Citrus Sinensis ID: 021032
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| 147863214 | 807 | hypothetical protein VITISV_006585 [Viti | 0.977 | 0.385 | 0.669 | 1e-114 | |
| 225443339 | 704 | PREDICTED: KH domain-containing protein | 0.974 | 0.440 | 0.669 | 1e-113 | |
| 449448150 | 716 | PREDICTED: KH domain-containing protein | 0.977 | 0.434 | 0.558 | 1e-85 | |
| 449492545 | 716 | PREDICTED: KH domain-containing protein | 0.977 | 0.434 | 0.558 | 1e-85 | |
| 356526304 | 565 | PREDICTED: heterogeneous nuclear ribonuc | 0.955 | 0.538 | 0.566 | 4e-79 | |
| 356522258 | 559 | PREDICTED: KH domain-containing protein | 0.952 | 0.542 | 0.573 | 9e-79 | |
| 15217969 | 621 | RNA-binding KH domain-containing protein | 0.883 | 0.452 | 0.570 | 2e-78 | |
| 297847528 | 622 | KH domain-containing protein [Arabidopsi | 0.883 | 0.451 | 0.573 | 3e-78 | |
| 357159179 | 629 | PREDICTED: poly(rC)-binding protein 2-li | 0.977 | 0.494 | 0.484 | 6e-67 | |
| 242045198 | 371 | hypothetical protein SORBIDRAFT_02g02892 | 0.971 | 0.832 | 0.461 | 2e-64 |
| >gi|147863214|emb|CAN78372.1| hypothetical protein VITISV_006585 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 417 bits (1072), Expect = e-114, Method: Compositional matrix adjust.
Identities = 211/315 (66%), Positives = 248/315 (78%), Gaps = 4/315 (1%)
Query: 2 RHSPAQDAVMRVHSRIAEIGFEPGQAVVARLLVHSQQIGCLLGRGGHIVSEMRRATGASI 61
+HSPAQDAV+RVH RIAEIGFEPG AVVARLLVHSQQIGCLLG+GG I+SEMRRATGASI
Sbjct: 487 KHSPAQDAVIRVHCRIAEIGFEPGAAVVARLLVHSQQIGCLLGKGGIIISEMRRATGASI 546
Query: 62 RVFPKDQAPRCGSPHDEIVQVIGNYHSVQDALFHITSRLRETIFPMKRPGPN-NGHSYLP 120
R+F K+Q P+CGS +DE+VQVIG+ SVQDALF ITSR+RETIFP+K N NG Y+
Sbjct: 547 RIFAKEQVPKCGSQNDELVQVIGSLQSVQDALFCITSRIRETIFPLKPSISNVNGPPYMS 606
Query: 121 PFPEMPPPPFRPRHNPASPGSYPSPVGPFHSMDRGMGPSQPFDHQAAFSHGMDPMVPPNS 180
FPE+PPP FRPRH+PASPG Y SPVG H +DR P P DHQ++FSHG+D + P N
Sbjct: 607 SFPEIPPPMFRPRHDPASPGHYSSPVGVPHGIDRSAVPGHPLDHQSSFSHGVDRIGPSNL 666
Query: 181 DRIPFPYGSERPGHGPTFDRP-PSPRSWTPQGVGGGDPRGFDA-SSGFTPRNRPVESGNH 238
DR P+PYG +RPGHGP FDRP SPR WTPQGV G+ RG D S G R+ P SG+
Sbjct: 667 DRAPYPYGGDRPGHGPPFDRPSSSPRMWTPQGV-SGNLRGTDVGSGGLASRSGPPGSGSQ 725
Query: 239 AAILTSTTIEVVIPQLYMAHVYGENNSNLSHIRQISGANVVVNDPKPGATEGVVMVSGTS 298
A +T TT+EV +PQ ++HVYGENNSNL+ IRQISGA VV+ DP+ G++EGVV+VSGT
Sbjct: 726 APNITXTTVEVAVPQALLSHVYGENNSNLNQIRQISGARVVIQDPRTGSSEGVVVVSGTP 785
Query: 299 DQMRAAQSLIHAFIL 313
DQ RAAQSL+ AFIL
Sbjct: 786 DQTRAAQSLVQAFIL 800
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225443339|ref|XP_002264125.1| PREDICTED: KH domain-containing protein At4g18375 [Vitis vinifera] gi|297735779|emb|CBI18466.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449448150|ref|XP_004141829.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449492545|ref|XP_004159029.1| PREDICTED: KH domain-containing protein At4g18375-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356526304|ref|XP_003531758.1| PREDICTED: heterogeneous nuclear ribonucleoprotein K-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356522258|ref|XP_003529764.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15217969|ref|NP_175569.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] gi|12321677|gb|AAG50879.1|AC025294_17 hypothetical protein [Arabidopsis thaliana] gi|12325367|gb|AAG52626.1|AC024261_13 hypothetical protein; 15135-12645 [Arabidopsis thaliana] gi|31711718|gb|AAP68215.1| At1g51580 [Arabidopsis thaliana] gi|110735740|dbj|BAE99849.1| hypothetical protein [Arabidopsis thaliana] gi|332194564|gb|AEE32685.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297847528|ref|XP_002891645.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297337487|gb|EFH67904.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357159179|ref|XP_003578365.1| PREDICTED: poly(rC)-binding protein 2-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|242045198|ref|XP_002460470.1| hypothetical protein SORBIDRAFT_02g028920 [Sorghum bicolor] gi|241923847|gb|EER96991.1| hypothetical protein SORBIDRAFT_02g028920 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| TAIR|locus:2017612 | 621 | AT1G51580 "AT1G51580" [Arabido | 0.531 | 0.272 | 0.511 | 6.7e-78 | |
| TAIR|locus:2168367 | 652 | RCF3 "AT5G53060" [Arabidopsis | 0.261 | 0.127 | 0.458 | 8.4e-25 | |
| TAIR|locus:2161413 | 644 | AT5G46190 "AT5G46190" [Arabido | 0.339 | 0.167 | 0.360 | 5e-24 | |
| TAIR|locus:2150956 | 548 | AT5G15270 "AT5G15270" [Arabido | 0.323 | 0.187 | 0.428 | 4.8e-19 | |
| TAIR|locus:2084908 | 577 | FLK "AT3G04610" [Arabidopsis t | 0.308 | 0.169 | 0.355 | 5.5e-15 | |
| TAIR|locus:2831364 | 606 | AT4G18375 "AT4G18375" [Arabido | 0.402 | 0.211 | 0.318 | 9.1e-15 | |
| TAIR|locus:2066020 | 632 | AT2G22600 "AT2G22600" [Arabido | 0.298 | 0.150 | 0.364 | 2.1e-14 | |
| TAIR|locus:2035807 | 479 | AT1G14170 "AT1G14170" [Arabido | 0.327 | 0.217 | 0.405 | 5.7e-14 | |
| TAIR|locus:2056951 | 153 | AT2G03110 "AT2G03110" [Arabido | 0.286 | 0.594 | 0.383 | 7.2e-11 | |
| TAIR|locus:2120755 | 495 | PEP "AT4G26000" [Arabidopsis t | 0.308 | 0.197 | 0.301 | 9.5e-10 |
| TAIR|locus:2017612 AT1G51580 "AT1G51580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 415 (151.1 bits), Expect = 6.7e-78, Sum P(2) = 6.7e-78
Identities = 92/180 (51%), Positives = 114/180 (63%)
Query: 140 GSYPSP-VGPFHSMDRGMGPSQPFDHQAAFSHGMDPMVPPNSDRIPFPYGSERPGHGPTF 198
G P P +GP+ GP Q + A+ P+ P + P G +RP GP F
Sbjct: 447 GGPPPPFMGPYPEPPPPFGPRQ---YPASPDRYHSPVGPFHERHCHGP-GFDRPP-GPGF 501
Query: 199 DRPPSPRSWTPQGVGGGDPRGF---DASSGFTPRNRPVESGNHAAILTSTTIEVVIPQLY 255
DRPPSP SWTPQ G P G D + GF RN P+ S N ++TS +E+VIPQ Y
Sbjct: 502 DRPPSPMSWTPQPGIDGHPGGMVPPDVNHGFALRNEPIGSEN--PVMTSANVEIVIPQAY 559
Query: 256 MAHVYGENNSNLSHIRQISGANVVVNDPKPGATEGVVMVSGTSDQMRAAQSLIHAFILCG 315
+ HVYGEN SNL++I+Q+SGANVVV+DPK G TEG+V+VSGTSDQ AQSL+HAFILCG
Sbjct: 560 LGHVYGENCSNLNYIKQVSGANVVVHDPKAGTTEGLVVVSGTSDQAHFAQSLLHAFILCG 619
|
|
| TAIR|locus:2168367 RCF3 "AT5G53060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161413 AT5G46190 "AT5G46190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150956 AT5G15270 "AT5G15270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084908 FLK "AT3G04610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2831364 AT4G18375 "AT4G18375" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2066020 AT2G22600 "AT2G22600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035807 AT1G14170 "AT1G14170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056951 AT2G03110 "AT2G03110" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120755 PEP "AT4G26000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 1e-18 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 2e-12 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 1e-10 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 5e-10 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 3e-09 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 3e-09 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 8e-07 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 2e-06 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 2e-05 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 5e-05 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 1e-04 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 0.002 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
Score = 77.9 bits (193), Expect = 1e-18
Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
Query: 29 VARLLVHSQQIGCLLGRGGHIVSEMRRATGASIRVFPKDQAPRCGSPHDEIVQVIGNYHS 88
RLLV S Q G ++G+GG + E+R TGA IRV + +V + G +
Sbjct: 1 TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVLP----GSTERVVTISGKPSA 56
Query: 89 VQDALFHIT 97
VQ AL I
Sbjct: 57 VQKALLLIL 65
|
Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 100.0 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.96 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.96 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.94 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 99.93 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 99.93 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 99.88 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 99.83 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 99.8 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.75 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 99.71 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.71 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.59 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.59 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.45 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.43 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.41 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.38 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.36 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.36 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.36 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.29 | |
| PF13014 | 43 | KH_3: KH domain | 99.17 | |
| PF13014 | 43 | KH_3: KH domain | 99.13 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 99.11 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 99.11 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 99.05 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.93 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.67 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.59 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.57 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 98.55 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 98.22 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.22 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 98.17 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 98.14 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.05 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 98.01 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.92 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.76 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.75 | |
| KOG2208 | 753 | consensus Vigilin [Lipid transport and metabolism] | 97.73 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.71 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 97.69 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 97.63 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.62 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 97.42 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 97.41 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 97.4 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.4 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.38 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 97.37 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.36 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 97.27 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 97.24 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 97.18 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 97.17 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 97.13 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.08 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.97 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 96.8 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 96.73 | |
| KOG2814 | 345 | consensus Transcription coactivator complex, P50 c | 96.72 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 96.68 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 96.65 | |
| KOG1588 | 259 | consensus RNA-binding protein Sam68 and related KH | 96.58 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 96.47 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 96.45 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 96.44 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.41 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 96.33 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 96.33 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 96.24 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 96.22 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 96.18 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 96.05 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 96.03 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.01 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 95.61 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 95.59 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 95.46 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.37 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 95.34 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 95.32 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 95.28 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 95.26 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.15 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 95.12 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 94.78 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 94.32 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 94.15 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 93.94 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 93.52 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 93.51 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 93.48 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 92.87 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 92.16 | |
| KOG3273 | 252 | consensus Predicted RNA-binding protein Pno1p inte | 92.04 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 92.0 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 91.93 | |
| PRK13764 | 602 | ATPase; Provisional | 91.7 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 91.53 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 91.41 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 91.2 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 91.13 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 91.08 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 90.8 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 90.6 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 90.56 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 89.65 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 89.53 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 88.58 | |
| PRK13764 | 602 | ATPase; Provisional | 88.28 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 88.25 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 88.15 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 87.58 | |
| cd02411 | 85 | archeal_30S_S3_KH K homology RNA-binding domain (K | 87.49 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 87.45 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 87.03 | |
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 86.95 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 86.03 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 84.5 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 84.17 | |
| COG0092 | 233 | RpsC Ribosomal protein S3 [Translation, ribosomal | 84.16 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 84.11 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 83.07 | |
| KOG2874 | 356 | consensus rRNA processing protein [Translation, ri | 82.46 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 82.16 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 80.74 |
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-35 Score=259.41 Aligned_cols=273 Identities=22% Similarity=0.362 Sum_probs=176.9
Q ss_pred HHHHHHHHHHHHHhh---ccCCCCeeEEEEEEecccceeeeCCCCchHHHHHHHhCCeEEEecCCCCCCCCCCCCceEEE
Q 021032 6 AQDAVMRVHSRIAEI---GFEPGQAVVARLLVHSQQIGCLLGRGGHIVSEMRRATGASIRVFPKDQAPRCGSPHDEIVQV 82 (318)
Q Consensus 6 a~~a~~~v~~~i~~~---~~e~~~~~~~rllVp~~~vG~IIGkgG~~Ik~I~e~tGa~I~i~~~~~~p~~~~~~er~V~I 82 (318)
..+-+..|+..|+-. ++...+++++||||+.+++|.|||++|++||+|||++.|+++|... ||+.++||+|.|
T Consensus 98 d~~ti~~ilk~iip~lee~f~~~~pce~rllihqs~ag~iigrngskikelrekcsarlkift~----c~p~stdrv~l~ 173 (390)
T KOG2192|consen 98 DIETIGEILKKIIPTLEEGFQLPSPCELRLLIHQSLAGGIIGRNGSKIKELREKCSARLKIFTE----CCPHSTDRVVLI 173 (390)
T ss_pred cHHHHHHHHHHHhhhhhhCCCCCCchhhhhhhhhhhccceecccchhHHHHHHhhhhhhhhhhc----cCCCCcceEEEe
Confidence 344555555555543 3446788999999999999999999999999999999999999977 999999999999
Q ss_pred EecHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 021032 83 IGNYHSVQDALFHITSRLRETIFPMKRPGPNNGHSYLPPFPEMPPPPFRPRHNPASPGSYPSPVGPFHSMDRGMGPSQPF 162 (318)
Q Consensus 83 ~G~~~~V~~A~~~I~~~l~e~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~g~~~~p~~~~~~~~~~~~~~~~~ 162 (318)
.|++.+|..+++.|++.|.|. +++.++.+|+|.|.+ +.+.|... ..+.+..+.. ....+.+.
T Consensus 174 ~g~~k~v~~~i~~il~~i~e~------pikgsa~py~p~fyd-~t~dyggf---------~M~f~d~pg~--pgpapqrg 235 (390)
T KOG2192|consen 174 GGKPKRVVECIKIILDLISES------PIKGSAQPYDPNFYD-ETYDYGGF---------TMMFDDRPGR--PGPAPQRG 235 (390)
T ss_pred cCCcchHHHHHHHHHHHhhcC------CcCCcCCcCCccccC-cccccCCc---------eeecCCCCCC--CCCCCCCC
Confidence 999999999999999999997 788899999999843 22222111 0000000000 00000000
Q ss_pred CCcccccCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCC----CCC-----CCCCCCCC-CCCCCCCCCCCCCCCCCCC
Q 021032 163 DHQAAFSHGMDPMVPPNSDRIPFPYGSERPGHG---PTFD----RPP-----SPRSWTPQ-GVGGGDPRGFDASSGFTPR 229 (318)
Q Consensus 163 ~~~~~~~~g~~~~~~~~~~~~~~~~g~~~~~~~---~~~~----~~~-----~~~~~~~~-~~~~~~~~g~~~~~~~~~~ 229 (318)
|-++-+++..+...+..++..+... .+|. .|. .|..|.+. ..-+++.+.+.....+.+.
T Consensus 236 --------gqgpp~~~~sdlmay~r~GrpG~rydg~vdFs~detw~saidtw~~SewqmaYePQgGs~ydysyAG~~GsY 307 (390)
T KOG2192|consen 236 --------GQGPPPPRGSDLMAYDRRGRPGDRYDGMVDFSADETWPSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGYGSY 307 (390)
T ss_pred --------CCCCCCCCccccceeccCCCCCccccccccccccccCCCcCCCcCccccccccCCCCCCCCCcccccccccc
Confidence 0000000111111111111000000 0111 011 22333211 1101111111111101100
Q ss_pred CCCCCCCCccccCcceEEEEEecccccccccccccchHHHHHHHhCCEEEEcCCCCCCCCeEEEEEcCHHHHHHHHHHHH
Q 021032 230 NRPVESGNHAAILTSTTIEVVIPQLYMAHVYGENNSNLSHIRQISGANVVVNDPKPGATEGVVMVSGTSDQMRAAQSLIH 309 (318)
Q Consensus 230 ~~~~~~~~~~~~~~~~t~~v~IP~~~vG~IIGk~G~~Ik~Ir~~SGA~I~i~~~~~~~~er~v~I~Gt~~~v~~A~~lI~ 309 (318)
.++ .....|.+|.||.++-|.||||+|.+|++|++++||+|+|+++.+++.||+++|+||.+|++.||+|++
T Consensus 308 -Gdl-------GGPitTaQvtip~dlggsiigkggqri~~ir~esGA~IkidepleGsedrIitItGTqdQIqnAQYLlQ 379 (390)
T KOG2192|consen 308 -GDL-------GGPITTAQVTIPKDLGGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQ 379 (390)
T ss_pred -CCC-------CCceeeeeEecccccCcceecccchhhhhhhhccCceEEecCcCCCCCceEEEEeccHHHHhhHHHHHH
Confidence 111 124678999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHcCc
Q 021032 310 AFILCGV 316 (318)
Q Consensus 310 ~~i~~~~ 316 (318)
++|+.++
T Consensus 380 n~Vkq~r 386 (390)
T KOG2192|consen 380 NSVKQYR 386 (390)
T ss_pred HHHHhhh
Confidence 9998754
|
|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2208 consensus Vigilin [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2874 consensus rRNA processing protein [Translation, ribosomal structure and biogenesis; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 318 | ||||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 5e-05 | ||
| 1j5k_A | 89 | Complex Of The Kh3 Domain Of Hnrnp K With A Single_ | 6e-05 | ||
| 1wvn_A | 82 | Crsytal Structure Of Domain 3 Of Human Alpha Polyc | 1e-04 | ||
| 1khm_A | 89 | C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | 1e-04 | ||
| 2p2r_A | 76 | Crystal Structure Of The Third Kh Domain Of Human P | 3e-04 |
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
|
| >pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 | Back alignment and structure |
| >pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 | Back alignment and structure |
| >pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | Back alignment and structure |
| >pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 9e-20 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-10 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 3e-09 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-06 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 2e-19 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-10 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 5e-08 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 7e-08 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 1e-18 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 2e-12 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 3e-18 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 1e-11 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-17 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-11 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 1e-16 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 8e-12 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-07 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 6e-07 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 2e-16 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 1e-11 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-15 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-07 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 4e-15 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 3e-10 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 5e-09 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 4e-08 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 4e-15 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 4e-13 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 7e-15 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 5e-11 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 4e-14 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 2e-08 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 8e-14 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 4e-10 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 8e-10 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 7e-07 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 8e-11 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 7e-08 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-09 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-06 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-09 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 8e-07 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 2e-09 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 2e-09 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 1e-08 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 1e-07 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-07 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-06 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 8e-06 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-05 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-05 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 4e-05 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-04 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-04 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 2e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 5e-04 |
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
Score = 83.7 bits (207), Expect = 9e-20
Identities = 23/108 (21%), Positives = 44/108 (40%), Gaps = 12/108 (11%)
Query: 4 SPAQDAVMRVHSRIAEI--------GFEPGQAVVARLLVHSQQIGCLLGRGGHIVSEMRR 55
+ A + ++ E V RL+V + Q G L+G+GG + E+R
Sbjct: 57 NAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRE 116
Query: 56 ATGASIRVFPKDQAPRCGSPHDEIVQVIGNYHSVQDALFHITSRLRET 103
+TGA ++V + + + + G S+ + + I + ET
Sbjct: 117 STGAQVQVAGDM----LPNSTERAITIAGIPQSIIECVKQICVVMLET 160
|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.96 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.96 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.96 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.96 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.96 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.86 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.77 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.75 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.73 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.73 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.72 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.7 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.7 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.69 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.68 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.68 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.68 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.64 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.64 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.64 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.64 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.63 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.63 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.62 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.61 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.61 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.61 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.6 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.6 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.58 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.58 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.57 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.57 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.57 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.56 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.54 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.54 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.51 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.51 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.5 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.5 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.5 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.49 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.47 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.46 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.46 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.45 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.44 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.42 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.4 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.37 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.34 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.29 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.27 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.25 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.25 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.2 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 99.1 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.96 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 98.94 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.88 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.82 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.81 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.72 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.57 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 98.54 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 98.4 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.39 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.38 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 98.34 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.08 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.98 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.86 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.82 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.33 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 96.44 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 96.18 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 96.14 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 95.37 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 95.09 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 93.8 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 91.3 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 87.97 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 86.73 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 85.43 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 84.59 | |
| 1wh9_A | 92 | 40S ribosomal protein S3; KH domain, structural ge | 83.15 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 80.3 |
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.96 E-value=3.5e-29 Score=211.31 Aligned_cols=159 Identities=19% Similarity=0.354 Sum_probs=129.9
Q ss_pred eEEEEEEecccceeeeCCCCchHHHHHHHhCCeEEEecCCCCCCCCCCCCceEEEEecHHHHHHHHHHHHHHHHhhcCCC
Q 021032 28 VVARLLVHSQQIGCLLGRGGHIVSEMRRATGASIRVFPKDQAPRCGSPHDEIVQVIGNYHSVQDALFHITSRLRETIFPM 107 (318)
Q Consensus 28 ~~~rllVp~~~vG~IIGkgG~~Ik~I~e~tGa~I~i~~~~~~p~~~~~~er~V~I~G~~~~V~~A~~~I~~~l~e~~~~~ 107 (318)
++.+|+||.+++|.||||+|++||+|+++|||+|+|.+... ++...||+|+|+|++++|.+|+.+|.+++.+....
T Consensus 2 ~~~~~~Vp~~~~g~iIGk~G~~Ik~i~~~tg~~I~i~~~~~---~~~~~~r~v~I~G~~~~v~~A~~~I~~ii~e~~~~- 77 (164)
T 2jvz_A 2 TVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGS---QNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQG- 77 (164)
T ss_dssp EEEEEEECTTCHHHHTCTTTHHHHHHHHTSCSEEEECCCTT---SSSSSCEEEEEEECHHHHHHHHHHHHHHTTCSSSC-
T ss_pred eEEEEEechhheeEEECCChHHHHHHHHHhCCeEEEecCCC---CCCCCceEEEEEcCHHHHHHHHHHHHHHHHhccCC-
Confidence 57899999999999999999999999999999999964321 23467899999999999999999999988764100
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCCCCCCCCCCCCCCC
Q 021032 108 KRPGPNNGHSYLPPFPEMPPPPFRPRHNPASPGSYPSPVGPFHSMDRGMGPSQPFDHQAAFSHGMDPMVPPNSDRIPFPY 187 (318)
Q Consensus 108 ~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~g~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~ 187 (318)
.| . .. . .|
T Consensus 78 -------------~~--------------------~-------~~---------------------------~-----~~ 85 (164)
T 2jvz_A 78 -------------GF--------------------G-------DR---------------------------N-----EY 85 (164)
T ss_dssp -------------CC--------------------S-------SC---------------------------S-----SC
T ss_pred -------------CC--------------------C-------Cc---------------------------c-----cc
Confidence 00 0 00 0 00
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCcceEEEEEecccccccccccccchH
Q 021032 188 GSERPGHGPTFDRPPSPRSWTPQGVGGGDPRGFDASSGFTPRNRPVESGNHAAILTSTTIEVVIPQLYMAHVYGENNSNL 267 (318)
Q Consensus 188 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~t~~v~IP~~~vG~IIGk~G~~I 267 (318)
+ .....+.+|.||.+++|+||||+|++|
T Consensus 86 ~----------------------------------------------------~~~~~~~~i~vp~~~~g~iIGk~G~~I 113 (164)
T 2jvz_A 86 G----------------------------------------------------SRIGGGIDVPVPRHSVGVVIGRSGEMI 113 (164)
T ss_dssp T----------------------------------------------------TSCSSSBCCEEETTTHHHHHCSSSHHH
T ss_pred C----------------------------------------------------CCCCceEEEEEChhhccccCCCCcHhH
Confidence 0 000124677899999999999999999
Q ss_pred HHHHHHhCCEEEEcCCCCCCCCeEEEEEcCHHHHHHHHHHHHHHHHc
Q 021032 268 SHIRQISGANVVVNDPKPGATEGVVMVSGTSDQMRAAQSLIHAFILC 314 (318)
Q Consensus 268 k~Ir~~SGA~I~i~~~~~~~~er~v~I~Gt~~~v~~A~~lI~~~i~~ 314 (318)
++|++.|||+|+|.+..+.+.+|.|+|+|++++++.|+.+|.+++.+
T Consensus 114 ~~i~~~tg~~I~i~~~~~~~~~~~v~I~G~~~~v~~A~~~I~~~i~~ 160 (164)
T 2jvz_A 114 KKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQS 160 (164)
T ss_dssp HHHHHHTCCEEEECCCCTTSSEEEEEEESCHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHCCeEEEeCCCCCCCcEEEEEEcCHHHHHHHHHHHHHHHhh
Confidence 99999999999998877677799999999999999999999999875
|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 318 | ||||
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 1e-15 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 4e-11 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 2e-15 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 6e-11 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 4e-14 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 3e-11 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 5e-14 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-11 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 8e-14 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 3e-09 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 6e-13 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 6e-13 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-12 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-08 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 3e-12 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 2e-10 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 4e-12 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 3e-08 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 1e-11 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 6e-10 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 2e-11 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 5e-11 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 2e-11 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 2e-08 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 2e-10 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 5e-10 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 1e-05 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 2e-09 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 5e-09 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-07 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 6e-09 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 0.002 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 3e-04 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 5e-04 |
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.3 bits (167), Expect = 1e-15
Identities = 22/68 (32%), Positives = 41/68 (60%)
Query: 245 TTIEVVIPQLYMAHVYGENNSNLSHIRQISGANVVVNDPKPGATEGVVMVSGTSDQMRAA 304
TT E+ IP + + G +N++ IRQ+SGA + + +P G++ V ++G++ + A
Sbjct: 2 TTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLA 61
Query: 305 QSLIHAFI 312
Q LI+A +
Sbjct: 62 QYLINARL 69
|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.76 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.74 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.72 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.71 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.7 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.7 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.68 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.67 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.67 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.66 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.66 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.65 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.64 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.63 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.61 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.61 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.44 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.42 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.33 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.3 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 99.15 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 99.05 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 99.05 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 99.02 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.98 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.91 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.89 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.82 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.75 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.69 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.48 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.29 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 98.15 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.82 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 96.19 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 96.14 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 96.02 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 95.55 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 92.66 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 91.67 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 89.5 | |
| d2uubc1 | 105 | Ribosomal protein S3 N-terminal domain {Thermus th | 86.94 | |
| d1wf3a2 | 118 | GTPase Era C-terminal domain {Thermus thermophilus | 86.39 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 84.47 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 84.03 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 83.39 |
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76 E-value=5.6e-19 Score=125.92 Aligned_cols=68 Identities=32% Similarity=0.560 Sum_probs=65.6
Q ss_pred eEEEEEecccccccccccccchHHHHHHHhCCEEEEcCCCCCCCCeEEEEEcCHHHHHHHHHHHHHHH
Q 021032 245 TTIEVVIPQLYMAHVYGENNSNLSHIRQISGANVVVNDPKPGATEGVVMVSGTSDQMRAAQSLIHAFI 312 (318)
Q Consensus 245 ~t~~v~IP~~~vG~IIGk~G~~Ik~Ir~~SGA~I~i~~~~~~~~er~v~I~Gt~~~v~~A~~lI~~~i 312 (318)
.|.+|.||++++|+||||+|++|++|++.|||+|+|+++.+++.+|.|+|+|++++|+.|++||+++|
T Consensus 2 ~T~~i~VP~~~vg~iIGk~G~~I~~I~~~tga~I~i~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i 69 (70)
T d1wvna1 2 TTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARL 69 (70)
T ss_dssp EEEEEEEEGGGHHHHHCGGGHHHHHHHHHHCCEEEECCCCTTCSEEEEEEEECHHHHHHHHHHHHHHT
T ss_pred eEEEEEEChHhcceeECCCChHHHHHHHHcCcEEEEcCCCCCCCcEEEEEEeCHHHHHHHHHHHHHHc
Confidence 68999999999999999999999999999999999998888899999999999999999999999886
|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|