Citrus Sinensis ID: 020934


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MQSASVSAALPSSSCHYCYPVPNRFLHFRNLHLKKNLNSLSLSRNQIHAKNFCSLTLPTANSFSKEQEENLRKDNKLHPDQNHTFLDQFYSSADTNKLGNQDPESQNQEQDEEPRYNKDKYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCVKDPPSLESNFIACNRS
cccccccccccccccccccccccccccccHHHccccccEEEEccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEccEEEEEcccccccccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHccccccEEEEccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc
ccccEEEcccccccccEEEEccccccccccHHccccccEEEcccccccccccccccccccccccccccccccccccccHcHcccHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccHHHccHHHHHHcccEEEEEccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHccccccEEEEccccHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccccccccccEEEEccc
mqsasvsaalpssschycypvpnrflhFRNLHLKKnlnslslsrnqihaknfcsltlptansfsKEQEENlrkdnklhpdqnhtfldqfyssadtnklgnqdpesqnqeqdeeprynkdkyWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKdrhlalphvtvpdiryiDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHrvkkpagtaeEIEKhfgcqssqlimvgdrpftdivygnrngfltilteplslaeepfIVRQVRKLEVTIVNRWFrrglkpishnllpdamqcvkdppslesnfiacnrs
mqsasvsaalpssschYCYPVPNRFLHFRNLHLKKNLNSLSLSRNQIHAKNFCSLTLPTANSFSKEQEENLRKDNKLHPDQNHTFLDQFYSSADTNKLgnqdpesqnqeqdeeprynKDKYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKdrhlalphvtvpdiryidWAELQRRGFKGLyeydndaskarklegkigikvirhrvkkpagtaeeiekhfgcqssqlimVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQcvkdppslesnfiacnrs
MQsasvsaalpsssCHYCYPVPNRFLHFrnlhlkknlnslslsrnQIHAKNFCSLTLPTANSFSKEQEENLRKDNKLHPDQNHTFLDQFYSSADTNKLGNQDPESQNQEQDEEPRYNKDKYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCVKDPPSLESNFIACNRS
*************SCHYCYPVPNRFLHFRNLHLKKNLNSLSLSRNQIHAKNFCSLTL*************************************************************DKYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCV****************
*********LPSSSCHYCYPVPNRFLHFR**********L******IHA**FC**************************DQNHTFLDQFY***********************PRYNKDKYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQC***PPSLESNFIACN**
***********SSSCHYCYPVPNRFLHFRNLHLKKNLNSLSLSRNQIHAKNFCSLTLPTAN***********KDNKLHPDQNHTFLDQFYSSADTNK*****************RYNKDKYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCVKDPPSLESNFIACNRS
****SVSAALPSSSCHYCYPVPNRFLHFRNLHLKKNLNSLSLSRNQIHAKNFCSLTLPTANSFSKEQEENLRKDNKLHPDQNHTFLDQFYSSADT***************************TVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCVKDPPSLESNFIACNR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSASVSAALPSSSCHYCYPVPNRFLHFRNLHLKKNLNSLSLSRNQIHAKNFCSLTLPTANSFSKEQEENLRKDNKLHPDQNHTFLDQFYSSADTNKLGNQDPESQNQEQDEEPRYNKDKYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCVKDPPSLESNFIACNRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query319 2.2.26 [Sep-21-2011]
P54452172 Uncharacterized protein Y yes no 0.426 0.790 0.288 2e-07
P38812185 Phosphatidylglycerophosph yes no 0.304 0.524 0.367 3e-05
>sp|P54452|YQEG_BACSU Uncharacterized protein YqeG OS=Bacillus subtilis (strain 168) GN=yqeG PE=4 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 77/149 (51%), Gaps = 13/149 (8%)

Query: 143 NVEGIVSS--TVVFAKDRHLALPHVTVPDIRYIDW-AELQRRGFKGLYEYDNDASKARKL 199
           NV+GI++     +   DR  A P       R I+W  E++  G K     +N+  + +  
Sbjct: 27  NVKGIITDLDNTLVEWDRPNATP-------RLIEWFEEMKEHGIKVTIVSNNNERRVKLF 79

Query: 200 EGKIGIKVIRHRVKKPAGTA-EEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTILTE 258
              +GI  I ++ +KP G A     ++   +    +++GD+  TD++ GNRNG+ TIL  
Sbjct: 80  SEPLGIPFI-YKARKPMGKAFNRAVRNMELKKEDCVVIGDQLLTDVLGGNRNGYHTILVV 138

Query: 259 PLSLAEEPFIVRQVRKLEVTIVNRWFRRG 287
           P++ + + FI R  R++E  I++   R+G
Sbjct: 139 PVA-SSDGFITRFNRQVERRILSALKRKG 166





Bacillus subtilis (strain 168) (taxid: 224308)
>sp|P38812|GEP4_YEAST Phosphatidylglycerophosphatase GEP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEP4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
225446869344 PREDICTED: uncharacterized protein LOC10 0.909 0.843 0.536 3e-90
357443913352 hypothetical protein MTR_1g100570 [Medic 0.937 0.849 0.505 2e-87
356508442355 PREDICTED: uncharacterized protein LOC10 0.946 0.850 0.501 4e-87
396582339354 haloacid dehalogenase superfamily protei 0.943 0.850 0.492 9e-86
449444759348 PREDICTED: uncharacterized protein LOC10 0.915 0.839 0.492 2e-83
224062762225 predicted protein [Populus trichocarpa] 0.561 0.795 0.681 1e-81
255558724355 catalytic, putative [Ricinus communis] g 0.815 0.732 0.541 1e-81
224085296225 predicted protein [Populus trichocarpa] 0.567 0.804 0.644 4e-78
296086317225 unnamed protein product [Vitis vinifera] 0.567 0.804 0.657 9e-78
297820718338 haloacid dehalogenase superfamily protei 0.912 0.860 0.485 5e-75
>gi|225446869|ref|XP_002283859.1| PREDICTED: uncharacterized protein LOC100252338 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  337 bits (865), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 190/354 (53%), Positives = 222/354 (62%), Gaps = 64/354 (18%)

Query: 10  LPSSSC---HYC-YPVPNRFLHFRNLHLK---KNLNSLSLSRNQIHAKNFCSLTLPTANS 62
           + S SC   H C +P+PN+F + R L  +   +NL S    ++Q H    C+LTL   NS
Sbjct: 1   MQSCSCAPWHICKFPIPNQFHNHRYLCPRLYHRNLPSWP-CKHQTHLTKICALTLHPTNS 59

Query: 63  FSKEQEENLRKDNKL---HPDQNHTFLDQFYSSADTNKLGNQDPESQNQEQDEEPRYNKD 119
             KEQE    K N      P Q + FL + YSS +         +S+  +  EE + N  
Sbjct: 60  CRKEQEIKRNKSNSQPSHTPSQTNIFLHELYSSTENFN------QSKTTQDPEERKINSS 113

Query: 120 KYWTVLCTNMWWSQLKAALGQRINVEGIVSSTVVFAKDRHLALPHVTVPDIRYIDWAELQ 179
           +   V+ TNMWW+ LKAALGQR N EGI+ S VV AKDRHLALPHV VPDIRYIDWAEL 
Sbjct: 114 R---VIFTNMWWADLKAALGQRFNFEGIICSAVVLAKDRHLALPHVAVPDIRYIDWAELH 170

Query: 180 RRGFKG--------------------------------------------LYEYDNDASK 195
           RRGFKG                                            LYEYD D SK
Sbjct: 171 RRGFKGVVFDKDNTLTKPYSLTLWEPIGSSLQQCKSVFGHDIGVFSNSAGLYEYDPDGSK 230

Query: 196 ARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTI 255
           AR LEG IGI+VIRHRVKKPAGTAEEIEKHFGC SS LIMVGDRPFTDIV+GNRNGFLTI
Sbjct: 231 ARVLEGAIGIEVIRHRVKKPAGTAEEIEKHFGCASSLLIMVGDRPFTDIVFGNRNGFLTI 290

Query: 256 LTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCVKDPPSL 309
           LTEPLSLAEEPF+V+QVRKLE  +VNR ++RGLKP +H+LLPDA +CVK+PP L
Sbjct: 291 LTEPLSLAEEPFLVKQVRKLEAFVVNRCYKRGLKPTNHSLLPDAQECVKNPPPL 344




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357443913|ref|XP_003592234.1| hypothetical protein MTR_1g100570 [Medicago truncatula] gi|357462099|ref|XP_003601331.1| hypothetical protein MTR_3g079530 [Medicago truncatula] gi|355481282|gb|AES62485.1| hypothetical protein MTR_1g100570 [Medicago truncatula] gi|355490379|gb|AES71582.1| hypothetical protein MTR_3g079530 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356508442|ref|XP_003522966.1| PREDICTED: uncharacterized protein LOC100820364 [Glycine max] Back     alignment and taxonomy information
>gi|396582339|gb|AFN88203.1| haloacid dehalogenase superfamily protein [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|449444759|ref|XP_004140141.1| PREDICTED: uncharacterized protein LOC101213822 [Cucumis sativus] gi|449515655|ref|XP_004164864.1| PREDICTED: uncharacterized protein LOC101230953 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224062762|ref|XP_002300885.1| predicted protein [Populus trichocarpa] gi|222842611|gb|EEE80158.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558724|ref|XP_002520386.1| catalytic, putative [Ricinus communis] gi|223540433|gb|EEF42002.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224085296|ref|XP_002307540.1| predicted protein [Populus trichocarpa] gi|222856989|gb|EEE94536.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296086317|emb|CBI31758.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297820718|ref|XP_002878242.1| haloacid dehalogenase superfamily protein [Arabidopsis lyrata subsp. lyrata] gi|297324080|gb|EFH54501.1| haloacid dehalogenase superfamily protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
TAIR|locus:2099104343 AT3G58830 "AT3G58830" [Arabido 0.391 0.364 0.736 1.8e-74
TIGR_CMR|BA_4563170 BA_4563 "hydrolase, HAD subfam 0.379 0.711 0.257 9e-06
TIGR_CMR|CHY_0622182 CHY_0622 "hydrolase, HAD subfa 0.369 0.648 0.279 3.6e-05
SGD|S000001142185 GEP4 "Mitochondrial phosphatid 0.304 0.524 0.367 4e-05
TAIR|locus:2099104 AT3G58830 "AT3G58830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 496 (179.7 bits), Expect = 1.8e-74, Sum P(2) = 1.8e-74
 Identities = 92/125 (73%), Positives = 108/125 (86%)

Query:   185 GLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDI 244
             GL EYD+D SKA+ LE +IGI+V+RHRVKKPAGTAEE+EKHFGC SS+LIMVGDRPFTDI
Sbjct:   219 GLTEYDHDDSKAKALEAEIGIRVLRHRVKKPAGTAEEVEKHFGCTSSELIMVGDRPFTDI 278

Query:   245 VYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISHNLLPDAMQCVK 304
             VYGNRNGFLT+LTEPLS AEEPFIVRQVR+LE+ ++ RW R+GLKP+ H+L+ D  Q VK
Sbjct:   279 VYGNRNGFLTVLTEPLSRAEEPFIVRQVRRLELALLKRWLRKGLKPVDHSLVSDITQFVK 338

Query:   305 DPPSL 309
              P  L
Sbjct:   339 VPSDL 343


GO:0003824 "catalytic activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
TIGR_CMR|BA_4563 BA_4563 "hydrolase, HAD subfamily IIIA" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0622 CHY_0622 "hydrolase, HAD subfamily IIIA" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
SGD|S000001142 GEP4 "Mitochondrial phosphatidylglycerophosphatase (PGP phosphatase)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018919001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (344 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
TIGR01668170 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfam 3e-41
pfam09419166 pfam09419, PGP_phosphatase, Mitochondrial PGP phos 9e-26
TIGR01662132 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, 6e-15
COG2179175 COG2179, COG2179, Predicted hydrolase of the HAD s 1e-10
pfam1324274 pfam13242, Hydrolase_like, HAD-hyrolase-like 1e-05
COG0647269 COG0647, NagD, Predicted sugar phosphatases of the 7e-05
PLN02645311 PLN02645, PLN02645, phosphoglycolate phosphatase 9e-05
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 2e-04
TIGR01452279 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal pho 3e-04
>gnl|CDD|233519 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
 Score =  141 bits (356), Expect = 3e-41
 Identities = 48/168 (28%), Positives = 71/168 (42%), Gaps = 37/168 (22%)

Query: 162 LPHVTVPDIRYIDWAELQRRGFKGL---------YEYDNDAS------------------ 194
           LPH  V  +  +    L++ G KG+         Y   N+A                   
Sbjct: 4   LPHAIVKTLNDLTIDLLKKVGIKGVVLDKDNTLVYPDHNEAYPALRDWIEELKAAGRKLL 63

Query: 195 ---------KARKLEGKIGIKVIRHRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIV 245
                    +A+ +E  +GI V+ H VK P           G  S Q+ +VGDR FTD++
Sbjct: 64  IVSNNAGEQRAKAVEKALGIPVLPHAVKPPGCAFRRAHPEMGLTSEQVAVVGDRLFTDVM 123

Query: 246 YGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRRGLKPISH 293
            GNRNG  TIL EPL   ++ FI R  R++E T++ ++      P   
Sbjct: 124 GGNRNGSYTILVEPLVHPDQWFIKRIWRRVERTVL-KFLVSRGGPAPE 170


This family of hypothetical proteins is a member of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases. All characterized members of this subfamily (TIGR01662) and most characterized members of the HAD superfamily are phosphatases. HAD superfamily phosphatases contain active site residues in several conserved catalytic motifs, all of which are found conserved here. This family consists of sequences from fungi, plants, cyanobacteria, gram-positive bacteria and Deinococcus. There is presently no characterization of any sequence in this family. Length = 170

>gnl|CDD|220230 pfam09419, PGP_phosphatase, Mitochondrial PGP phosphatase Back     alignment and domain information
>gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>gnl|CDD|225090 COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like Back     alignment and domain information
>gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178251 PLN02645, PLN02645, phosphoglycolate phosphatase Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|233420 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 319
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.96
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 99.84
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 99.8
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.75
COG0647269 NagD Predicted sugar phosphatases of the HAD super 99.56
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.53
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.5
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.48
PRK10444248 UMP phosphatase; Provisional 99.43
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.42
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.41
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.41
PRK06769173 hypothetical protein; Validated 99.39
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.38
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.37
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.36
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.35
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.34
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.34
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.32
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.28
COG0546220 Gph Predicted phosphatases [General function predi 99.28
PRK11587218 putative phosphatase; Provisional 99.27
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.27
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.26
PRK09449224 dUMP phosphatase; Provisional 99.26
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 99.26
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.25
PLN02645311 phosphoglycolate phosphatase 99.25
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.24
PRK13226229 phosphoglycolate phosphatase; Provisional 99.24
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.24
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.24
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.23
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.22
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.22
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.21
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.21
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.21
PRK13288214 pyrophosphatase PpaX; Provisional 99.21
PRK14988224 GMP/IMP nucleotidase; Provisional 99.2
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.18
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.15
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.15
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.15
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.15
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 99.14
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.13
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.13
PLN02575381 haloacid dehalogenase-like hydrolase 99.12
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 99.1
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.08
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 99.07
COG0241181 HisB Histidinol phosphatase and related phosphatas 99.06
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.05
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.05
PLN02940 382 riboflavin kinase 99.03
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.02
PRK13223272 phosphoglycolate phosphatase; Provisional 99.02
PRK13222226 phosphoglycolate phosphatase; Provisional 99.01
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 99.0
PRK13225273 phosphoglycolate phosphatase; Provisional 99.0
PLN02811220 hydrolase 99.0
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 98.99
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 98.98
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.94
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 98.92
COG0637221 Predicted phosphatase/phosphohexomutase [General f 98.91
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 98.88
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 98.85
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 98.84
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.84
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 98.8
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.79
PHA02597197 30.2 hypothetical protein; Provisional 98.78
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 98.77
PHA02530300 pseT polynucleotide kinase; Provisional 98.77
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 98.72
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 98.57
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 98.49
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 98.48
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 98.48
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 98.45
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.44
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 98.4
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 98.4
PLN02954224 phosphoserine phosphatase 98.31
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 98.28
PRK11133322 serB phosphoserine phosphatase; Provisional 98.25
PRK13582205 thrH phosphoserine phosphatase; Provisional 98.14
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 97.97
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 97.97
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 97.97
PTZ00445219 p36-lilke protein; Provisional 97.89
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 97.88
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 97.79
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 97.63
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 97.53
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 97.53
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 97.5
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 97.49
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 97.48
PRK08238 479 hypothetical protein; Validated 97.44
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 97.33
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 97.2
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 97.17
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 97.1
PRK10671834 copA copper exporting ATPase; Provisional 97.07
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 96.52
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.5
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 96.5
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 96.31
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 95.94
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 95.81
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 95.72
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 95.71
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 95.63
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 95.42
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 95.19
PLN02645 311 phosphoglycolate phosphatase 95.16
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 94.8
PRK01158230 phosphoglycolate phosphatase; Provisional 94.77
COG4087152 Soluble P-type ATPase [General function prediction 94.13
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 94.02
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 93.92
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 93.64
COG4229229 Predicted enolase-phosphatase [Energy production a 93.5
COG5610 635 Predicted hydrolase (HAD superfamily) [General fun 93.2
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 93.17
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 92.96
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 92.64
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 92.23
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 92.03
PRK14010673 potassium-transporting ATPase subunit B; Provision 91.52
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 91.33
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 90.97
PRK01122679 potassium-transporting ATPase subunit B; Provision 90.47
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 90.43
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 90.09
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 89.74
PRK11590211 hypothetical protein; Provisional 89.19
TIGR01675229 plant-AP plant acid phosphatase. This model explic 88.03
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 87.56
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 87.46
COG4359220 Uncharacterized conserved protein [Function unknow 87.37
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 87.33
KOG1618389 consensus Predicted phosphatase [General function 87.29
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 87.27
PRK15122 903 magnesium-transporting ATPase; Provisional 87.08
KOG2469424 consensus IMP-GMP specific 5'-nucleotidase [Nucleo 84.28
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 84.25
PRK10976266 putative hydrolase; Provisional 83.78
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 83.66
TIGR01684301 viral_ppase viral phosphatase. These proteins also 83.55
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 83.54
PRK10513270 sugar phosphate phosphatase; Provisional 83.15
PHA03398303 viral phosphatase superfamily protein; Provisional 82.45
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 81.22
COG4996164 Predicted phosphatase [General function prediction 80.44
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
Probab=99.96  E-value=1.6e-28  Score=216.75  Aligned_cols=140  Identities=30%  Similarity=0.464  Sum_probs=124.5

Q ss_pred             eeeeeccCCcccCcccc-CCcchhhH-HHHHHcCCcEEEEecCCHHHHHHHHHHhCCcEEEccCCCChHH-HHHHHHHhC
Q 020934          151 TVVFAKDRHLALPHVTV-PDIRYIDW-AELQRRGFKGLYEYDNDASKARKLEGKIGIKVIRHRVKKPAGT-AEEIEKHFG  227 (319)
Q Consensus       151 a~vL~rd~~l~~P~~~v-~~i~~i~l-~~Lke~Gikl~I~SNn~~~~v~~l~~~lGI~~I~~~akKP~~~-f~~ALk~lg  227 (319)
                      ..+++.|++| .|+..- ....-++| ++++++|+++.|+|||...+++.+++.+|+++|+ .|+||.+. |.+|+++|+
T Consensus        30 gvi~DlDNTL-v~wd~~~~tpe~~~W~~e~k~~gi~v~vvSNn~e~RV~~~~~~l~v~fi~-~A~KP~~~~fr~Al~~m~  107 (175)
T COG2179          30 GVILDLDNTL-VPWDNPDATPELRAWLAELKEAGIKVVVVSNNKESRVARAAEKLGVPFIY-RAKKPFGRAFRRALKEMN  107 (175)
T ss_pred             EEEEeccCce-ecccCCCCCHHHHHHHHHHHhcCCEEEEEeCCCHHHHHhhhhhcCCceee-cccCccHHHHHHHHHHcC
Confidence            3556888887 666555 44545565 9999999999999999999999999999999985 79999996 999999999


Q ss_pred             CCCCceEEEcCCchhhHHhHHHcCCeEEEEccCcCCCchhHHHHHHHHHHHHHHHHHhc-CCCCCCC
Q 020934          228 CQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVRQVRKLEVTIVNRWFRR-GLKPISH  293 (319)
Q Consensus       228 v~p~e~vmVGDrl~TDIlgAn~aGm~TILV~Pi~~~~e~~~trl~R~lEr~il~~l~~k-g~~~~~~  293 (319)
                      ++++|++|||||++|||+|||++||.||+|.|+... ++|.|+++|++|+.+++++.++ |..-|++
T Consensus       108 l~~~~vvmVGDqL~TDVlggnr~G~~tIlV~Pl~~~-d~~~t~~nR~~Er~v~~~l~~k~g~i~~k~  173 (175)
T COG2179         108 LPPEEVVMVGDQLFTDVLGGNRAGMRTILVEPLVAP-DGWITKINRWRERRVLKKLGKKYGPIHWKE  173 (175)
T ss_pred             CChhHEEEEcchhhhhhhcccccCcEEEEEEEeccc-cchhhhhhHHHHHHHHHHHHHhcCCccccc
Confidence            999999999999999999999999999999999976 6799999999999999998886 8777664



>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>KOG1618 consensus Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>KOG2469 consensus IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 3e-08
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 3e-08
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 3e-08
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 4e-08
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 4e-08
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 4e-08
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 4e-08
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 1e-07
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 2e-07
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 7e-07
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 4e-06
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 2e-04
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 5e-04
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 Back     alignment and structure
 Score = 52.9 bits (128), Expect = 3e-08
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 214 KP-AGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTIL 256
           KP +   E+  +  G   S+ +MVGD   TDI+ G   G  T+L
Sbjct: 183 KPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLL 226


>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Length = 263 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Length = 352 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.47
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.46
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.43
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.37
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.36
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.35
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.32
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.32
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.3
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.3
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.29
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.29
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.27
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.26
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.26
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.24
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.24
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.23
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.23
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.22
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.22
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.21
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.21
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.2
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.2
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.2
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.2
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.19
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.19
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.19
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.19
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.19
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.19
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.18
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.18
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.17
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.17
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.17
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.17
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.17
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.16
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.16
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.16
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 99.15
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.15
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.13
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.13
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.12
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.12
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.11
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.11
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.1
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.1
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.1
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.09
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.08
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.06
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 99.06
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.06
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.06
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.05
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.05
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.05
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.04
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.04
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.03
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.03
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.03
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.03
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.02
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.01
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.0
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.0
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.0
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.99
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.99
1te2_A226 Putative phosphatase; structural genomics, phospha 98.98
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.97
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.97
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.96
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.94
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 98.94
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.9
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 98.89
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 98.88
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.87
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 98.87
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.86
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 98.86
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 98.85
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 98.82
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 98.82
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.81
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.8
2p11_A231 Hypothetical protein; putative haloacid dehalogena 98.76
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.75
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 98.74
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 98.72
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.72
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.72
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 98.69
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 98.68
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 98.67
3fvv_A232 Uncharacterized protein; unknown function, structu 98.61
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 98.58
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 98.56
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.44
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 98.32
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 97.5
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 98.18
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 98.15
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 97.88
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 97.78
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 97.76
1l6r_A227 Hypothetical protein TA0175; structural genomics, 97.67
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 97.53
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 97.43
4g63_A470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 97.41
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 97.4
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 97.04
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 97.0
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 96.97
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.84
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 96.69
3dao_A283 Putative phosphatse; structural genomics, joint ce 96.58
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 96.58
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 96.52
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 96.47
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 96.45
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 96.03
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 95.88
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 95.83
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 95.78
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 95.63
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 95.46
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 95.29
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 95.26
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 95.22
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 95.12
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 94.58
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 94.43
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 93.94
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 93.88
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 93.58
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 90.78
1y8a_A332 Hypothetical protein AF1437; structural genomics, 90.33
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 90.19
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 89.45
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 89.34
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 87.08
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 85.05
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 84.69
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 84.4
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 81.32
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 80.68
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
Probab=99.47  E-value=4.7e-13  Score=112.88  Aligned_cols=85  Identities=16%  Similarity=0.285  Sum_probs=73.7

Q ss_pred             hHHHHHHcCCcEEEEecCCH---------------HHHHHHHHHhC--CcEEE---------ccCCCChHH-HHHHHHHh
Q 020934          174 DWAELQRRGFKGLYEYDNDA---------------SKARKLEGKIG--IKVIR---------HRVKKPAGT-AEEIEKHF  226 (319)
Q Consensus       174 ~l~~Lke~Gikl~I~SNn~~---------------~~v~~l~~~lG--I~~I~---------~~akKP~~~-f~~ALk~l  226 (319)
                      .++.|+++|++++|+||+..               ..+..+++.+|  +..+.         ....||.+. +.++++++
T Consensus        35 ~l~~L~~~g~~~~i~Tn~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~KP~~~~~~~~~~~~  114 (179)
T 3l8h_A           35 AIARLTQADWTVVLATNQSGLARGLFDTATLNAIHDKMHRALAQMGGVVDAIFMCPHGPDDGCACRKPLPGMYRDIARRY  114 (179)
T ss_dssp             HHHHHHHTTCEEEEEEECTTTTTTSSCHHHHHHHHHHHHHHHHHTTCCCCEEEEECCCTTSCCSSSTTSSHHHHHHHHHH
T ss_pred             HHHHHHHCCCEEEEEECCCccccCcCCHHHHHHHHHHHHHHHHhCCCceeEEEEcCCCCCCCCCCCCCCHHHHHHHHHHc
Confidence            47999999999999999875               45667778889  66432         146899998 89999999


Q ss_pred             CCCCCceEEEcCCchhhHHhHHHcCCeEEEEcc
Q 020934          227 GCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEP  259 (319)
Q Consensus       227 gv~p~e~vmVGDrl~TDIlgAn~aGm~TILV~P  259 (319)
                      |++|++++||||+. +||.+|+++||.+|+|..
T Consensus       115 ~~~~~~~~~vGD~~-~Di~~a~~aG~~~i~v~~  146 (179)
T 3l8h_A          115 DVDLAGVPAVGDSL-RDLQAAAQAGCAPWLVQT  146 (179)
T ss_dssp             TCCCTTCEEEESSH-HHHHHHHHHTCEEEEEST
T ss_pred             CCCHHHEEEECCCH-HHHHHHHHCCCcEEEECC
Confidence            99999999999998 999999999999999963



>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 319
d1yv9a1253 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En 7e-04
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NagD-like
domain: Putative hydrolase EF1188
species: Enterococcus faecalis [TaxId: 1351]
 Score = 38.1 bits (87), Expect = 7e-04
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 210 HRVKKPAGTAEEIEKHFGCQSSQLIMVGDRPFTDIVYGNRNGFLTIL 256
           +  K  A   E    H G +  Q+IMVGD   TDI  G +NG  ++L
Sbjct: 177 YIGKPKAIIMERAIAHLGVEKEQVIMVGDNYETDIQSGIQNGIDSLL 223


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.44
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.44
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.43
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.42
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.4
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.39
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.37
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.36
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.34
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.33
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.32
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.31
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.31
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.31
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.29
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.29
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.29
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.26
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.25
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.24
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.23
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.23
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.19
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.11
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.08
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.07
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 98.86
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 98.62
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 98.47
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.45
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.07
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 97.67
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 97.58
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 97.45
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 97.41
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 97.33
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 97.31
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 96.41
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 96.32
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 96.1
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 96.02
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 94.53
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 94.51
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 94.49
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 92.32
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 92.01
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 91.74
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 90.3
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 90.19
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 89.72
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 89.54
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 89.39
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 89.09
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 88.84
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 88.63
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 87.95
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 87.93
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 87.92
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 87.56
d1yioa2128 Response regulatory protein StyR, N-terminal domai 85.59
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 85.54
d1mb3a_123 Cell division response regulator DivK {Caulobacter 85.48
d1qkka_140 Transcriptional regulatory protein DctD, receiver 83.89
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 83.85
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 83.08
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Histidinol phosphatase-like
domain: Histidine biosynthesis bifunctional protein HisB, phosphatase domain
species: Escherichia coli [TaxId: 562]
Probab=99.44  E-value=7.1e-14  Score=118.68  Aligned_cols=87  Identities=20%  Similarity=0.271  Sum_probs=66.4

Q ss_pred             hHHHHHHcCCcEEEEecCCH--------H-------HHHHHHHHhCCcE----EE-------ccCCCChHH-HHHHHHHh
Q 020934          174 DWAELQRRGFKGLYEYDNDA--------S-------KARKLEGKIGIKV----IR-------HRVKKPAGT-AEEIEKHF  226 (319)
Q Consensus       174 ~l~~Lke~Gikl~I~SNn~~--------~-------~v~~l~~~lGI~~----I~-------~~akKP~~~-f~~ALk~l  226 (319)
                      .++.|+++|++++++||..+        .       ....+++..|+..    +.       +..+||.|. +.+|++++
T Consensus        38 ~L~~L~~~g~~l~i~TNq~~ia~~~~~~~~~~~~~~~l~~~l~~~~~~~~~i~~~~~~~~~~~~~~KP~p~~~~~~~~~~  117 (161)
T d2fpwa1          38 QLLKLQKAGYKLVMITNQDGLGTQSFPQADFDGPHNLMMQIFTSQGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQ  117 (161)
T ss_dssp             HHHHHHHTTEEEEEEEECTTTTSTTSCHHHHHHHHHHHHHHHHHTTCCEEEEEEECCCGGGCCSSSTTSSGGGGGGC---
T ss_pred             HHHHHHHcCCceeeecccccchhHHHHHHHhhhhhhhhhhhccccccccceeeeccccccccccccccccHHHHHHHHhc
Confidence            47999999999999999752        1       1234455667642    21       245699998 88999999


Q ss_pred             CCCCCceEEEcCCchhhHHhHHHcCCeEEEEccCc
Q 020934          227 GCQSSQLIMVGDRPFTDIVYGNRNGFLTILTEPLS  261 (319)
Q Consensus       227 gv~p~e~vmVGDrl~TDIlgAn~aGm~TILV~Pi~  261 (319)
                      |++|++++||||+. +||.+|++|||++|||.+-.
T Consensus       118 ~id~~~~~~IGD~~-~Di~aA~~aG~~~i~i~~~~  151 (161)
T d2fpwa1         118 AMDRANSYVIGDRA-TDIQLAENMGINGLRYDRET  151 (161)
T ss_dssp             -CCGGGCEEEESSH-HHHHHHHHHTSEEEECBTTT
T ss_pred             CCChhcEEEECCCH-HHHHHHHHcCCeEEEECCCC
Confidence            99999999999998 89999999999999997754



>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure