Citrus Sinensis ID: 021201
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| 118488149 | 354 | unknown [Populus trichocarpa] | 0.920 | 0.822 | 0.534 | 8e-80 | |
| 224120494 | 354 | predicted protein [Populus trichocarpa] | 0.920 | 0.822 | 0.534 | 2e-79 | |
| 224120488 | 610 | predicted protein [Populus trichocarpa] | 0.920 | 0.477 | 0.534 | 4e-79 | |
| 224120314 | 354 | predicted protein [Populus trichocarpa] | 0.920 | 0.822 | 0.520 | 3e-78 | |
| 225425076 | 563 | PREDICTED: ankyrin repeat-containing pro | 0.895 | 0.502 | 0.505 | 1e-74 | |
| 297737987 | 1855 | unnamed protein product [Vitis vinifera] | 0.857 | 0.146 | 0.509 | 1e-74 | |
| 147784800 | 1697 | hypothetical protein VITISV_029434 [Viti | 0.857 | 0.159 | 0.509 | 2e-74 | |
| 359472754 | 789 | PREDICTED: ankyrin repeat-containing pro | 0.857 | 0.343 | 0.509 | 3e-74 | |
| 224136692 | 743 | predicted protein [Populus trichocarpa] | 0.851 | 0.362 | 0.516 | 1e-73 | |
| 359473665 | 602 | PREDICTED: LOW QUALITY PROTEIN: ankyrin | 0.895 | 0.470 | 0.508 | 3e-73 |
| >gi|118488149|gb|ABK95894.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 303 bits (775), Expect = 8e-80, Method: Compositional matrix adjust.
Identities = 157/294 (53%), Positives = 205/294 (69%), Gaps = 3/294 (1%)
Query: 1 MWKCDENRYTIFHIAVSNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGK-LAP 59
++K + N Y+IFHI++ NR ++FK I + +I +L+ D EGNN+LHLA K L
Sbjct: 62 IFKVEHNMYSIFHISILNRHEDIFKIIY--QIGSIKNLITTYKDTEGNNMLHLAAKVLES 119
Query: 60 PDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEK 119
P RLN + G+ALQ+QRELLWF+ VKKVV + E KN G TP ALF EQHRDL ++GE+
Sbjct: 120 PSRLNAIPGAALQLQRELLWFEEVKKVVQPRHIEEKNFHGKTPGALFIEQHRDLMKEGEQ 179
Query: 120 WMKDTASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVAS 179
WM+DTA SCM+VATLIATVVFAAA TVPGGN +D G P FL ++FK FA+S+ ISLV S
Sbjct: 180 WMRDTADSCMLVATLIATVVFAAAFTVPGGNFQDKGTPVFLKEIAFKFFAISDAISLVTS 239
Query: 180 TLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTW 239
S++ FLS+ T RYAE++FL LP +L +GL TLFI+I AMMV F AT F+VF +
Sbjct: 240 ASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLTTLFISIGAMMVAFMATFFLVFGNKLLP 299
Query: 240 IAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLFYKEGETKV 293
+I + VV S+P I F + HFRLF D++ S + S L K+ LF K+ + KV
Sbjct: 300 YSIPIAVVASLPVIFFIWQHFRLFVDMIHSTYTSRSLFKPNKSPLFSKKLKPKV 353
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224120494|ref|XP_002331061.1| predicted protein [Populus trichocarpa] gi|222872991|gb|EEF10122.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224120488|ref|XP_002331060.1| predicted protein [Populus trichocarpa] gi|222872990|gb|EEF10121.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224120314|ref|XP_002331017.1| predicted protein [Populus trichocarpa] gi|222872947|gb|EEF10078.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225425076|ref|XP_002271486.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224136692|ref|XP_002322392.1| predicted protein [Populus trichocarpa] gi|222869388|gb|EEF06519.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359473665|ref|XP_003631341.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| TAIR|locus:2165174 | 347 | AT5G35810 "AT5G35810" [Arabido | 0.895 | 0.815 | 0.443 | 1.4e-62 | |
| TAIR|locus:2080240 | 574 | AT3G54070 "AT3G54070" [Arabido | 0.867 | 0.477 | 0.434 | 4e-58 | |
| TAIR|locus:2175413 | 669 | AT5G04700 "AT5G04700" [Arabido | 0.819 | 0.387 | 0.428 | 2.7e-52 | |
| TAIR|locus:2180228 | 625 | AT5G04690 "AT5G04690" [Arabido | 0.813 | 0.411 | 0.424 | 7.4e-50 | |
| TAIR|locus:2175448 | 603 | AT5G04730 "AT5G04730" [Arabido | 0.813 | 0.426 | 0.393 | 6.9e-47 | |
| TAIR|locus:2046628 | 601 | AT2G24600 "AT2G24600" [Arabido | 0.496 | 0.261 | 0.303 | 3.8e-11 | |
| TAIR|locus:2170081 | 535 | AT5G50140 "AT5G50140" [Arabido | 0.518 | 0.306 | 0.258 | 4.3e-11 | |
| TAIR|locus:2092522 | 590 | ITN1 "INCREASED TOLERANCE TO N | 0.417 | 0.223 | 0.347 | 1.3e-10 | |
| TAIR|locus:2157553 | 598 | AT5G54710 "AT5G54710" [Arabido | 0.468 | 0.247 | 0.283 | 2.5e-10 | |
| TAIR|locus:2020833 | 616 | AT1G03670 "AT1G03670" [Arabido | 0.731 | 0.375 | 0.266 | 3.6e-10 |
| TAIR|locus:2165174 AT5G35810 "AT5G35810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 639 (230.0 bits), Expect = 1.4e-62, P = 1.4e-62
Identities = 129/291 (44%), Positives = 195/291 (67%)
Query: 1 MWKCDENRYTIFHIAVSNRQVELFKFIDADDMKAIADLLVDSTDGEGN-NILHLAGKLAP 59
+W D ++FHIA NR ++F I ++ AI DL+ + E N N+LHL +L P
Sbjct: 58 IWTVDHKNQSLFHIAAINRHEKIFNRIY--ELGAIKDLIAMYKEKESNDNLLHLVARLPP 115
Query: 60 PDRLNVVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEK 119
P+RL VVSG+ALQMQRE+LW++AVK++VPR + KNKK LF+++H +L+++GEK
Sbjct: 116 PNRLQVVSGAALQMQREILWYKAVKEIVPRVYIKTKNKKEEVAHDLFTKEHDNLRKEGEK 175
Query: 120 WMKDTASSCMIVATLIATVVFAAALTVPGGNK-----EDTGLPFFLHNVSFKIFAVSNVI 174
WMK+TA++C++V+TLIATVVFAAA T+PGGN + G P F F++F +S+ +
Sbjct: 176 WMKETATACILVSTLIATVVFAAAFTLPGGNDTSGDIKTLGFPTFRKEFWFEVFIISDSV 235
Query: 175 SLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFT 234
+L++S SI++FLS++T RYAE F + LP KL +GL LF++I +M++ F+AT ++
Sbjct: 236 ALLSSVTSIMIFLSILTSRYAEASFQTTLPTKLMLGLLALFVSIISMVLAFTATLILIRD 295
Query: 235 DGSTWIAILVIVVPSVPAILFFYLHFRLFDDILRSVFVSDYLIPKCKTSLF 285
W IL++ V S A+ F LHF+L+ D LRS ++S +L K+ L+
Sbjct: 296 QEPKWSLILLVYVASATALSFVVLHFQLWFDTLRSAYLSKFLFHGRKSGLY 346
|
|
| TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175413 AT5G04700 "AT5G04700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2180228 AT5G04690 "AT5G04690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175448 AT5G04730 "AT5G04730" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046628 AT2G24600 "AT2G24600" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170081 AT5G50140 "AT5G50140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157553 AT5G54710 "AT5G54710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0152005601 | SubName- Full=Putative uncharacterized protein; (354 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| pfam13962 | 114 | pfam13962, PGG, Domain of unknown function | 8e-29 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 0.001 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 0.001 |
| >gnl|CDD|222475 pfam13962, PGG, Domain of unknown function | Back alignment and domain information |
|---|
Score = 106 bits (268), Expect = 8e-29
Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 13/121 (10%)
Query: 118 EKWMKDTASSCMIVATLIATVVFAAALTVPGGNKEDT-----GLPFFLHN-VSFKIFAVS 171
+W++ T +S ++VATLIATV FAA T PGG +D G P FK F VS
Sbjct: 1 SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60
Query: 172 NVISLVASTLSIVVFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFI 231
N I+ VAS +++++ L +V F LPR L L L++++ ++MV F+A S+
Sbjct: 61 NTIAFVASLVAVILLLYIV------PSFSRRLPR-LLALLTLLWLSLLSLMVAFAAGSYR 113
Query: 232 V 232
V
Sbjct: 114 V 114
|
The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| PF13962 | 113 | PGG: Domain of unknown function | 99.92 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.51 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.43 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.27 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.24 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.22 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.2 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.17 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.1 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.08 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.07 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.06 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.05 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.05 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.04 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.04 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.0 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 98.98 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 98.97 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 98.97 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 98.97 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 98.97 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 98.96 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 98.93 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 98.92 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 98.9 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 98.9 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 98.89 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 98.88 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 98.88 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 98.88 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 98.86 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 98.85 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 98.84 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 98.83 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 98.83 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.83 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 98.81 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 98.8 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 98.8 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 98.76 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 98.76 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 98.74 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 98.74 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 98.72 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 98.71 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 98.69 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 98.69 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 98.69 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.68 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 98.67 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.67 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 98.67 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 98.64 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.63 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 98.63 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 98.61 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 98.59 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 98.57 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.56 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 98.54 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 98.51 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 98.49 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 98.45 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 98.43 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 98.41 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 98.41 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 98.39 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 98.38 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 98.36 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 98.33 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.31 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.24 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 98.19 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.19 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.16 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 98.16 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 98.09 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 98.08 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 98.07 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 98.06 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 97.99 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 97.86 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 97.83 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 97.81 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 97.71 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 97.68 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.68 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 97.55 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 97.42 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 97.28 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.23 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 97.2 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 97.18 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.11 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 97.04 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 97.03 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 96.54 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 96.29 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 96.02 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 95.82 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.65 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 95.54 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 95.31 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 95.27 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 95.04 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 94.92 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 93.45 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 93.4 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 93.34 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 91.69 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 91.37 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 90.61 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 89.96 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 85.39 | |
| KOG4591 | 280 | consensus Uncharacterized conserved protein, conta | 83.38 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 82.0 |
| >PF13962 PGG: Domain of unknown function | Back alignment and domain information |
|---|
Probab=99.92 E-value=2.8e-25 Score=178.62 Aligned_cols=109 Identities=41% Similarity=0.682 Sum_probs=97.3
Q ss_pred cccccccchhHHHHHHHHHHHHHHhhccCCCCCcCC---CCcccccCCc-chhhhHhHHHHHHHHHHHHHHHHhhhcCcc
Q 021201 118 EKWMKDTASSCMIVATLIATVVFAAALTVPGGNKED---TGLPFFLHNV-SFKIFAVSNVISLVASTLSIVVFLSLVTPR 193 (316)
Q Consensus 118 ~k~lk~t~~s~lvvA~Liatvtf~a~~t~Pgg~~~~---~G~~~~~~~~-~f~~F~~~n~~a~~~S~~~i~~~~~~~~s~ 193 (316)
+||++++++++++||+||||+||||+++||||+||| +|+|++.+++ .|++|+++|++||++|+++++++++.+
T Consensus 1 ~~~~~~~~~~llVvAtLIATvtF~A~~tpPGG~~~~~~~~G~~il~~~~~~f~~F~~~nt~af~~S~~~i~~l~~~~--- 77 (113)
T PF13962_consen 1 KKWLEDTRNSLLVVATLIATVTFQAAFTPPGGYWQDDDDAGTPILAKKPSAFKAFLISNTIAFFSSLAAIFLLISGL--- 77 (113)
T ss_pred ChHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCccccccCCCCchhccccchhhhHHHHHHHHHHHHHHHHHHHHHHh---
Confidence 478999999999999999999999999999999875 6999998777 999999999999999999998877422
Q ss_pred ccchhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhhhe
Q 021201 194 YAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIV 232 (316)
Q Consensus 194 ~~~~~f~~~l~~~l~~~~~~l~~si~~m~~af~~~~~~v 232 (316)
+++.+..++.+.++..++++++.+|++||++|+++|
T Consensus 78 ---~~~~~~~~~~~~~~~~~~~~a~~~~~~Af~~g~~~v 113 (113)
T PF13962_consen 78 ---DDFRRFLRRYLLIASVLMWIALISMMVAFAAGIYLV 113 (113)
T ss_pred ---hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence 445566677788899999999999999999999875
|
|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 3e-04 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
Score = 40.9 bits (96), Expect = 3e-04
Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 10/96 (10%)
Query: 9 YTIFHIAVSNRQVELFKF-IDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVS 67
+A Q+ + KF + A + + D GN +LH ++A N
Sbjct: 149 ELPLSLAACTNQLAIVKFLLQNSWQPAD----ISARDSVGNTVLHALVEVADNTVDNTKF 204
Query: 68 GSALQMQRELLWFQAVKKVVPR-KLAEAKNKKGLTP 102
++ M E+L K+ P KL E N+KGLTP
Sbjct: 205 VTS--MYNEIL--ILGAKLHPTLKLEEITNRKGLTP 236
|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.49 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.47 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.43 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.43 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.43 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.41 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.39 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.36 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.34 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.33 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.33 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.33 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.33 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.32 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.32 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.31 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.31 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.31 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.3 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.3 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.3 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.29 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.29 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.27 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.27 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.26 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.26 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.26 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.25 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.25 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.24 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.24 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.24 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.24 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.23 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.23 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.23 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.22 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.22 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.21 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.21 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.2 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.2 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.19 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.19 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.18 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.18 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.18 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.18 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.18 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.17 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.17 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.17 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.17 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.17 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.16 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.16 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.16 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.16 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.14 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.14 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.14 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.14 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.14 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.14 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.14 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.14 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.13 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.13 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.13 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.12 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.11 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.11 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.11 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.1 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.1 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.09 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.09 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.09 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.09 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.08 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.08 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.08 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.07 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.07 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.07 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.06 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.05 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.02 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 98.99 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 98.99 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 98.98 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 98.97 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 98.97 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 98.97 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 98.95 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 98.95 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 98.94 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 98.94 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 98.93 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 98.92 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 98.91 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 98.91 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 98.91 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 98.88 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 98.88 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 98.87 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 98.82 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 98.81 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 98.65 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 98.56 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 98.19 |
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
Probab=99.49 E-value=6.7e-15 Score=124.79 Aligned_cols=103 Identities=23% Similarity=0.282 Sum_probs=70.8
Q ss_pred CccccCCCCcHHhHHHHCCCHHHHHHHhhcchhhhhhhhcccCCCCCChHHHHHhhhCCCCccccc--cC----------
Q 021201 1 MWKCDENRYTIFHIAVSNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVV--SG---------- 68 (316)
Q Consensus 1 i~~~D~~G~T~LH~Av~~~~~~iv~~Ll~~~~~~~~~~lin~~D~~GnTpLHlAa~~~~~~~v~~L--~g---------- 68 (316)
++.+|.+|+||||+|+..++.+++++|++ .+.+ ++.+|.+|+||||+|+..|+.+++++| .|
T Consensus 30 vn~~d~~g~t~l~~a~~~~~~~~~~~ll~--~gad----~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G 103 (169)
T 4gpm_A 30 VNASDSDGRTPLHHAAENGHKEVVKLLIS--KGAD----VNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDG 103 (169)
T ss_dssp TTCCCTTSCCHHHHHHHTTCHHHHHHHHH--TTCC----TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTS
T ss_pred CCCcCCCCCCHHHHHHHcCCHHHHHHHHh--cccc----hhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCC
Confidence 45667777777777777777777777777 5543 577777777777777777777766554 22
Q ss_pred -chHHhHHHhhhHhHHHHhcc-chhhhhhccCCCCccccccch
Q 021201 69 -SALQMQRELLWFQAVKKVVP-RKLAEAKNKKGLTPRALFSEQ 109 (316)
Q Consensus 69 -aal~~~~el~w~~~v~~lv~-~~~~~~~N~~G~Tp~~l~~~~ 109 (316)
.+++...+.+..+.++.++. +.+++.+|++|+||++++.+.
T Consensus 104 ~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~ 146 (169)
T 4gpm_A 104 RTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREH 146 (169)
T ss_dssp CCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHT
T ss_pred CCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHc
Confidence 23444444444555555553 467888999999999988654
|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 316 | ||||
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.001 |
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Transcription factor inhibitor I-kappa-B-beta, IKBB species: Mouse (Mus musculus) [TaxId: 10090]
Score = 37.8 bits (86), Expect = 0.001
Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 5/53 (9%)
Query: 3 KCDENRYTIFHIAVSNRQVELFKFIDADDMKAIADL-LVDSTDGEGNNILHLA 54
E+ T H+AV ++ F+ + A +D + G LHLA
Sbjct: 4 YVTEDGDTALHLAVIHQHEPFLDFL----LGFSAGHEYLDLQNDLGQTALHLA 52
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.52 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.38 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.34 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.31 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.27 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.22 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.21 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.21 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.2 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.16 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.16 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.15 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.14 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.13 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.09 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.07 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.04 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.04 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.03 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.02 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 98.99 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 98.99 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 98.98 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 98.93 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 98.92 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 98.91 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 98.9 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 98.82 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 98.82 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 98.78 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 98.78 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 98.36 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 98.27 |
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Myotrophin species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.52 E-value=1.8e-15 Score=118.67 Aligned_cols=82 Identities=17% Similarity=0.107 Sum_probs=61.2
Q ss_pred CccccCCCCcHHhHHHHCCCHHHHHHHhhcchhhhhhhhcccCCCCCChHHHHHhhhCCCCccccccCchHHhHHHhhhH
Q 021201 1 MWKCDENRYTIFHIAVSNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRELLWF 80 (316)
Q Consensus 1 i~~~D~~G~T~LH~Av~~~~~~iv~~Ll~~~~~~~~~~lin~~D~~GnTpLHlAa~~~~~~~v~~L~gaal~~~~el~w~ 80 (316)
++.+|.+|+||||+|+.+|+.++++++++ .+.+ +|.+|.+|+||||+|+..++.++++.|
T Consensus 28 ~n~~~~~g~t~lh~A~~~~~~~~~~~ll~--~g~d----in~~d~~g~tpLh~A~~~~~~~~v~~L-------------- 87 (118)
T d1myoa_ 28 VNRTLEGGRKPLHYAADCGQLEILEFLLL--KGAD----INAPDKHHITPLLSAVYEGHVSCVKLL-------------- 87 (118)
T ss_dssp CCCCSSSSCCTTHHHHHHSTTTHHHHHHH--SSCT----TTCCSSSCSCHHHHHHTTTCCHHHHHH--------------
T ss_pred ccccccccccccccccccccccccccccc--ccce----eeecccccccchhhhhhcCchhhhhhh--------------
Confidence 35667778888888888888888888877 5543 577788888888888887776654433
Q ss_pred hHHHHhc-cchhhhhhccCCCCccccccc
Q 021201 81 QAVKKVV-PRKLAEAKNKKGLTPRALFSE 108 (316)
Q Consensus 81 ~~v~~lv-~~~~~~~~N~~G~Tp~~l~~~ 108 (316)
+ .+.+++.+|++|+||++++..
T Consensus 88 ------l~~Gad~~~~d~~G~t~l~~a~~ 110 (118)
T d1myoa_ 88 ------LSKGADKTVKGPDGLTALEATDN 110 (118)
T ss_dssp ------HTTCCCSSSSSSSTCCCCCTCSS
T ss_pred ------hcccccceeeCCCCCCHHHHHhH
Confidence 3 246788999999999998854
|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|