                      ||||||+||+|++|++|+++++.+.++++|++|+||++   ++...++|++.++|......+.    ...+.++.+.++ 
T Consensus         1 MkIaVl~SG~GSnL~aLl~a~~~~~l~~~I~~Visn~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~   77 (209)
T d1jkxa_           1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKA---DAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDM   77 (209)
T ss_dssp             CEEEEEESSCCHHHHHHHHHHHTTSSSSEEEEEEESCT---TCHHHHHHHHTTCEEEECCGGGCSSHHHHHHHHHHHHGG
T ss_pred             CEEEEEEecCcHHHHHHHHHHHcCCCCCEEEEEEeCCC---CcccchhhhccccceeeeeccccccccchHHHHHHHHHh
Confidence            79999999999999999999999999999999999874   5678999999999998765321    123456777776 


Q ss_pred             -CCCEEEEEeeccccchhhHhhhhhhhhhhhcccCcccccccccCChhHHhhcCCCeEEecCCCCCCCCCChHHHHHHHh
Q 020794          204 -NTDFLVLARYMQPVPLQKEAYLGYKLLESLSSKGSLTSYFNMILSGKFLRSYGKDVINIHHGLLPSFKGGKPAKQAFDA  282 (321)
Q Consensus       204 -~~Dlivlag~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~~~~l~~~~~~~INiHpslLP~yrG~~pi~~Ai~~  282 (321)
                       ++|++|++|||+                              |+|+++++.++.++||+|||+||+|||++|++||+.+
T Consensus        78 ~~~Dliv~~g~~~------------------------------il~~~~l~~~~~~~iN~HpslLP~~rG~~p~~~~i~~  127 (209)
T d1jkxa_          78 YAPDVVVLAGFMR------------------------------ILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALEN  127 (209)
T ss_dssp             GCCSEEEESSCCS------------------------------CCCHHHHHHTTTSEEEEESSCTTSCCSSCHHHHHHHT
T ss_pred             cCCCEEEEeeeeE------------------------------ecChhhhcccccCEEEeCCchhcccCCcCchhHHHHC
Confidence             899999999999                              9999999999999999999999999999999999999


Q ss_pred             CCCeeEEEEEEecCCCCCCCeEEEEEEecCCCCChhhh
Q 020794          283 GVKLIGATSHFVTEELDAGPIIEQMLELLAISFATELM  320 (321)
Q Consensus       283 G~~~~G~TvH~v~~~~D~G~Ii~Q~~~~I~~~~t~~~L  320 (321)
                      |++.+|+|+|+|++++|+||||.|+.++|.++||+++|
T Consensus       128 g~~~~G~t~h~~~~~~D~G~Ii~q~~~~i~~~d~~~~l  165 (209)
T d1jkxa_         128 GDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDI  165 (209)
T ss_dssp             TCSEEEEEEEECCSSTTCSCEEEEEEEECCTTCCHHHH
T ss_pred             CCeeecceEEEecCCCCcccEeeEEEEcCCCCCCHHHH
Confidence            99999999999999999999999999999999999987
>d1meoa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zgha2 c.65.1.1 (A:1-164) Methionyl-tRNAfmet formyltransferase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure