Citrus Sinensis ID: 021465
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 312 | ||||||
| 225451283 | 304 | PREDICTED: uncharacterized protein LOC10 | 0.916 | 0.940 | 0.590 | 1e-90 | |
| 224088368 | 297 | predicted protein [Populus trichocarpa] | 0.923 | 0.969 | 0.577 | 3e-88 | |
| 255574613 | 312 | conserved hypothetical protein [Ricinus | 0.948 | 0.948 | 0.552 | 1e-81 | |
| 388512507 | 290 | unknown [Lotus japonicus] | 0.820 | 0.882 | 0.526 | 2e-69 | |
| 148910484 | 317 | unknown [Picea sitchensis] | 0.862 | 0.848 | 0.443 | 2e-53 | |
| 298204888 | 232 | unnamed protein product [Vitis vinifera] | 0.573 | 0.771 | 0.588 | 1e-50 | |
| 388521805 | 205 | unknown [Lotus japonicus] | 0.570 | 0.868 | 0.562 | 2e-49 | |
| 357164182 | 420 | PREDICTED: uncharacterized protein LOC10 | 0.881 | 0.654 | 0.376 | 3e-47 | |
| 125548727 | 406 | hypothetical protein OsI_16325 [Oryza sa | 0.858 | 0.660 | 0.373 | 1e-46 | |
| 116309908 | 406 | OSIGBa0116M22.10 [Oryza sativa Indica Gr | 0.858 | 0.660 | 0.373 | 1e-46 |
| >gi|225451283|ref|XP_002277975.1| PREDICTED: uncharacterized protein LOC100246931 [Vitis vinifera] gi|147833080|emb|CAN62085.1| hypothetical protein VITISV_035122 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 339 bits (869), Expect = 1e-90, Method: Compositional matrix adjust.
Identities = 180/305 (59%), Positives = 218/305 (71%), Gaps = 19/305 (6%)
Query: 13 QPHYEGRVVPAPGMLRHGPFPGS--PAGHRLLEPLP---LLEDKIAVQAAEIERLARDNH 67
QP +EGR APGM+RHGPFPGS G R LE P + E+K+ Q AEIERLA DNH
Sbjct: 8 QPSFEGRAAQAPGMMRHGPFPGSGHTVGLRSLETAPHPDIAENKMLAQVAEIERLAGDNH 67
Query: 68 RLAASHITMREDLAAAQQEIPRIKAHIRNIHTESDSHIRVLLDKIAKMEADCKAGERLKK 127
RLAA+H +R++L AAQ EI RIKA IR+I TESD IRVL+++IAKME D +AGE +KK
Sbjct: 68 RLAATHGALRQELVAAQHEISRIKAQIRSIETESDIQIRVLMERIAKMEGDIRAGEHVKK 127
Query: 128 DLQQAHIEAQSLARARQELTSKIQQASEALHKARLEVKNLPDLHAELDSLRQEHRRLRAT 187
+LQQAHIEAQSL ARQELT+++QQA++ L KA +VK LP+LHAELDS+ QEH+RLR+T
Sbjct: 128 ELQQAHIEAQSLVTARQELTTQVQQATQELQKANADVKRLPELHAELDSMGQEHQRLRST 187
Query: 188 FEYEKGLNIDNVEQLQAMEKNLVGMAREMEKLHAEVVNAEMRGHAPNPYSRTYTNPIPSY 247
FEYEKGLN+D V ++Q MEKNLV MARE+EKL AEV+NAE R HAPNPYS +Y P
Sbjct: 188 FEYEKGLNVDQVREMQEMEKNLVVMAREVEKLRAEVLNAEKRAHAPNPYSGSYPEPSYPP 247
Query: 248 PPSVQGGGVYVDGYSQPLLQMGVVQTGEGMIPYGSGNGVAAASGVGMPAVPASTVGAVWG 307
QG G Y+D Y +P QM GMIPYGS A+P ++ GA WG
Sbjct: 248 --PTQGSGAYIDSYGRPHAQMIAGTPSAGMIPYGS------------VAIPPASSGAAWG 293
Query: 308 GSYDP 312
G+YDP
Sbjct: 294 GAYDP 298
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224088368|ref|XP_002308428.1| predicted protein [Populus trichocarpa] gi|222854404|gb|EEE91951.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255574613|ref|XP_002528217.1| conserved hypothetical protein [Ricinus communis] gi|223532378|gb|EEF34174.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388512507|gb|AFK44315.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|148910484|gb|ABR18317.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|298204888|emb|CBI34195.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388521805|gb|AFK48964.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|357164182|ref|XP_003579974.1| PREDICTED: uncharacterized protein LOC100844332 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|125548727|gb|EAY94549.1| hypothetical protein OsI_16325 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|116309908|emb|CAH66943.1| OSIGBa0116M22.10 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 312 | ||||||
| TAIR|locus:2033681 | 359 | AT1G67170 "AT1G67170" [Arabido | 0.801 | 0.696 | 0.389 | 6.6e-42 | |
| TAIR|locus:2156146 | 238 | AT5G61920 "AT5G61920" [Arabido | 0.576 | 0.756 | 0.45 | 1.3e-38 | |
| TAIR|locus:2089616 | 331 | AT3G14750 "AT3G14750" [Arabido | 0.785 | 0.740 | 0.328 | 2.3e-32 | |
| TAIR|locus:2035751 | 283 | AT1G55170 "AT1G55170" [Arabido | 0.756 | 0.833 | 0.353 | 3e-30 | |
| TAIR|locus:2060848 | 288 | AT2G30120 [Arabidopsis thalian | 0.653 | 0.708 | 0.299 | 4.8e-23 | |
| UNIPROTKB|F1P4A8 | 1431 | GOLGA3 "Uncharacterized protei | 0.612 | 0.133 | 0.241 | 5.7e-05 | |
| UNIPROTKB|E1BXY6 | 1519 | GOLGA3 "Uncharacterized protei | 0.612 | 0.125 | 0.241 | 6.1e-05 | |
| FB|FBgn0039731 | 472 | sas-6 "spindle assembly abnorm | 0.541 | 0.358 | 0.24 | 0.00011 | |
| UNIPROTKB|H7C110 | 250 | LOC728763 "Protein LOC728763" | 0.544 | 0.68 | 0.25 | 0.00015 | |
| TAIR|locus:2119206 | 779 | AT4G33390 "AT4G33390" [Arabido | 0.560 | 0.224 | 0.226 | 0.00021 |
| TAIR|locus:2033681 AT1G67170 "AT1G67170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 444 (161.4 bits), Expect = 6.6e-42, P = 6.6e-42
Identities = 104/267 (38%), Positives = 156/267 (58%)
Query: 11 RIQP--HYEGRVVPAPGML--------RHGPFPGSPA-----GHRLLEPLPLLEDKIAVQ 55
RI P H+ R +P PG HG P S A +L P ++E K Q
Sbjct: 6 RIHPSHHHMRRPLPGPGGCIAHPETFGNHGAIPPSAAQGVYPSFNMLPPPEVMEQKFVAQ 65
Query: 56 AAEIERLARDNHRLAASHITMREDLAAAQQEIPRIKAHIRNIHTESDSHIRVLLDKIAKM 115
E++RLA +N RL +H ++R++LAAAQ EI + A I ++ +E + + L +K+AKM
Sbjct: 66 HGELQRLAIENQRLGGTHGSLRQELAAAQHEIQMLHAQIGSMKSEREQRMMGLAEKVAKM 125
Query: 116 EADCKAGERLKKDLQQAHIEAQSLARARQELTSKIQQASEALHKARLEVKNLPDLHAELD 175
E + + E +K ++QQA EA+SL AR+EL SK+ Q ++ L K+R +V+ +P L +EL+
Sbjct: 126 ETELQKSEAVKLEMQQARAEARSLVVAREELMSKVHQLTQELQKSRSDVQQIPALMSELE 185
Query: 176 SLRQEHRRLRATFEYEKGLNIDNVEQLQAMEKNLVGMAREMEKLHAEVVN-AEMRGHAPN 234
+LRQE+++ RAT++YEK D++E LQAMEKN + MARE+EKL A+++N A A
Sbjct: 186 NLRQEYQQCRATYDYEKKFYNDHLESLQAMEKNYMTMAREVEKLQAQLMNNANSDRRAGG 245
Query: 235 PYSRTYTNPIPSYPPSVQGGGVYVDGY 261
PY I + G G Y D +
Sbjct: 246 PYGNNINAEIDASGHQ-SGNGYYEDAF 271
|
|
| TAIR|locus:2156146 AT5G61920 "AT5G61920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089616 AT3G14750 "AT3G14750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035751 AT1G55170 "AT1G55170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2060848 AT2G30120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4A8 GOLGA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BXY6 GOLGA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039731 sas-6 "spindle assembly abnormal 6" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C110 LOC728763 "Protein LOC728763" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119206 AT4G33390 "AT4G33390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00061343 | hypothetical protein (298 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 312 | |||
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 6e-05 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 8e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| pfam05478 | 807 | pfam05478, Prominin, Prominin | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-04 | |
| pfam05667 | 536 | pfam05667, DUF812, Protein of unknown function (DU | 8e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.001 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| pfam09755 | 308 | pfam09755, DUF2046, Uncharacterized conserved prot | 0.003 |
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Score = 51.6 bits (124), Expect = 3e-07
Identities = 33/184 (17%), Positives = 81/184 (44%), Gaps = 17/184 (9%)
Query: 48 LEDKIAVQAAEIERLARDNHRLAASHITMREDLAAAQQEIPRIKAHIRNIH---TESDSH 104
L ++ E+E+L ++ L+ +R+DLA + E+ +++ I + TE ++
Sbjct: 703 LRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAE 762
Query: 105 IRVLLDKIAKMEADCKAGER----LKKDLQQAHIEAQSLARARQELTSKIQQASEALHKA 160
I L +++ + E + E L+ ++Q E ++L A EL +++ +E
Sbjct: 763 IEELEERLEEAEEELAEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAANL 822
Query: 161 RLEVKNLPDLHAELDSLRQEHRRLRATFEYEKGLNIDNVEQLQAMEKNLVGMAREMEKLH 220
R +++L + + + L E + E ++++ + + +E+L
Sbjct: 823 RERLESL---ERRIAATERRLEDLEEQIE-------ELSEDIESLAAEIEELEELIEELE 872
Query: 221 AEVV 224
+E+
Sbjct: 873 SELE 876
|
SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1179 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218602 pfam05478, Prominin, Prominin | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218681 pfam05667, DUF812, Protein of unknown function (DUF812) | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150430 pfam09755, DUF2046, Uncharacterized conserved protein H4 (DUF2046) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| PRK11637 | 428 | AmiB activator; Provisional | 99.02 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.43 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.27 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.18 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.12 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.11 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.11 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.08 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.02 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.95 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.93 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.87 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.86 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.74 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.67 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.63 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.63 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.59 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.58 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.56 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.56 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.54 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.51 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.5 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.49 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.42 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.42 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.41 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.39 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.33 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 97.33 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.32 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.3 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.27 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.25 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.24 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.2 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 97.2 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.15 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.12 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.12 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.11 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.09 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.09 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.08 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.08 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.05 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.05 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 97.01 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.01 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.0 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 96.97 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.94 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.92 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.87 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.87 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.86 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.85 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.83 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 96.81 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.8 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.8 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.79 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.76 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.74 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.74 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 96.72 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.72 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 96.69 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.66 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.65 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.6 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 96.6 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.56 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.51 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.5 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.45 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.42 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.39 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 96.38 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 96.38 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.37 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.36 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.35 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.34 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.33 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 96.32 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.32 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.31 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.3 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 96.26 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.24 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.21 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 96.2 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.13 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.13 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 96.06 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.01 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.99 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 95.98 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.98 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 95.95 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 95.94 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.93 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.92 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 95.92 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 95.92 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.9 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 95.89 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.88 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 95.87 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 95.87 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.86 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.8 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 95.78 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.77 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.73 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.73 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 95.73 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.69 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 95.67 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 95.66 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 95.66 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.63 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.63 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 95.61 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 95.56 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 95.55 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 95.55 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 95.54 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 95.52 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 95.51 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 95.51 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 95.5 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.32 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 95.3 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.25 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 95.18 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.11 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 95.1 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.04 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 95.04 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 95.02 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 95.01 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 94.98 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 94.96 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.92 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 94.91 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 94.9 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.89 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.85 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 94.85 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 94.84 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 94.84 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 94.81 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 94.75 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.73 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 94.65 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 94.61 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.61 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 94.57 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 94.56 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 94.53 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 94.51 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.43 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 94.41 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.39 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 94.34 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 94.34 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.33 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.27 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 94.24 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 94.23 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 94.2 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 94.18 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.13 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 94.07 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 94.07 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 94.01 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 93.98 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 93.95 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 93.94 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 93.77 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 93.77 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 93.69 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.66 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 93.63 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 93.62 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 93.57 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 93.54 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 93.52 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 93.5 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 93.49 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 93.47 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 93.45 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 93.43 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 93.41 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 93.41 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 93.41 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.38 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 93.33 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 93.3 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 93.3 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 93.18 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 93.15 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 93.15 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 93.09 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 93.06 | |
| KOG0993 | 542 | consensus Rab5 GTPase effector Rabaptin-5 [Intrace | 93.01 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 92.99 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 92.94 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 92.9 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 92.88 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 92.88 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 92.86 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 92.82 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 92.81 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 92.73 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 92.71 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 92.68 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 92.66 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 92.66 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 92.66 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 92.64 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 92.62 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 92.58 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 92.54 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 92.5 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 92.45 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 92.44 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 92.34 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 92.33 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.19 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 92.19 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 92.13 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 92.1 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 92.1 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 92.1 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 92.09 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 92.09 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 92.06 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 92.02 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 91.91 | |
| KOG3478 | 120 | consensus Prefoldin subunit 6, KE2 family [Posttra | 91.75 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 91.67 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 91.65 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 91.64 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 91.62 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 91.6 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 91.46 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 91.45 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 91.41 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 91.4 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 91.39 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 91.3 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 91.2 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 91.19 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 91.19 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 91.18 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 91.16 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 91.15 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 91.12 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 90.88 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 90.82 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 90.8 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 90.65 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 90.56 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 90.54 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 90.49 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 90.42 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 90.33 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 90.28 | |
| PRK06569 | 155 | F0F1 ATP synthase subunit B'; Validated | 90.28 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 90.25 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 90.21 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 90.02 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 90.01 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 89.99 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 89.99 | |
| PF03915 | 424 | AIP3: Actin interacting protein 3; InterPro: IPR02 | 89.7 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 89.53 | |
| PF05837 | 106 | CENP-H: Centromere protein H (CENP-H); InterPro: I | 89.49 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 89.42 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 89.41 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 89.37 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 89.27 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 89.18 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 89.17 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 89.14 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 89.08 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 89.08 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 89.03 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 88.98 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 88.85 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 88.84 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 88.81 | |
| PRK11546 | 143 | zraP zinc resistance protein; Provisional | 88.77 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 88.69 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 88.68 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 88.67 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 88.66 | |
| PF14817 | 632 | HAUS5: HAUS augmin-like complex subunit 5 | 88.49 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 88.47 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 88.47 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 88.43 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 88.38 | |
| cd00890 | 129 | Prefoldin Prefoldin is a hexameric molecular chape | 88.34 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 88.32 | |
| cd07647 | 239 | F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ | 88.22 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 88.19 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 88.14 | |
| PRK11546 | 143 | zraP zinc resistance protein; Provisional | 88.09 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 88.08 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 88.08 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 87.87 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 87.83 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 87.78 | |
| KOG3478 | 120 | consensus Prefoldin subunit 6, KE2 family [Posttra | 87.77 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 87.71 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 87.69 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 87.43 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 87.29 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 87.29 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 87.15 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 87.08 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 87.07 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 86.93 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 86.9 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 86.78 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 86.77 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 86.67 | |
| KOG4657 | 246 | consensus Uncharacterized conserved protein [Funct | 86.65 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 86.57 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 86.51 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 86.47 | |
| cd07673 | 269 | F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/A | 86.45 | |
| cd07666 | 243 | BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S | 86.39 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 86.18 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 86.15 | |
| PRK14474 | 250 | F0F1 ATP synthase subunit B; Provisional | 86.04 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 85.99 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 85.76 | |
| PRK13453 | 173 | F0F1 ATP synthase subunit B; Provisional | 85.73 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 85.35 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 85.25 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 85.16 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 85.16 | |
| PF13094 | 160 | CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub | 85.1 | |
| PF12761 | 195 | End3: Actin cytoskeleton-regulatory complex protei | 85.06 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 85.0 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 84.99 | |
| PF07139 | 302 | DUF1387: Protein of unknown function (DUF1387); In | 84.78 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 84.73 | |
| smart00806 | 426 | AIP3 Actin interacting protein 3. Aip3p/Bud6p is a | 84.68 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 84.68 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 84.56 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 84.54 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 84.46 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 84.32 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 84.29 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 84.2 | |
| KOG3433 | 203 | consensus Protein involved in meiotic recombinatio | 84.16 | |
| PF12004 | 495 | DUF3498: Domain of unknown function (DUF3498); Int | 84.16 | |
| PF04799 | 171 | Fzo_mitofusin: fzo-like conserved region; InterPro | 84.11 | |
| COG3264 | 835 | Small-conductance mechanosensitive channel [Cell e | 84.05 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 83.96 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 83.87 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 83.79 | |
| cd07672 | 240 | F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin | 83.67 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 83.53 | |
| cd07596 | 218 | BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So | 83.52 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 83.4 | |
| PRK11820 | 288 | hypothetical protein; Provisional | 83.36 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 83.29 | |
| PRK13454 | 181 | F0F1 ATP synthase subunit B'; Provisional | 83.27 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 82.94 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 82.9 | |
| TIGR00255 | 291 | conserved hypothetical protein TIGR00255. The appa | 82.71 | |
| TIGR03321 | 246 | alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. | 82.69 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 82.67 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 82.65 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 82.56 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 82.56 | |
| PRK08475 | 167 | F0F1 ATP synthase subunit B; Validated | 82.52 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 82.42 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 82.32 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 82.31 | |
| PF12072 | 201 | DUF3552: Domain of unknown function (DUF3552); Int | 82.25 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 82.22 | |
| PF06548 | 488 | Kinesin-related: Kinesin-related; InterPro: IPR010 | 82.15 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 82.14 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 82.14 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 82.1 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 81.75 | |
| KOG2077 | 832 | consensus JNK/SAPK-associated protein-1 [Signal tr | 81.7 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 81.7 | |
| PRK06569 | 155 | F0F1 ATP synthase subunit B'; Validated | 81.53 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 81.15 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 81.1 | |
| PF14817 | 632 | HAUS5: HAUS augmin-like complex subunit 5 | 81.1 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 81.06 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 81.04 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 81.0 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 80.55 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 80.49 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 80.45 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 80.33 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 80.32 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 80.31 | |
| TIGR01541 | 332 | tape_meas_lam_C phage tail tape measure protein, l | 80.3 | |
| PF05008 | 79 | V-SNARE: Vesicle transport v-SNARE protein N-termi | 80.28 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 80.13 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 80.12 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 80.11 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 80.09 |
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
Probab=99.02 E-value=3.5e-07 Score=91.03 Aligned_cols=88 Identities=19% Similarity=0.271 Sum_probs=69.3
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhHHHHHHHHHHHHHHHHHHHHHHHhhcHHhHHHH----HHHHHHHHH
Q 021465 136 AQSLARARQELTSKIQQASEALHKARLEVKNLPDLHAELDSLRQEHRRLRATFEYEKGLNIDNVEQL----QAMEKNLVG 211 (312)
Q Consensus 136 ~q~L~~~rqeL~aevq~l~~EL~r~kad~qql~alraELe~LrqElq~~RaaiE~EKk~~~elleq~----qaMEknL~~ 211 (312)
+..|...|++++.++...+++|...+. ++...+++++.+.++++..++.++.+++.+...+.++ +..++.+..
T Consensus 161 l~~i~~~d~~~l~~l~~~~~~L~~~k~---~le~~~~~l~~~~~e~~~~k~~L~~~k~e~~~~l~~L~~~~~~~~~~l~~ 237 (428)
T PRK11637 161 FGYLNQARQETIAELKQTREELAAQKA---ELEEKQSQQKTLLYEQQAQQQKLEQARNERKKTLTGLESSLQKDQQQLSE 237 (428)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 456778899999999999999988886 7788888888888898888888888888877766666 445556777
Q ss_pred HHHHHHHHHHHHHHH
Q 021465 212 MAREMEKLHAEVVNA 226 (312)
Q Consensus 212 marEvekLrAEIana 226 (312)
+.++.++|.+.|+..
T Consensus 238 l~~~~~~L~~~I~~l 252 (428)
T PRK11637 238 LRANESRLRDSIARA 252 (428)
T ss_pred HHHHHHHHHHHHHHH
Confidence 777777777666643
|
|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK06569 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF03915 AIP3: Actin interacting protein 3; InterPro: IPR022782 This entry represents a domain found in yeast actin interacting protein 3 and bud site selection protein 6 | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PRK11546 zraP zinc resistance protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14817 HAUS5: HAUS augmin-like complex subunit 5 | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11546 zraP zinc resistance protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4657 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >cd07673 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 2 protein | Back alignment and domain information |
|---|
| >cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PRK14474 F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13453 F0F1 ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit | Back alignment and domain information |
|---|
| >PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >PF07139 DUF1387: Protein of unknown function (DUF1387); InterPro: IPR009816 This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00806 AIP3 Actin interacting protein 3 | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF12004 DUF3498: Domain of unknown function (DUF3498); InterPro: IPR021887 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF04799 Fzo_mitofusin: fzo-like conserved region; InterPro: IPR006884 This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases | Back alignment and domain information |
|---|
| >COG3264 Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11820 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PRK13454 F0F1 ATP synthase subunit B'; Provisional | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >TIGR00255 conserved hypothetical protein TIGR00255 | Back alignment and domain information |
|---|
| >TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK08475 F0F1 ATP synthase subunit B; Validated | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2077 consensus JNK/SAPK-associated protein-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06569 F0F1 ATP synthase subunit B'; Validated | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF14817 HAUS5: HAUS augmin-like complex subunit 5 | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01541 tape_meas_lam_C phage tail tape measure protein, lambda family | Back alignment and domain information |
|---|
| >PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 312 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 9e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 61.0 bits (148), Expect = 2e-10
Identities = 26/184 (14%), Positives = 72/184 (39%), Gaps = 4/184 (2%)
Query: 48 LEDKIAVQAAEIERLARDNHRLAASHITMREDLAAAQQEIPRIKAHIRNIHTESDSHIRV 107
LE+++ + A ++L + M +D+ + + ++ + +
Sbjct: 960 LEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTN 1019
Query: 108 LLDKIAKMEADCKAGERLKKDLQQAHIEAQSLARARQELTSKIQQASEALHKARLEVKNL 167
L ++ K + K + + + + + + ++RQEL ++ ++ L
Sbjct: 1020 LAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAEL 1079
Query: 168 ----PDLHAELDSLRQEHRRLRATFEYEKGLNIDNVEQLQAMEKNLVGMAREMEKLHAEV 223
+L A+L +E + A E E + +++++ +E ++ + ++E A
Sbjct: 1080 QAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAAR 1139
Query: 224 VNAE 227
AE
Sbjct: 1140 NKAE 1143
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.9 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.61 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.58 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.58 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.5 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.31 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.14 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.12 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.07 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 96.99 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.91 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.65 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.43 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.27 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.16 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.83 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.71 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.54 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 95.45 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 95.38 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 95.2 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 95.08 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.78 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 94.77 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 94.67 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 93.86 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 93.81 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 93.74 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 93.59 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 93.5 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 93.46 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 93.24 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 93.15 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 93.0 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.98 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 92.95 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 92.72 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 92.33 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 92.25 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 92.2 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 92.15 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 91.95 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 91.73 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 91.7 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 91.67 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 91.59 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 91.59 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 91.49 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 91.35 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 91.33 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 91.23 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 90.78 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 90.6 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 89.98 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 89.88 | |
| 3lay_A | 175 | Zinc resistance-associated protein; salmonella typ | 89.18 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 89.17 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 89.16 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 89.05 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 88.99 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 88.98 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.91 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 88.8 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 88.7 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 88.63 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 88.43 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 87.94 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 87.92 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 87.91 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 87.68 | |
| 3lay_A | 175 | Zinc resistance-associated protein; salmonella typ | 87.54 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 87.38 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 87.38 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 87.37 | |
| 1ez3_A | 127 | Syntaxin-1A; three helix bundle, endocytosis/exocy | 86.89 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 86.69 | |
| 2pih_A | 151 | Protein YMCA; regulate community development, stru | 86.67 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 86.55 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 86.43 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 86.18 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 86.01 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 85.37 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 85.36 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 85.33 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 85.16 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 85.08 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 84.99 | |
| 3onj_A | 97 | T-snare VTI1; helix, HABC, protein transport; 1.92 | 84.91 | |
| 3etw_A | 119 | Adhesin A; antiparallel helix-loop-helix, leucine | 84.8 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 84.62 | |
| 2qyw_A | 102 | Vesicle transport through interaction with T-SNAR | 84.57 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 84.57 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 83.95 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 83.29 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 82.34 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 81.67 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 80.62 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 80.57 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 80.34 |
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
Probab=97.90 E-value=0.0012 Score=60.40 Aligned_cols=128 Identities=15% Similarity=0.161 Sum_probs=63.8
Q ss_pred HHHhhhhhhhhhhhhHHHHHHHHHHHHHHhHHHHHHhhhhhchh---hHHHHHHHHHhhhhhHhhhhhHHHHHHHHHHHH
Q 021465 58 EIERLARDNHRLAASHITMREDLAAAQQEIPRIKAHIRNIHTES---DSHIRVLLDKIAKMEADCKAGERLKKDLQQAHI 134 (312)
Q Consensus 58 Ei~~L~~dNqrLa~th~~L~qeL~aaq~Elq~L~~~~~~~~ae~---e~qiR~L~ek~~k~Eaelra~e~lk~EL~q~r~ 134 (312)
+|.+|...=..|......|+.++..++..+..+...+.+++.+. +..|..+.+++.+.+..+..+-.-| |+..+..
T Consensus 19 ~i~~l~~~~~~lp~el~~le~~~~~l~~~~~~~~~~l~d~~~~~~~~e~~i~~~~~ri~~~~~~l~~v~~~k-E~~aL~k 97 (256)
T 3na7_A 19 EIDSLEPLIREKRKDLDKALNDKEAKNKAILNLEEEKLALKLQVSKNEQTLQDTNAKIASIQKKMSEIKSER-ELRSLNI 97 (256)
T ss_dssp HHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSSS-HHHHHHH
T ss_pred HHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCHH-HHHHHHH
Confidence 34444444444555566666666666666666655555555443 5666666677766666543222212 3444444
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhHHHHHHHHHHHHHHHHHHHH
Q 021465 135 EAQSLARARQELTSKIQQASEALHKARLEVKNLPDLHAELDSLRQEHRRLRATFE 189 (312)
Q Consensus 135 e~q~L~~~rqeL~aevq~l~~EL~r~kad~qql~alraELe~LrqElq~~RaaiE 189 (312)
|+..+......|-.++..++..++..+. .+..+.+.++.++.++...++.++
T Consensus 98 Eie~~~~~i~~lE~eile~~e~ie~~~~---~l~~~~~~l~~~~~~l~~~~~~~~ 149 (256)
T 3na7_A 98 EEDIAKERSNQANREIENLQNEIKRKSE---KQEDLKKEMLELEKLALELESLVE 149 (256)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4444444444444444444444444443 333333445555555555554444
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2pih_A Protein YMCA; regulate community development, structural genomics, PSI-2, protein structure initiative; 2.10A {Bacillus subtilis} SCOP: a.281.1.1 | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >3onj_A T-snare VTI1; helix, HABC, protein transport; 1.92A {Saccharomyces cerevisiae} PDB: 3onl_C | Back alignment and structure |
|---|
| >3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >2qyw_A Vesicle transport through interaction with T-SNAR homolog; HABC domain, protein transport, endocytosis; 2.00A {Mus musculus} PDB: 2v8s_V | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 92.05 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 91.96 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 90.78 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 89.19 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 89.05 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 86.92 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 83.64 |
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: BAR/IMD domain-like superfamily: BAR/IMD domain-like family: FCH domain domain: Formin-binding protein 1, FNBP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=92.05 E-value=2.7 Score=34.59 Aligned_cols=17 Identities=6% Similarity=-0.054 Sum_probs=7.5
Q ss_pred hhHHHHHHHHHhhhhhH
Q 021465 101 SDSHIRVLLDKIAKMEA 117 (312)
Q Consensus 101 ~e~qiR~L~ek~~k~Ea 117 (312)
.+...+.+.+...+++.
T Consensus 109 ~~~~~K~~~~~~~k~~k 125 (288)
T d2efla1 109 LKQERKSNFHDGRKAQQ 125 (288)
T ss_dssp HHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHH
Confidence 33344444444444443
|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|