Citrus Sinensis ID: 021488


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MTFPDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCAVPPKKGINSKSRSLPSNKRATSKVTDSAGLGTSNDADNSGAVTSNVAANAGSGTSDVTEHIDLSAVSGKIRRRTCYECGEKGHLSSACLKKTADQTMVTGKVSDNAGSRTGNFADNAGLGTTNVSDNAGLSAVSGKIRRRTCYECGEKGHLSSACPKKTADQTNSTTIQVEQL
cccccccccccEEEEEEccHHHHHHHHHHcccEEccEEEEEcccccccccccccccccccccccEEEEccccccccHHHHHHHcccccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHccccEEccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccEEEEEcccHHHHHHHHHccccccccEEEEEcccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccEEEEEEEEccccccccEEEEEEcccHHHHHHHHHHcccEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccEEEcccEEccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccEccccccccccccccccccccccccEEcccc
mtfpdtgkfrGIAIINFRTEGAVKRALAldgsemdglflkiqpykatkakrtsdftpkivEGYNRIYignlswdiTEEDLKKLFSdckisslrfgtnketgefrgyahvdfsdsLSLSMALKLDqevvrgrpvkiscavppkkginsksrslpsnkratskvtdsaglgtsndadnsgavtsnvaanagsgtsdvtehidlsavsgkirrrtcyecgekghlssaclkktadqtmvtgkvsdnagsrtgnfadnaglgttnvsdnaglsavsgkirrrtcyecgekghlssacpkktadqtnstTIQVEQL
mtfpdtgkfrgiaiinfrteGAVKRALAldgsemdgLFLKIQpykatkakrtsdftpkivegynrIYIGNLSWDITEEDLKKLFSDCKisslrfgtnketgefRGYAHVDFSDSLSLSMALKLDQevvrgrpvkiscavppkkginsksrslpsnkratskvtdsaglgtsndadnsgAVTSNVAAnagsgtsdvtehidlsavsgkirrRTCYEcgekghlssaclkktadQTMVTGkvsdnagsrtgNFADnaglgttnvsdnaglsavsgkirRRTCYEcgekghlssacpkktadqtnsttiqveql
MTFPDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCAVPPKKGINSKSRSLPSNKRATSKVTDSAGLGTSNDADNSGAVTSNVAANAGSGTSDVTEHIDLSAVSGKIRRRTCYECGEKGHLSSACLKKTADQTMVTGKVSDNAGSRTGNFADNAGLGTTNVSDNAGLSAVSGKIRRRTCYECGEKGHLSSACPKKTADQTNSTTIQVEQL
*******KFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCA************************************************************IDLSAVSGKIRRRTCYECGEKGHLSSACLK******************************************VSGKIRRRTCYECG***************************
*T*PDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKI************************IYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVK*********************************************************************************************************************************************************************************
MTFPDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCAVPPKK**********************AGLGTSNDADNSGAVTSNVAANAGSGTSDVTEHIDLSAVSGKIRRRTCYECGEKGHLSSACLKKTADQTMVTGKVSDNAGSRTGNFADNAGLGTTNVSDNAGLSAVSGKIRRRTCYECG***************************
*******KFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPY*****************GYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCAVP********************************DADNSGAVTSNVAANAGS************AVSGKIRRRTCYECGEKGHLSSACL****************************************************CY****KGHLSSACPKK***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFPDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCAVPPKKGINSKSRSLPSNKRATSKVTDSAGLGTSNDADNSGAVTSNVAANAGSGTSDVTEHIDLSAVSGKIRRRTCYECGEKGHLSSACLKKTADQTMVTGKVSDNAGSRTGNFADNAGLGTTNVSDNAGLSAVSGKIRRRTCYECGEKGHLSSACPKKTADQTNSTTIQVEQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
P41891500 Protein gar2 OS=Schizosac yes no 0.424 0.264 0.292 3e-11
P28644233 28 kDa ribonucleoprotein, N/A no 0.414 0.553 0.328 3e-10
Q04836329 31 kDa ribonucleoprotein, no no 0.434 0.410 0.290 2e-09
Q5RC80524 RNA-binding protein 39 OS yes no 0.405 0.240 0.323 8e-09
Q14498530 RNA-binding protein 39 OS yes no 0.405 0.237 0.323 9e-09
Q8VH51530 RNA-binding protein 39 OS yes no 0.405 0.237 0.323 1e-08
Q7XTT4707 Nucleolin 2 OS=Oryza sati no no 0.244 0.107 0.333 1e-08
P19683315 31 kDa ribonucleoprotein, N/A no 0.424 0.419 0.284 2e-08
Q6NVP7296 Polyadenylate-binding pro no no 0.282 0.297 0.325 3e-08
O14369388 Probable RNA-binding prot no no 0.234 0.188 0.405 3e-08
>sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 80/147 (54%), Gaps = 15/147 (10%)

Query: 6   TGKFRGIAIINFRTEGAVKRALALDGS-EMDGLFLKI----------QPYKATKAKRTSD 54
           +G+ +G   ++F T  A K A+A +G+ E+DG  + +          QPY     +R  +
Sbjct: 300 SGRSKGYGYVDFETPEAAKAAVAANGTKEIDGRMVNLDLSNPRPANPQPYAQ---QRAGN 356

Query: 55  FTPKIVEGYNRIYIGNLSWDITEEDLKKLFSDC-KISSLRFGTNKETGEFRGYAHVDFSD 113
           F  ++ E  + +++GNLS++ TE+DL   F  C  I S+R  T+ ++G  +G+ +V FSD
Sbjct: 357 FGDQLSEPSDTVFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSD 416

Query: 114 SLSLSMALKLDQEVVRGRPVKISCAVP 140
             S    ++++   + GRP ++  + P
Sbjct: 417 IDSAKKCVEMNGHFIAGRPCRLDFSTP 443




Helps the assembly of pre-ribosomal particles containing 18S rRNA.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description
>sp|Q04836|ROC3_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=RBP31 PE=1 SV=1 Back     alignment and function description
>sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 Back     alignment and function description
>sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 Back     alignment and function description
>sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 Back     alignment and function description
>sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 Back     alignment and function description
>sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 Back     alignment and function description
>sp|Q6NVP7|PABP2_XENTR Polyadenylate-binding protein 2 OS=Xenopus tropicalis GN=pabpn1 PE=2 SV=1 Back     alignment and function description
>sp|O14369|SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sce3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
255582384 436 Protein gar2, putative [Ricinus communis 0.662 0.472 0.582 6e-73
326531612 740 predicted protein [Hordeum vulgare subsp 0.864 0.363 0.486 1e-72
357129961 620 PREDICTED: uncharacterized protein LOC10 0.858 0.430 0.479 2e-72
115461723 548 Os05g0114500 [Oryza sativa Japonica Grou 0.893 0.507 0.5 2e-72
125550587 548 hypothetical protein OsI_18195 [Oryza sa 0.893 0.507 0.496 8e-72
224112839 442 predicted protein [Populus trichocarpa] 0.665 0.468 0.592 4e-71
225449617 415 PREDICTED: 31 kDa ribonucleoprotein, chl 0.620 0.465 0.575 6e-71
358248652411 uncharacterized protein LOC100814693 [Gl 0.659 0.498 0.604 6e-70
356536490394 PREDICTED: nucleolar protein 13-like [Gl 0.662 0.522 0.593 4e-69
413942254 647 hypothetical protein ZEAMMB73_929566 [Ze 0.913 0.438 0.432 5e-69
>gi|255582384|ref|XP_002531981.1| Protein gar2, putative [Ricinus communis] gi|223528378|gb|EEF30417.1| Protein gar2, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 170/249 (68%), Gaps = 43/249 (17%)

Query: 1   MTFPDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATK---AKRTSDFTP 57
           MTFPD+GKFRGIAII F+TE A KRALALDGS+M G FLKIQPYK T+   AK+ SDF P
Sbjct: 213 MTFPDSGKFRGIAIIGFKTEAAAKRALALDGSDMGGFFLKIQPYKTTRTFQAKKVSDFAP 272

Query: 58  KIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSL 117
           KIVEGYNRIY+GNLSWDITEEDL+K FS CKISS+R+GT+KETGEFRGY HV+FSD+LSL
Sbjct: 273 KIVEGYNRIYVGNLSWDITEEDLRKFFSGCKISSVRWGTDKETGEFRGYGHVEFSDNLSL 332

Query: 118 SMALKLDQEVVRGRPVKISCAVPPKKGINSKSRSLPSNKRATSKVTDSAGLGTSNDADNS 177
            MALKLDQ++V GR +KISCAV P KG    + + P+               T N+ADN 
Sbjct: 333 LMALKLDQQIVCGRAIKISCAV-PMKGAKVHATAAPT--------------ATGNEADNG 377

Query: 178 GAVTSNVAANAGSGTSDVTEHIDLSAVSGKIRRRTCYECGEKGHLSSAC---LKKTADQT 234
                                 +LS VSGK+RRRTCYEC +KGH+S+AC   L   A   
Sbjct: 378 ----------------------ELSTVSGKMRRRTCYECHQKGHVSTACPKVLASAAATD 415

Query: 235 MVTGKVSDN 243
            VT   +DN
Sbjct: 416 TVTANEADN 424




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|326531612|dbj|BAJ97810.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357129961|ref|XP_003566627.1| PREDICTED: uncharacterized protein LOC100837982 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115461723|ref|NP_001054461.1| Os05g0114500 [Oryza sativa Japonica Group] gi|45680441|gb|AAS75242.1| hypothetical protein [Oryza sativa Japonica Group] gi|52353509|gb|AAU44075.1| putative RNA recognition motif (RRM)-containing protein [Oryza sativa Japonica Group] gi|113578012|dbj|BAF16375.1| Os05g0114500 [Oryza sativa Japonica Group] gi|222629967|gb|EEE62099.1| hypothetical protein OsJ_16883 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125550587|gb|EAY96296.1| hypothetical protein OsI_18195 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|224112839|ref|XP_002316306.1| predicted protein [Populus trichocarpa] gi|222865346|gb|EEF02477.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225449617|ref|XP_002279438.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic [Vitis vinifera] gi|296086279|emb|CBI31720.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248652|ref|NP_001240173.1| uncharacterized protein LOC100814693 [Glycine max] gi|255644669|gb|ACU22837.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356536490|ref|XP_003536770.1| PREDICTED: nucleolar protein 13-like [Glycine max] Back     alignment and taxonomy information
>gi|413942254|gb|AFW74903.1| hypothetical protein ZEAMMB73_929566 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
TAIR|locus:2100696597 PHIP1 "phragmoplastin interact 0.922 0.480 0.466 1.2e-63
POMBASE|SPAC140.02500 gar2 "nucleolar protein requir 0.446 0.278 0.290 2.1e-12
TAIR|locus:2157702289 CP31B "chloroplast RNA-binding 0.424 0.456 0.306 4.1e-10
ASPGD|ASPL00000735591290 AN10574 [Emericella nidulans ( 0.408 0.098 0.333 7.8e-10
ZFIN|ZDB-GENE-080709-5192 pabpn1l "poly(A) binding prote 0.350 0.567 0.309 8.4e-10
TAIR|locus:2122009329 RBP31 "AT4G24770" [Arabidopsis 0.443 0.419 0.282 1.9e-09
UNIPROTKB|B4DEH8168 PABPN1 "cDNA FLJ57714, highly 0.315 0.583 0.3 3.9e-09
UNIPROTKB|G3V4T2178 PABPN1 "Polyadenylate-binding 0.315 0.550 0.3 3.9e-09
UNIPROTKB|E1P5S2373 RBM39 "RNA-binding protein 39" 0.469 0.391 0.311 4.7e-09
TAIR|locus:2202740258 AT1G60000 [Arabidopsis thalian 0.418 0.503 0.313 5.3e-09
TAIR|locus:2100696 PHIP1 "phragmoplastin interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 649 (233.5 bits), Expect = 1.2e-63, P = 1.2e-63
 Identities = 152/326 (46%), Positives = 197/326 (60%)

Query:     4 PDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPY-KAT-----KAKRTSDFTP 57
             P+ G F GIA I F TE   KRALA D + M   +L IQ Y K T     + K +S F P
Sbjct:   196 PEDGAFSGIAFITFDTEDGAKRALAFDRAAMGDRYLTIQQYVKTTTPSIPRRKTSSGFAP 255

Query:    58 KIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSL 117
             ++V+GYNR+YIGNL+WD TE D++KLFSDC I+S+R G NKETGEF+GYAHVDF DS+S+
Sbjct:   256 EMVDGYNRVYIGNLAWDTTERDIRKLFSDCVINSVRLGKNKETGEFKGYAHVDFKDSVSV 315

Query:   118 SMALKLDQEVVRGRPVKISCAVPPKKGINSKSRSLPSNKRATSKVTDSAGLGTSNDADNS 177
             ++ALKLDQ+V+ GRPVKI CA+        K R  P+      + T++AG   S + +++
Sbjct:   316 AIALKLDQQVICGRPVKICCAL--------KDR--PATDHTPGE-TNNAG---SYNMEDT 361

Query:   178 GAVTSNVAANAGSGTSDVTEHIDLSAVSGKIRRRTCYECGEKGHLSSAC---LKKTADQT 234
              A    V A AG    D   +   +  S K++RR CYECGEKGHLS+AC   L+K  DQ 
Sbjct:   362 YAAADPVPALAGRSEVDDGNYFATTVSSSKVKRRVCYECGEKGHLSTACPIKLQKADDQA 421

Query:   235 -------MVTGKVSDNAGSRTGNFAD----NAGLGTTNVSDNAGLSAVS---GKIRRRTC 280
                     V G+ +  +     N  D    N    +TN + N G SA +   GK++RR C
Sbjct:   422 NSKLGQETVDGRPAMQSYGLPKNSGDSYYMNETYASTNETYNGGYSASAVGTGKVKRRNC 481

Query:   281 YECGEKGHLSSACPKK--TADQTNST 304
             YECGEKGHLS+ACP K      TNST
Sbjct:   482 YECGEKGHLSTACPIKLQNTSHTNST 507


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003729 "mRNA binding" evidence=IPI
GO:0009920 "cell plate formation involved in plant-type cell wall biogenesis" evidence=IDA
GO:0019898 "extrinsic to membrane" evidence=IDA
POMBASE|SPAC140.02 gar2 "nucleolar protein required for rRNA processing" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2157702 CP31B "chloroplast RNA-binding protein 31B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000073559 AN10574 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080709-5 pabpn1l "poly(A) binding protein, nuclear 1, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2122009 RBP31 "AT4G24770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B4DEH8 PABPN1 "cDNA FLJ57714, highly similar to Poly(A)-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V4T2 PABPN1 "Polyadenylate-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1P5S2 RBM39 "RNA-binding protein 39" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2202740 AT1G60000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 6e-36
smart0036073 smart00360, RRM, RNA recognition motif 7e-17
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 4e-16
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 3e-15
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 5e-15
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 8e-15
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 2e-14
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 3e-14
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-13
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-13
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 3e-13
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 5e-13
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 4e-12
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 4e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-11
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-11
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-11
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2e-10
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 6e-10
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-09
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 3e-09
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 3e-09
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 6e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 9e-09
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 1e-08
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 2e-08
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 2e-08
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 3e-08
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 3e-08
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 4e-08
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 6e-08
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-07
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 2e-07
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 3e-07
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 4e-07
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 5e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 6e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 8e-07
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 8e-07
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 1e-06
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-06
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-06
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 2e-06
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 2e-06
cd1250272 cd12502, RRM2_RMB19, RNA recognition motif 2 in RN 2e-06
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-06
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 2e-06
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 3e-06
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 3e-06
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 3e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 4e-06
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 5e-06
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 5e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-06
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 6e-06
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 9e-06
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 9e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-05
cd1262577 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in 1e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-05
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 2e-05
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-05
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-05
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 3e-05
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 3e-05
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 4e-05
cd1228192 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 5e-05
cd1272979 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recogniti 5e-05
cd1262677 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in 5e-05
cd1264490 cd12644, RRM_CFIm59, RNA recognition motif of pre- 6e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 6e-05
cd1262777 cd12627, RRM1_IGF2BP3, RNA recognition motif 1 in 8e-05
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 9e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 9e-05
cd1264377 cd12643, RRM_CFIm68, RNA recognition motif of pre- 9e-05
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-04
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 1e-04
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 1e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 1e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-04
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-04
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 2e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 2e-04
smart0036073 smart00360, RRM, RNA recognition motif 3e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 4e-04
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 5e-04
cd1251473 cd12514, RRM4_RBM12_like, RNA recognition motif 4 5e-04
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 5e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 6e-04
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 7e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 8e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 8e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 9e-04
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 0.001
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 0.001
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 0.001
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 0.001
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.001
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 0.001
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 0.001
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 0.001
cd1239685 cd12396, RRM1_Nop13p_fungi, RNA recognition motif 0.001
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 0.002
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 0.002
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 0.002
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 0.002
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.002
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.002
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.002
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 0.002
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 0.002
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.003
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.003
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 0.003
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 0.003
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.003
cd1250377 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition m 0.003
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.003
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 0.004
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 0.004
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.004
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 0.004
pfam0009818 pfam00098, zf-CCHC, Zinc knuckle 0.004
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
 Score =  123 bits (311), Expect = 6e-36
 Identities = 41/72 (56%), Positives = 58/72 (80%)

Query: 65  RIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLD 124
            +YIGNL+WDITE+D+++ F  C+I+S+R  T+KETGEF+G+ HVDF+D  SL  ALKLD
Sbjct: 1   TVYIGNLAWDITEDDVREFFKGCEITSVRLATDKETGEFKGFGHVDFADEESLDAALKLD 60

Query: 125 QEVVRGRPVKIS 136
             V+ GRP++I+
Sbjct: 61  GTVLCGRPIRIA 72


The CD corresponds to the RRM2 of PHIP1. A. thaliana PHIP1 and its homologs represent a novel class of plant-specific RNA-binding proteins that may play a unique role in the polarized mRNA transport to the vicinity of the cell plate. The family members consist of multiple functional domains, including a lysine-rich domain (KRD domain) that contains three nuclear localization motifs (KKKR/NK), two RNA recognition motifs (RRMs), and three CCHC-type zinc fingers. PHIP1 is a peripheral membrane protein and is localized at the cell plate during cytokinesis in plants. In addition to phragmoplastin, PHIP1 interacts with two Arabidopsis small GTP-binding proteins, Rop1 and Ran2. However, PHIP1 interacted only with the GTP-bound form of Rop1 but not the GDP-bound form. It also binds specifically to Ran2 mRNA. . Length = 72

>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|240946 cd12502, RRM2_RMB19, RNA recognition motif 2 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241069 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241173 cd12729, RRM1_hnRNPH_hnRNPH2_hnRNPF, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP H , hnRNP H2, hnRNP F and similar proteins Back     alignment and domain information
>gnl|CDD|241070 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2) Back     alignment and domain information
>gnl|CDD|241088 cd12644, RRM_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241071 cd12627, RRM1_IGF2BP3, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3) Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241087 cd12643, RRM_CFIm68, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding protein RBM12, RBM12B and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240842 cd12396, RRM1_Nop13p_fungi, RNA recognition motif 1 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240947 cd12503, RRM1_hnRNPH_GRSF1_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.91
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.9
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.9
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.88
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.88
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.87
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.85
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.84
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.83
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.81
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.81
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.8
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.79
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.79
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.79
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.79
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.78
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.76
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.74
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.73
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.72
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.72
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.71
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.7
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.7
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.7
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.69
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.67
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.66
PTZ00368148 universal minicircle sequence binding protein (UMS 99.65
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.65
PTZ00368148 universal minicircle sequence binding protein (UMS 99.63
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.58
KOG0122270 consensus Translation initiation factor 3, subunit 99.57
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.55
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.51
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.5
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.5
COG5082190 AIR1 Arginine methyltransferase-interacting protei 99.49
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.46
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.42
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.42
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.42
PLN03120260 nucleic acid binding protein; Provisional 99.41
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.39
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.38
KOG4207256 consensus Predicted splicing factor, SR protein su 99.38
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.36
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.36
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.35
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.35
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.33
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.29
PLN03121243 nucleic acid binding protein; Provisional 99.29
PLN03213 759 repressor of silencing 3; Provisional 99.29
smart0036272 RRM_2 RNA recognition motif. 99.26
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.24
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.23
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.23
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.23
smart0036071 RRM RNA recognition motif. 99.2
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.17
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.15
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.15
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.12
KOG4400261 consensus E3 ubiquitin ligase interacting with arg 99.09
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.09
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.06
COG5082190 AIR1 Arginine methyltransferase-interacting protei 99.04
smart0036170 RRM_1 RNA recognition motif. 98.99
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.97
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.96
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 98.95
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.92
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.9
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 98.9
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 98.9
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.9
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.89
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 98.86
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.85
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.84
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.84
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.83
KOG4400261 consensus E3 ubiquitin ligase interacting with arg 98.8
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.8
KOG4210285 consensus Nuclear localization sequence binding pr 98.79
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.77
KOG0226290 consensus RNA-binding proteins [General function p 98.75
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.75
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.73
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.68
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.68
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.65
smart0036170 RRM_1 RNA recognition motif. 98.62
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.62
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.59
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.54
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.48
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.47
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.45
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.43
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.37
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 98.35
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.34
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.32
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.32
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.26
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 98.26
KOG4207256 consensus Predicted splicing factor, SR protein su 98.24
KOG0126219 consensus Predicted RNA-binding protein (RRM super 98.23
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.22
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.22
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 98.18
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.15
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 98.14
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.1
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.09
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.04
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.03
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 98.02
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.0
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 97.99
smart0036071 RRM RNA recognition motif. 97.97
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.91
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.82
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 97.81
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.8
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.8
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 97.79
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 97.77
KOG0226290 consensus RNA-binding proteins [General function p 97.76
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 97.73
PF1369632 zf-CCHC_2: Zinc knuckle 97.71
PLN03120260 nucleic acid binding protein; Provisional 97.64
KOG0151 877 consensus Predicted splicing regulator, contains R 97.56
smart0036272 RRM_2 RNA recognition motif. 97.49
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.43
PLN03213 759 repressor of silencing 3; Provisional 97.42
PLN03121243 nucleic acid binding protein; Provisional 97.42
KOG0121153 consensus Nuclear cap-binding protein complex, sub 97.36
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 97.3
PF1369632 zf-CCHC_2: Zinc knuckle 97.24
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.17
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.17
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 97.05
KOG0114124 consensus Predicted RNA-binding protein (RRM super 96.89
smart0034326 ZnF_C2HC zinc finger. 96.86
PF1391742 zf-CCHC_3: Zinc knuckle 96.85
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 96.8
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.76
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 96.75
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.69
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.62
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.6
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 96.56
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.49
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 96.31
KOG1855484 consensus Predicted RNA-binding protein [General f 96.23
KOG3152278 consensus TBP-binding protein, activator of basal 96.21
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 96.03
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 95.83
smart0034326 ZnF_C2HC zinc finger. 95.74
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.6
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 95.53
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 95.28
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 95.25
PF1391742 zf-CCHC_3: Zinc knuckle 95.22
KOG0129520 consensus Predicted RNA-binding protein (RRM super 95.16
KOG2314 698 consensus Translation initiation factor 3, subunit 95.15
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 94.85
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 94.82
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 94.71
PF1439249 zf-CCHC_4: Zinc knuckle 94.55
KOG0119 554 consensus Splicing factor 1/branch point binding p 94.54
KOG0119 554 consensus Splicing factor 1/branch point binding p 94.44
KOG1996378 consensus mRNA splicing factor [RNA processing and 94.43
PF1528840 zf-CCHC_6: Zinc knuckle 93.83
COG5222 427 Uncharacterized conserved protein, contains RING Z 93.64
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 93.44
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.37
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.26
KOG2314 698 consensus Translation initiation factor 3, subunit 93.0
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.83
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 92.41
KOG0153377 consensus Predicted RNA-binding protein (RRM super 92.35
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 92.3
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 92.25
KOG1995351 consensus Conserved Zn-finger protein [General fun 92.2
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 91.88
PF1439249 zf-CCHC_4: Zinc knuckle 91.64
PF1528840 zf-CCHC_6: Zinc knuckle 91.51
COG5222 427 Uncharacterized conserved protein, contains RING Z 91.29
KOG0533243 consensus RRM motif-containing protein [RNA proces 90.94
KOG2591 684 consensus c-Mpl binding protein, contains La domai 90.36
KOG0314 448 consensus Predicted E3 ubiquitin ligase [Posttrans 89.6
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 89.51
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 88.93
KOG2068327 consensus MOT2 transcription factor [Transcription 88.89
KOG4660549 consensus Protein Mei2, essential for commitment t 88.73
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 88.29
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 86.26
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 85.24
PF15023166 DUF4523: Protein of unknown function (DUF4523) 84.57
PF0753068 PRE_C2HC: Associated with zinc fingers; InterPro: 84.0
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 83.69
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 83.24
KOG2135526 consensus Proteins containing the RNA recognition 81.34
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=99.91  E-value=8.9e-24  Score=190.37  Aligned_cols=133  Identities=26%  Similarity=0.358  Sum_probs=117.3

Q ss_pred             CccCCCCCccceEEEEeCCHHHHHHHHH-cCCCCcCCeeEEEEECcccccccCCCCCCCCcCCCCEEEEcCCCCCCCHHH
Q 021488            1 MTFPDTGKFRGIAIINFRTEGAVKRALA-LDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEED   79 (311)
Q Consensus         1 i~d~~tg~skG~afV~F~~~~~A~~Al~-l~g~~~~g~~i~V~~~~~~~~~~~~~~~~~~~~~~~~l~V~~L~~~~t~~~   79 (311)
                      |+|..||+++|||||+|.++++|++||+ |++..|.+++|+|..+.+...          .....+|||.|||+++++++
T Consensus       140 ~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~gr~i~V~~a~p~~~----------~~~~~~lfV~nLp~~vtee~  209 (346)
T TIGR01659       140 MRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVRNKRLKVSYARPGGE----------SIKDTNLYVTNLPRTITDDQ  209 (346)
T ss_pred             EecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccCCceeeeeccccccc----------ccccceeEEeCCCCcccHHH
Confidence            3678899999999999999999999995 999999999999987654321          12346899999999999999


Q ss_pred             HHhhccC-CceeEEEEeecCCCCCceeEEEEEecCHHHHHHHH-hcCCceeCC--eEeEEEEcCCCCC
Q 021488           80 LKKLFSD-CKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMAL-KLDQEVVRG--RPVKISCAVPPKK  143 (311)
Q Consensus        80 l~~~f~~-g~i~~i~v~~~~~~~~~~G~afV~f~~~~~a~~al-~l~~~~i~g--~~i~v~~a~~~~~  143 (311)
                      |+++|++ |.|..+.|+.++.+++++|||||+|.+.++|.+|| .|++..+.+  +.|+|.++..+..
T Consensus       210 L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~~~g~~~~l~V~~a~~~~~  277 (346)
T TIGR01659       210 LDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKREEAQEAISALNNVIPEGGSQPLTVRLAEEHGK  277 (346)
T ss_pred             HHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCHHHHHHHHHHhCCCccCCCceeEEEEECCcccc
Confidence            9999999 99999999999999999999999999999999999 799998865  6899999876543



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07530 PRE_C2HC: Associated with zinc fingers; InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
2jwn_A124 Solution Nmr Structure Of The Protease-Resistent Do 3e-08
3ucg_A89 Crystal Structure Of A Rna Binding Domain Of Hypoth 2e-07
3b4d_A96 Crystal Structure Of Human Pabpn1 Rrm Length = 96 2e-07
2dng_A103 Solution Structure Of Rna Binding Domain In Eukaryo 4e-07
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 1e-06
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 2e-05
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 5e-05
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 6e-05
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 7e-05
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-04
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 3e-04
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 4e-04
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 4e-04
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 4e-04
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 7e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 8e-04
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 8e-04
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 8e-04
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 8e-04
>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 Back     alignment and structure

Iteration: 1

Score = 55.8 bits (133), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 28/86 (32%), Positives = 51/86 (59%), Gaps = 1/86 (1%) Query: 66 IYIGNLSWDITEEDLKKLFSDC-KISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLD 124 +Y+GN+ + T +DL+ FS C I+ + +K +G +GYA+++F++ S+ A+ +D Sbjct: 39 VYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMD 98 Query: 125 QEVVRGRPVKISCAVPPKKGINSKSR 150 + V RGR +K+ GI+S R Sbjct: 99 ETVFRGRTIKVLPKRTNMPGISSTDR 124
>pdb|3UCG|A Chain A, Crystal Structure Of A Rna Binding Domain Of Hypothetical Polyadenylate-Binding Protein (Pabpn1) From Homo Sapiens At 1.95 A Resolution Length = 89 Back     alignment and structure
>pdb|3B4D|A Chain A, Crystal Structure Of Human Pabpn1 Rrm Length = 96 Back     alignment and structure
>pdb|2DNG|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 4h Length = 103 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-29
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 8e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-27
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-27
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-04
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-26
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-04
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-25
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-16
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-25
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-14
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-22
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 4e-05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-22
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-22
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 4e-22
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-22
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 6e-14
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-21
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-04
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-19
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-11
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-19
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 7e-19
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-15
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-11
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-17
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-16
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-12
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-14
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-17
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-16
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-16
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-16
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-16
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-16
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 6e-16
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 6e-16
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 8e-16
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 9e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-15
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-15
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-15
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-15
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-15
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-15
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 3e-15
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-15
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 5e-15
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-04
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 5e-15
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 6e-15
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 6e-15
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 6e-15
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 7e-15
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 8e-15
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 9e-15
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-14
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-14
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-14
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-14
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-14
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 3e-14
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 8e-04
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-14
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 7e-11
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-14
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-14
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-14
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-14
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-14
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 5e-14
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 7e-14
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 7e-14
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-14
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 8e-14
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 8e-14
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-13
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-13
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 9e-04
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-13
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-13
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-13
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-13
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-13
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 4e-13
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-13
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 7e-13
2cph_A107 RNA binding motif protein 19; RNA recognition moti 8e-13
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-12
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-12
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-12
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-12
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-12
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 3e-12
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 3e-12
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 4e-12
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-12
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 4e-12
2cpj_A99 Non-POU domain-containing octamer-binding protein; 6e-12
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 8e-12
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 8e-12
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 8e-12
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 9e-12
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-11
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 7e-11
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-11
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-11
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-11
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-11
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 9e-08
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 5e-11
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 7e-11
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-06
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-11
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 8e-11
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 8e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-10
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-10
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-10
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-10
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-10
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-05
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-10
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-10
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-10
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-10
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 6e-10
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 6e-10
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 1e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 6e-10
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 8e-10
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 8e-10
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 9e-10
2div_A99 TRNA selenocysteine associated protein; structural 1e-09
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-09
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-09
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-05
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-09
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-09
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-09
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-09
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 5e-09
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-09
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 7e-09
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 7e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 9e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 9e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-08
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-08
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 1e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-08
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-08
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-08
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-08
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 7e-08
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 9e-08
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 1e-07
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 1e-07
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-07
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-07
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 2e-07
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-07
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-07
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-07
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-06
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-06
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-06
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 4e-06
1x5p_A97 Negative elongation factor E; structure genomics, 4e-06
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 6e-06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 7e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 4e-04
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 8e-04
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
 Score =  106 bits (267), Expect = 3e-29
 Identities = 26/96 (27%), Positives = 47/96 (48%)

Query: 49  AKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLKKLFSDCKISSLRFGTNKETGEFRGYAH 108
               S       E     Y+GNL ++  + D+  +F D  I S+R   +K+T +F+G+ +
Sbjct: 1   GSSGSSGKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCY 60

Query: 109 VDFSDSLSLSMALKLDQEVVRGRPVKISCAVPPKKG 144
           V+F +  SL  AL  D  ++  R +++  A   K+ 
Sbjct: 61  VEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQD 96


>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.93
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.92
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.92
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.92
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.92
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.92
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.91
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.91
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.91
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.91
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.89
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.89
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.88
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.88
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.87
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.86
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.85
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.85
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.84
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.83
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.83
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.79
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.78
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.77
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 99.76
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.76
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.75
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.74
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.74
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.74
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.74
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.73
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.73
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.73
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.73
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.73
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.73
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.72
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.72
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.72
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.72
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.72
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.72
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.72
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.72
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.71
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.71
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.71
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.71
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.71
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.71
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.71
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.7
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.7
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.7
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.7
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.7
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.7
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.7
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.7
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.7
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.7
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.7
2div_A99 TRNA selenocysteine associated protein; structural 99.7
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.7
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.69
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.69
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.69
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.69
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.69
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.69
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.69
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.69
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.69
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.69
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.68
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.68
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.68
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.68
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.68
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.68
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.68
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.68
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.68
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.67
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.67
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.67
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.67
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.67
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.67
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.67
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.67
2dis_A109 Unnamed protein product; structural genomics, RRM 99.67
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.66
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.66
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.66
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.66
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.66
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.66
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.66
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.66
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.66
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 99.66
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.65
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.65
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.65
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.65
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.65
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.65
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.64
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.64
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.64
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.64
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.64
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.64
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.64
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.64
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.64
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.64
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.63
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.63
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.63
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.63
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.62
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.62
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 99.62
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.62
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.62
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.62
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.62
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.62
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.61
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.61
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.61
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.61
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.61
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.61
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.61
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.61
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.6
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.6
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.6
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.6
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.6
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.59
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.59
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.38
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 99.59
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.59
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.59
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.58
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.58
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.58
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.58
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.58
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.57
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.57
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.57
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.57
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.56
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.56
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.56
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.56
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.55
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.55
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.54
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.54
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.54
1x5p_A97 Negative elongation factor E; structure genomics, 99.54
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.53
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.53
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.53
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.52
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.52
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.51
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.51
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.51
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.5
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.5
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 99.5
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.5
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.49
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 99.49
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.48
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 99.48
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 99.46
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.46
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.45
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.45
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.45
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.44
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.44
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.44
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 99.44
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.41
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 99.4
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.4
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.38
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 99.38
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.37
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.35
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.35
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.3
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.29
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 99.27
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.27
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.27
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.27
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.25
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.24
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.23
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 99.21
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.15
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.09
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 99.04
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.01
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.94
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 98.93
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.9
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.9
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 98.89
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 98.89
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.88
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.88
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 98.87
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.87
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 98.86
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.86
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.84
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 98.83
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.82
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.82
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.8
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.79
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.78
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.78
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 98.78
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.77
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 98.77
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.77
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.77
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 98.76
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.74
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.74
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.74
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.74
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.74
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.73
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.73
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.73
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.73
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.72
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.71
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.71
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.71
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.71
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.71
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.71
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.7
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.7
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.69
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.69
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.69
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.69
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.69
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.68
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.68
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.67
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.67
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.66
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.66
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.65
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.65
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.65
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.65
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.65
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.64
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.64
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.63
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.63
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.63
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.63
2dis_A109 Unnamed protein product; structural genomics, RRM 98.62
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.62
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.62
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.61
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.61
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.61
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.61
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.61
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.6
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.6
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.6
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.6
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.6
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.6
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.6
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.59
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.58
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.58
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.58
2div_A99 TRNA selenocysteine associated protein; structural 98.57
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.57
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.57
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 98.57
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.56
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.56
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.56
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.56
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.56
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.55
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.54
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.54
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.53
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.53
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.52
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.51
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.51
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.51
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.51
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.5
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.5
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.49
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.49
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.48
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.48
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.48
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.48
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.47
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.47
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.46
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.46
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.45
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.84
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.45
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.43
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.41
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.41
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 98.41
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.4
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.4
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.37
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.36
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.35
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.34
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.33
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 98.33
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.33
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.32
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.28
1x5p_A97 Negative elongation factor E; structure genomics, 98.28
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.28
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.27
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.27
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.25
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.25
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 98.24
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.23
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 98.22
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.22
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 98.2
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.19
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.17
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.17
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.16
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.16
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.16
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.14
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.13
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.1
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.08
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.08
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.08
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.08
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.07
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.07
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.07
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.07
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.06
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.06
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.05
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.05
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.04
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.02
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.02
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 98.01
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.0
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 97.99
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 97.98
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.98
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 97.98
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 97.97
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 97.88
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 97.88
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.77
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 97.75
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 97.75
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 97.61
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.6
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 97.37
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.27
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.26
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.24
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 96.92
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.79
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.62
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.17
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 96.04
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.8
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 95.76
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 94.91
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.9
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 94.83
2i2y_A150 Fusion protein consists of immunoglobin G- binding 94.38
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 91.79
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 89.65
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 87.16
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
Probab=99.93  E-value=4.6e-25  Score=183.63  Aligned_cols=139  Identities=22%  Similarity=0.363  Sum_probs=116.4

Q ss_pred             ccCCCCCccceEEEEeCCHHHHHHHHHcCCCCcCCeeEEEEECcccccccCCCCCCCCcCCCCEEEEcCCCCCCCHHHHH
Q 021488            2 TFPDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLK   81 (311)
Q Consensus         2 ~d~~tg~skG~afV~F~~~~~A~~Al~l~g~~~~g~~i~V~~~~~~~~~~~~~~~~~~~~~~~~l~V~~L~~~~t~~~l~   81 (311)
                      +++.+|+++|||||+|.+.++|.+||++++..|.|+.|.|..+.......    .+....+..+|||+|||+++++++|+
T Consensus        47 ~~~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~g~~l~v~~~~~~~~~~----~~~~~~~~~~l~V~nLp~~~t~~~l~  122 (196)
T 1l3k_A           47 RDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ----RPGAHLTVKKIFVGGIKEDTEEHHLR  122 (196)
T ss_dssp             ECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEECCC---------------CCSEEEEECCTTTCCHHHHH
T ss_pred             EcCCCCCccceEEEEeCCHHHHHHHHhcCCCEECCEEeeeecccCccccc----ccccCCCcceEEEeCCCCCCCHHHHH
Confidence            56789999999999999999999999999999999999999876543321    12223456899999999999999999


Q ss_pred             hhccC-CceeEEEEeecCCCCCceeEEEEEecCHHHHHHHHhcCCceeCCeEeEEEEcCCCCCC
Q 021488           82 KLFSD-CKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCAVPPKKG  144 (311)
Q Consensus        82 ~~f~~-g~i~~i~v~~~~~~~~~~G~afV~f~~~~~a~~al~l~~~~i~g~~i~v~~a~~~~~~  144 (311)
                      ++|+. |.|..+.|+.++.++.++|||||+|.+.++|.+|+..++..|+|+.|.|.++.++...
T Consensus       123 ~~F~~~G~i~~v~i~~~~~~g~~~g~afV~F~~~~~A~~A~~~~~~~~~G~~i~v~~a~~k~~~  186 (196)
T 1l3k_A          123 DYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEM  186 (196)
T ss_dssp             HHHTTTSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHCSCCEETTEECEEEECC-----
T ss_pred             HHHhcCCCeEEEEEeecCCCCCccceEEEEECCHHHHHHHHHhCCcEECCEEEEEEecCChhHh
Confidence            99999 9999999999998999999999999999999999966899999999999999987764



>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 7e-16
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-15
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 0.002
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 6e-15
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-10
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-15
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-04
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 8e-15
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-13
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-13
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 5e-13
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 5e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-12
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-12
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-12
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-12
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-12
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-12
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 5e-12
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-04
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-11
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-11
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-11
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 6e-11
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 7e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 8e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 9e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-10
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-10
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-10
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-10
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-10
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-10
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 6e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 7e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 9e-10
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-09
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-09
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 3e-09
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-09
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-09
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 7e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-08
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-08
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 4e-08
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 9e-08
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-07
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-07
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-07
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 9e-07
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-06
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 1e-06
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-06
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-06
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 3e-06
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 2e-05
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-05
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 3e-05
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 4e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 4e-05
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 5e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 6e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-04
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 5e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 0.004
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Heterogeneous nuclear ribonucleoproteins A2/B1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.1 bits (171), Expect = 7e-16
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 61  EGYNRIYIGNLSWDITEEDLKKLFSDC-KISSLRFGTNKETGEFRGYAHVDFSDSLSLSM 119
           E + +++IG LS++ TEE L+  +    K++      +  +   RG+  V FS    +  
Sbjct: 18  EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDA 77

Query: 120 ALKLDQEVVRGRPVKISCAVP 140
           A+      + GR V+   AV 
Sbjct: 78  AMAARPHSIDGRVVEPKRAVA 98


>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.9
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.8
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.8
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.79
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.79
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.79
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.78
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.78
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.78
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.78
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.77
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.77
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.75
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.75
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.75
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.75
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.75
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.74
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.74
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.74
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.74
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.74
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.74
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.74
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.73
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.72
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.72
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.71
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.71
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.71
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.69
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.69
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.68
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.68
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.68
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.67
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.66
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.66
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.65
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.65
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.65
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.65
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.65
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.64
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.64
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.64
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.64
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.63
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.63
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.63
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.63
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.63
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.63
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.61
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.61
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.6
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.6
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.6
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.6
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.59
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.59
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.58
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.57
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.56
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.54
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.53
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 99.53
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.46
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.45
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.36
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.3
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.29
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.26
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.26
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.26
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.08
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.0
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.96
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.95
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.95
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.94
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.94
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 98.93
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.92
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.92
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.91
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.9
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.9
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.89
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.89
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.89
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.89
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.89
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.85
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.84
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.83
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.82
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.82
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.82
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.81
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.8
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.8
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.79
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.79
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.79
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.77
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.77
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.77
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.76
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.76
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.75
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.74
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.74
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.73
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.71
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.71
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.7
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.67
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.65
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.63
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.6
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.58
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.56
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.56
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.55
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.55
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.54
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.53
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.51
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.51
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.5
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.5
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.5
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.49
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.48
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.48
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.47
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.45
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.43
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.41
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.35
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 98.35
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.34
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.33
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.32
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.31
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.27
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 98.25
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.24
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.19
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.19
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.12
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.04
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.0
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.99
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 97.97
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.94
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.93
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 97.93
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 97.91
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 97.88
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 97.78
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.7
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.31
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 97.21
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 97.21
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 97.16
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.12
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.99
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 96.93
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 96.45
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 90.86
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 90.43
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 89.39
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 84.33
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 83.7
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 81.93
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=7.3e-23  Score=166.85  Aligned_cols=137  Identities=22%  Similarity=0.374  Sum_probs=120.3

Q ss_pred             ccCCCCCccceEEEEeCCHHHHHHHHHcCCCCcCCeeEEEEECcccccccCCCCCCCCcCCCCEEEEcCCCCCCCHHHHH
Q 021488            2 TFPDTGKFRGIAIINFRTEGAVKRALALDGSEMDGLFLKIQPYKATKAKRTSDFTPKIVEGYNRIYIGNLSWDITEEDLK   81 (311)
Q Consensus         2 ~d~~tg~skG~afV~F~~~~~A~~Al~l~g~~~~g~~i~V~~~~~~~~~~~~~~~~~~~~~~~~l~V~~L~~~~t~~~l~   81 (311)
                      ++..+|+++|||||+|.+.++|.+|+.+++..+..+.+.+...........    .......++|||+|||+.+|+++|+
T Consensus        40 ~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~i~V~~lp~~~te~~L~  115 (183)
T d1u1qa_          40 RDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQR----PGAHLTVKKIFVGGIKEDTEEHHLR  115 (183)
T ss_dssp             ECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEECCCTTGGGS----TTTTCCCSEEEEECCCTTCCHHHHH
T ss_pred             ecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhhhhcccccc----cccccccceeEEccCCCcCCHHHHh
Confidence            567899999999999999999999999989999999888876654443221    2233456799999999999999999


Q ss_pred             hhccC-CceeEEEEeecCCCCCceeEEEEEecCHHHHHHHHhcCCceeCCeEeEEEEcCCCC
Q 021488           82 KLFSD-CKISSLRFGTNKETGEFRGYAHVDFSDSLSLSMALKLDQEVVRGRPVKISCAVPPK  142 (311)
Q Consensus        82 ~~f~~-g~i~~i~v~~~~~~~~~~G~afV~f~~~~~a~~al~l~~~~i~g~~i~v~~a~~~~  142 (311)
                      ++|.. |.|..+.|+.+..++.++|||||+|.+.++|.+|+++++..|.|+.|+|.+|.++.
T Consensus       116 ~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~~~~~~~~G~~i~V~~A~~k~  177 (183)
T d1u1qa_         116 DYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQ  177 (183)
T ss_dssp             HHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHTSSCEEETTEEEEEEECCCHH
T ss_pred             hhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHHhCCCeECCEEEEEEecCCcc
Confidence            99999 99999999999999999999999999999999999888899999999999987653



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure