Citrus Sinensis ID: 021611


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWSSV
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccc
ccccHHHEHHcHHHHccccccHHHHHHHHHHHHHEEEEEEEccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccc
mtgtfgalsLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQhvlkptinpplysfhrslltskaplsvqthinslfstprghylqnraptftrrlfipsvsgiwdaltggnnnsREAVVAIRRGMLLFRQgdvvgsvaefdkaieldprQKAYLWQRGLSLYYLDRFEEGAEQFRIDvaqnpndteESIWCFLCEAQLYGVDEARNRflevgrdprpvMREAYnmfkgggdpEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAAcespygqrsDDYMAALAKVHSLCRNWSSV
mtgtfgalslsqTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINslfstprghYLQNRAPTFTRRLFIPSVSGIWDaltggnnnsREAVVAIRRGMLLFRQGDVVGSVAEFdkaieldprqkayLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRflevgrdprpvMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSlcrnwssv
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWSSV
******************TQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRN****
***TFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRS*LT****LSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWS**
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWSSV
****F*ALSLS*TYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWSS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGTFGALSLSQTYQKSRTQLPKILHLHQLYYYKFCIFFQFTSMALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINSLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWSSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query310 2.2.26 [Sep-21-2011]
Q1CM50294 Lipoprotein NlpI OS=Yersi yes no 0.241 0.255 0.306 0.0007
Q7CKI5294 Lipoprotein NlpI OS=Yersi yes no 0.241 0.255 0.306 0.0007
Q1C3L9294 Lipoprotein NlpI OS=Yersi yes no 0.241 0.255 0.306 0.0007
>sp|Q1CM50|NLPI_YERPN Lipoprotein NlpI OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nlpI PE=3 SV=1 Back     alignment and function desciption
 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%)

Query: 131 GMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPN 190
           G+ L + G+   +   FD  +ELDP        RG++LYY  RF    +  +     +PN
Sbjct: 103 GIYLTQAGNFDAAYEAFDSVLELDPTYNYARLNRGIALYYGGRFPLAQDDLQAFYQDDPN 162

Query: 191 DTEESIWCFLCEAQL 205
           D   S+W +L E ++
Sbjct: 163 DPFRSLWLYLVEREI 177




May be involved in cell division. May play a role in bacterial septation or regulation of cell wall degradation during cell division.
Yersinia pestis bv. Antiqua (strain Nepal516) (taxid: 377628)
>sp|Q7CKI5|NLPI_YERPE Lipoprotein NlpI OS=Yersinia pestis GN=nlpI PE=3 SV=1 Back     alignment and function description
>sp|Q1C3L9|NLPI_YERPA Lipoprotein NlpI OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nlpI PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
224125100271 predicted protein [Populus trichocarpa] 0.858 0.981 0.770 1e-115
449454057267 PREDICTED: uncharacterized protein LOC10 0.8 0.928 0.777 1e-108
357441797265 hypothetical protein MTR_1g083600 [Medic 0.683 0.8 0.822 1e-104
225450751270 PREDICTED: uncharacterized protein LOC10 0.741 0.851 0.773 1e-103
217073934265 unknown [Medicago truncatula] 0.683 0.8 0.813 1e-102
124359146263 TPR repeat [Medicago truncatula] 0.677 0.798 0.803 1e-100
255542812221 conserved hypothetical protein [Ricinus 0.7 0.981 0.777 1e-99
388511867257 unknown [Lotus japonicus] 0.703 0.848 0.797 1e-99
30679555257 tetratricopeptide repeat-containing prot 0.816 0.984 0.681 1e-98
297829092257 binding protein [Arabidopsis lyrata subs 0.816 0.984 0.677 1e-96
>gi|224125100|ref|XP_002319500.1| predicted protein [Populus trichocarpa] gi|222857876|gb|EEE95423.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/270 (77%), Positives = 228/270 (84%), Gaps = 4/270 (1%)

Query: 44  MALTQHVLKPTINPPLYSFHRSLLTSKAPLSVQTHINS-LFST---PRGHYLQNRAPTFT 99
           MALT +       P   S H+  LT+  P S +TH NS  FST    R H LQN  PTFT
Sbjct: 1   MALTHNFNHIFPTPSSSSKHKHSLTTTLPFSPKTHTNSHFFSTNIPSRIHNLQNPLPTFT 60

Query: 100 RRLFIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKA 159
           RRLF+PSVSGIWDALTGGNNN REAV+AIRRGMLLFRQGDV+GS+ EFDKAIELD RQKA
Sbjct: 61  RRLFLPSVSGIWDALTGGNNNPREAVMAIRRGMLLFRQGDVLGSLVEFDKAIELDTRQKA 120

Query: 160 YLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVG 219
           YLWQRGLSLYY+DRFEEGA+QFRIDVAQNPNDTEESIWCFLCEAQLYGVDEAR RFLEVG
Sbjct: 121 YLWQRGLSLYYVDRFEEGAQQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARKRFLEVG 180

Query: 220 RDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHIL 279
           RDPRPVMREAYNMFK GGDPEK   AFS+G+ NEYFYASLYAGL++E+QK+ +AAK+ I+
Sbjct: 181 RDPRPVMREAYNMFKDGGDPEKFATAFSNGQGNEYFYASLYAGLYHEAQKEPEAAKVQII 240

Query: 280 AACESPYGQRSDDYMAALAKVHSLCRNWSS 309
           AAC SPYGQRSDDYMA+LAKVH LCRNWSS
Sbjct: 241 AACRSPYGQRSDDYMASLAKVHCLCRNWSS 270




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449454057|ref|XP_004144772.1| PREDICTED: uncharacterized protein LOC101209381 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357441797|ref|XP_003591176.1| hypothetical protein MTR_1g083600 [Medicago truncatula] gi|355480224|gb|AES61427.1| hypothetical protein MTR_1g083600 [Medicago truncatula] gi|388510044|gb|AFK43088.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225450751|ref|XP_002279298.1| PREDICTED: uncharacterized protein LOC100240883 [Vitis vinifera] gi|296089711|emb|CBI39530.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|217073934|gb|ACJ85327.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|124359146|gb|ABD28339.2| TPR repeat [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542812|ref|XP_002512469.1| conserved hypothetical protein [Ricinus communis] gi|223548430|gb|EEF49921.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|388511867|gb|AFK43995.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|30679555|ref|NP_683531.2| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|27311659|gb|AAO00795.1| Unknown protein [Arabidopsis thaliana] gi|30023732|gb|AAP13399.1| At3g05625 [Arabidopsis thaliana] gi|332640747|gb|AEE74268.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297829092|ref|XP_002882428.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297328268|gb|EFH58687.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query310
TAIR|locus:504955885257 AT3G05625 "AT3G05625" [Arabido 0.738 0.891 0.747 3e-92
TAIR|locus:504955885 AT3G05625 "AT3G05625" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 919 (328.6 bits), Expect = 3.0e-92, P = 3.0e-92
 Identities = 172/230 (74%), Positives = 198/230 (86%)

Query:    81 SLFSTPRGHYLQNRAPTFTRRLFIPSVSGIWDALTGG-NNNSREAVVAIRRGMLLFRQGD 139
             S F T    + ++     +RRLF+PSVS IWDA+TGG ++N REA+ A+RRGM LFRQGD
Sbjct:    25 SPFKTLSPQFSRHPPHALSRRLFLPSVSSIWDAITGGGDSNPREAIAAVRRGMQLFRQGD 84

Query:   140 VVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCF 199
             V GSVAEFD+AI LDPRQKAYLWQRGLSLYY+DRFEEGAEQFRIDVAQNPNDTEESIWCF
Sbjct:    85 VAGSVAEFDRAIILDPRQKAYLWQRGLSLYYVDRFEEGAEQFRIDVAQNPNDTEESIWCF 144

Query:   200 LCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAFSSGRENEYFYASL 259
             +CEA+L+GVD AR +FLEVGRD RPVMREAYN+FK GGDPEKLV  FSSG+ +EYFYASL
Sbjct:   145 ICEARLHGVDVARTQFLEVGRDSRPVMREAYNLFKNGGDPEKLVNDFSSGQASEYFYASL 204

Query:   260 YAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWSS 309
             YAGL+YE++ K++ AK H+ AAC SPYGQRSDDYMA+LAKVH LCRNWSS
Sbjct:   205 YAGLYYEAEGKSENAKFHLTAACGSPYGQRSDDYMASLAKVHCLCRNWSS 254


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.322   0.136   0.413    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      310       310   0.00079  116 3  11 22  0.50    33
                                                     33  0.45    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  607 (65 KB)
  Total size of DFA:  232 KB (2127 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  26.09u 0.12s 26.21t   Elapsed:  00:00:02
  Total cpu time:  26.09u 0.12s 26.21t   Elapsed:  00:00:02
  Start:  Fri May 10 03:30:54 2013   End:  Fri May 10 03:30:56 2013


GO:0008150 "biological_process" evidence=ND
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00130116
hypothetical protein (271 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-06
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 8e-06
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 5e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-04
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 0.002
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
 Score = 45.0 bits (107), Expect = 1e-06
 Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 122 REAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYL-DRFEEGAEQ 180
             A      G  LF+ GD   ++  ++KA+ELDP      +   L+   L   +EE  E 
Sbjct: 1   DNAEALKNLGNALFKLGDYDEAIEAYEKALELDPDNAEAYYNLALAYLKLGKDYEEALED 60

Query: 181 FRIDVAQNP 189
               +  +P
Sbjct: 61  LEKALELDP 69


Length = 69

>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 310
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK11189296 lipoprotein NlpI; Provisional 99.77
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.76
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.73
PRK12370553 invasion protein regulator; Provisional 99.67
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.64
PRK11189296 lipoprotein NlpI; Provisional 99.63
KOG0547606 consensus Translocase of outer mitochondrial membr 99.61
PRK12370553 invasion protein regulator; Provisional 99.59
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.59
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.56
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.55
PRK15359144 type III secretion system chaperone protein SscB; 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.51
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.5
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.49
KOG1126638 consensus DNA-binding cell division cycle control 99.48
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.47
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.47
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.44
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.44
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.43
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.42
KOG0553304 consensus TPR repeat-containing protein [General f 99.4
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.4
PLN02789320 farnesyltranstransferase 99.38
PRK15359144 type III secretion system chaperone protein SscB; 99.38
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.37
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.33
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.33
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.32
PRK11788389 tetratricopeptide repeat protein; Provisional 99.31
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.29
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.25
PRK10370198 formate-dependent nitrite reductase complex subuni 99.24
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.23
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.22
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.21
KOG1125579 consensus TPR repeat-containing protein [General f 99.19
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.19
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.18
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.17
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
KOG0553 304 consensus TPR repeat-containing protein [General f 99.14
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.14
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.11
PRK10370198 formate-dependent nitrite reductase complex subuni 99.11
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.06
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.05
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.04
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.03
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.02
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.02
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.01
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.01
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.98
PLN02789320 farnesyltranstransferase 98.96
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.96
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.96
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.95
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.89
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.87
PRK14574 822 hmsH outer membrane protein; Provisional 98.86
KOG2076 895 consensus RNA polymerase III transcription factor 98.85
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.82
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.82
KOG1125579 consensus TPR repeat-containing protein [General f 98.81
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.8
KOG1129478 consensus TPR repeat-containing protein [General f 98.78
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.76
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.75
PF1337173 TPR_9: Tetratricopeptide repeat 98.75
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.74
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.74
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.72
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.7
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.7
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.7
PRK15331165 chaperone protein SicA; Provisional 98.67
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.64
KOG2003 840 consensus TPR repeat-containing protein [General f 98.63
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.62
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.61
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.58
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.57
KOG2076 895 consensus RNA polymerase III transcription factor 98.57
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.57
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.57
PF12688120 TPR_5: Tetratrico peptide repeat 98.55
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.54
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.52
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.52
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.5
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.5
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.48
PRK10803263 tol-pal system protein YbgF; Provisional 98.48
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.46
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.46
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.46
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.45
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.45
PRK14574 822 hmsH outer membrane protein; Provisional 98.45
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.45
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.44
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.4
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.38
KOG1129478 consensus TPR repeat-containing protein [General f 98.38
PRK11906458 transcriptional regulator; Provisional 98.38
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.37
KOG4234271 consensus TPR repeat-containing protein [General f 98.35
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.35
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.34
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.33
PRK11906458 transcriptional regulator; Provisional 98.32
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.32
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.31
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.3
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.26
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.25
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.25
KOG4555175 consensus TPR repeat-containing protein [Function 98.25
PRK10803263 tol-pal system protein YbgF; Provisional 98.24
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.23
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.22
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.21
PRK15331165 chaperone protein SicA; Provisional 98.18
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.17
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.15
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.15
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.14
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.14
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.13
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.12
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.12
KOG4555175 consensus TPR repeat-containing protein [Function 98.09
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.09
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.09
PF1337173 TPR_9: Tetratricopeptide repeat 98.06
PLN03218 1060 maturation of RBCL 1; Provisional 98.06
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.05
KOG2003 840 consensus TPR repeat-containing protein [General f 98.05
PF1343134 TPR_17: Tetratricopeptide repeat 98.05
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.04
PLN03218 1060 maturation of RBCL 1; Provisional 98.01
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.01
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.0
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.0
PF1342844 TPR_14: Tetratricopeptide repeat 97.99
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.99
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.97
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.96
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.94
PLN03077 857 Protein ECB2; Provisional 97.93
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.93
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.91
PF13512142 TPR_18: Tetratricopeptide repeat 97.91
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.9
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.87
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.86
KOG1128777 consensus Uncharacterized conserved protein, conta 97.85
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.85
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.82
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.81
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.78
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.78
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.72
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.71
KOG4234271 consensus TPR repeat-containing protein [General f 97.71
PF12688120 TPR_5: Tetratrico peptide repeat 97.7
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.67
PF1343134 TPR_17: Tetratricopeptide repeat 97.64
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.63
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.61
PLN03077 857 Protein ECB2; Provisional 97.61
PF13512142 TPR_18: Tetratricopeptide repeat 97.57
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.54
PF1342844 TPR_14: Tetratricopeptide repeat 97.51
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.51
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.5
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.28
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.25
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.21
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.17
COG4700251 Uncharacterized protein conserved in bacteria cont 97.16
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.16
PRK04841 903 transcriptional regulator MalT; Provisional 97.14
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.12
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.12
COG4700251 Uncharacterized protein conserved in bacteria cont 97.11
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.1
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.08
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.96
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.96
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.95
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.93
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.93
PRK04841 903 transcriptional regulator MalT; Provisional 96.92
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.91
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.9
KOG3785 557 consensus Uncharacterized conserved protein [Funct 96.85
PRK10941269 hypothetical protein; Provisional 96.8
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.75
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.68
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.66
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.53
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.49
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.41
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.04
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.95
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.92
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.89
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.89
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.78
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.73
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.6
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.55
KOG3785 557 consensus Uncharacterized conserved protein [Funct 95.43
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.38
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.36
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.27
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.93
KOG1915 677 consensus Cell cycle control protein (crooked neck 94.93
KOG2047 835 consensus mRNA splicing factor [RNA processing and 94.83
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.44
KOG1310 758 consensus WD40 repeat protein [General function pr 94.35
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.27
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.09
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 93.99
KOG2047 835 consensus mRNA splicing factor [RNA processing and 93.91
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.9
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 93.67
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.54
KOG2471 696 consensus TPR repeat-containing protein [General f 93.51
KOG1915 677 consensus Cell cycle control protein (crooked neck 93.26
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 93.26
COG2912269 Uncharacterized conserved protein [Function unknow 93.26
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.93
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 92.89
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 92.32
COG4976287 Predicted methyltransferase (contains TPR repeat) 92.32
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 92.1
KOG1585308 consensus Protein required for fusion of vesicles 91.5
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.27
KOG4507886 consensus Uncharacterized conserved protein, conta 91.17
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 91.16
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.16
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.09
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.6
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 90.54
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 89.88
COG3898 531 Uncharacterized membrane-bound protein [Function u 89.47
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 89.47
KOG2471 696 consensus TPR repeat-containing protein [General f 89.08
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 89.07
PF1286294 Apc5: Anaphase-promoting complex subunit 5 88.17
KOG1310 758 consensus WD40 repeat protein [General function pr 88.09
PRK10941269 hypothetical protein; Provisional 88.0
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.7
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 87.35
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.33
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 87.3
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 87.22
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.19
KOG3364149 consensus Membrane protein involved in organellar 87.16
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.08
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 86.76
COG2976207 Uncharacterized protein conserved in bacteria [Fun 86.62
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 86.36
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.3
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.09
KOG3616 1636 consensus Selective LIM binding factor [Transcript 85.88
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 85.48
KOG1550552 consensus Extracellular protein SEL-1 and related 85.12
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 85.02
KOG0530318 consensus Protein farnesyltransferase, alpha subun 84.77
PF09986214 DUF2225: Uncharacterized protein conserved in bact 84.21
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 83.84
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 83.54
COG3898 531 Uncharacterized membrane-bound protein [Function u 82.92
COG5191 435 Uncharacterized conserved protein, contains HAT (H 81.61
COG3629280 DnrI DNA-binding transcriptional activator of the 80.9
KOG1585308 consensus Protein required for fusion of vesicles 80.74
KOG2610 491 consensus Uncharacterized conserved protein [Funct 80.17
KOG1941 518 consensus Acetylcholine receptor-associated protei 80.15
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=99.97  E-value=1.4e-31  Score=257.53  Aligned_cols=299  Identities=18%  Similarity=0.164  Sum_probs=201.1

Q ss_pred             cccccchhhHHHhhhccc-chhhhhhh-----hhhhhhhheehhhhhhhhhhh---cCCCC--------------CCCch
Q 021611            4 TFGALSLSQTYQKSRTQL-PKILHLHQ-----LYYYKFCIFFQFTSMALTQHV---LKPTI--------------NPPLY   60 (310)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~-~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~---~~~~~--------------~~~~~   60 (310)
                      ||.||++||+|+|+++|| .|+|.|.+     +|.|++||+++|.|.|++--+   ||+++              .|||+
T Consensus       172 ~TkALEl~P~Y~KAl~RRA~A~E~lg~~~eal~D~tv~ci~~~F~n~s~~~~~eR~Lkk~a~~ka~e~~k~nr~p~lPS~  251 (606)
T KOG0547|consen  172 CTKALELNPDYVKALLRRASAHEQLGKFDEALFDVTVLCILEGFQNASIEPMAERVLKKQAMKKAKEKLKENRPPVLPSA  251 (606)
T ss_pred             HHHHhhcCcHHHHHHHHHHHHHHhhccHHHHHHhhhHHHHhhhcccchhHHHHHHHHHHHHHHHHHHhhcccCCCCCCcH
Confidence            799999999999999999 99999999     899999999999998876544   88777              79999


Q ss_pred             hhhhhhhccCCCccccccccccc------------------------------------ccCccccc----CCCCccccc
Q 021611           61 SFHRSLLTSKAPLSVQTHINSLF------------------------------------STPRGHYL----QNRAPTFTR  100 (310)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~l~~~~------------------------------------~~~~~~~~----~~~~~~~~~  100 (310)
                      +||-||+.||.+.+-+...++.-                                    +....+..    +..+.++.-
T Consensus       252 ~fi~syf~sF~~~~~~~~~~~~~ksDa~l~~~l~~l~~~~~e~Y~~a~~~~te~~~~~~~~~~~n~~d~~le~~A~al~~  331 (606)
T KOG0547|consen  252 TFIASYFGSFHADPKPLFDNKSDKSDAALAEALEALEKGLEEGYLKAYDKATEECLGSESSLSVNEIDAELEYMAEALLL  331 (606)
T ss_pred             HHHHHHHhhccccccccccCCCccchhhHHHHHHHHHhhCchhHHHHHHHHHHHhhhhhhhccccccchhHHHHHHHHHH
Confidence            99999999998877633222210                                    00000000    000111111


Q ss_pred             hh-------cccchhhhhhhhcCCCCchhHHHHHHHhhhhheeccccccchhhhhhccccCcchhhHHHhhccchhhhhh
Q 021611          101 RL-------FIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDR  173 (310)
Q Consensus       101 ~~-------~~~~a~~~~~~ai~~~~~P~~~~a~~~rG~~~~~~g~~~eAl~~f~kAl~l~P~~~~a~~~~G~a~~~lg~  173 (310)
                      ++       ..-++...++++|.  ++|.+...|+.||.+|..+.+.++-..+|++|..+||.++..|+.||.+++.+++
T Consensus       332 ~gtF~fL~g~~~~a~~d~~~~I~--l~~~~~~lyI~~a~~y~d~~~~~~~~~~F~~A~~ldp~n~dvYyHRgQm~flL~q  409 (606)
T KOG0547|consen  332 RGTFHFLKGDSLGAQEDFDAAIK--LDPAFNSLYIKRAAAYADENQSEKMWKDFNKAEDLDPENPDVYYHRGQMRFLLQQ  409 (606)
T ss_pred             hhhhhhhcCCchhhhhhHHHHHh--cCcccchHHHHHHHHHhhhhccHHHHHHHHHHHhcCCCCCchhHhHHHHHHHHHH
Confidence            11       23345566667777  8888777788888888888888888888888888888888888888888888888


Q ss_pred             hhhhhhhhhhhhccCCCCCccceeeeehhhhhcChHHHHHhHHHhcCCChhhHHHHHH----hhcCCCChHHHHHHhcC-
Q 021611          174 FEEGAEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYN----MFKGGGDPEKLVAAFSS-  248 (310)
Q Consensus       174 ~~eA~~~f~~Al~l~P~d~~~~~~~~l~~a~l~~~~eA~~~l~~~~~d~~~~~~~a~~----l~~~~~~~e~al~~~~~-  248 (310)
                      |++|+.+|++|++++|++..+++....+..+.++++++...|.++...... ..++|.    .+..++++++|++.+.. 
T Consensus       410 ~e~A~aDF~Kai~L~pe~~~~~iQl~~a~Yr~~k~~~~m~~Fee~kkkFP~-~~Evy~~fAeiLtDqqqFd~A~k~YD~a  488 (606)
T KOG0547|consen  410 YEEAIADFQKAISLDPENAYAYIQLCCALYRQHKIAESMKTFEEAKKKFPN-CPEVYNLFAEILTDQQQFDKAVKQYDKA  488 (606)
T ss_pred             HHHHHHHHHHHhhcChhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCC-CchHHHHHHHHHhhHHhHHHHHHHHHHH
Confidence            888888888888888887765444333333677777777777665432110 113333    33445666667666642 


Q ss_pred             -CCCcc----hhHh--hhhhhh-hhhhccchhhHHHHHHHhhcCCCCCCChHHHHHHHHHhhcccCC
Q 021611          249 -GRENE----YFYA--SLYAGL-FYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNW  307 (310)
Q Consensus       249 -~~~~d----~~~a--~~~lG~-~~~~~G~~d~A~~~~~kAl~~~~~~~s~~~~~~la~~~~~~~~~  307 (310)
                       .+.+.    ...+  ....|+ +..=.+++.+|+..+++|+++.  ++++..+-+||.+.+++|+.
T Consensus       489 i~LE~~~~~~~v~~~plV~Ka~l~~qwk~d~~~a~~Ll~KA~e~D--pkce~A~~tlaq~~lQ~~~i  553 (606)
T KOG0547|consen  489 IELEPREHLIIVNAAPLVHKALLVLQWKEDINQAENLLRKAIELD--PKCEQAYETLAQFELQRGKI  553 (606)
T ss_pred             HhhccccccccccchhhhhhhHhhhchhhhHHHHHHHHHHHHccC--chHHHHHHHHHHHHHHHhhH
Confidence             12221    1111  112222 2222377788888888888743  56677777888887777763



>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
2kck_A112 Nmr Solution Structure Of The Northeast Structural 9e-05
1xnf_A275 Crystal Structure Of E.Coli Tpr-Protein Nlpi Length 6e-04
>pdb|2KCK|A Chain A, Nmr Solution Structure Of The Northeast Structural Genomics Consortium (Nesg) Target Mrr121a Length = 112 Back     alignment and structure

Iteration: 1

Score = 44.3 bits (103), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 22/77 (28%), Positives = 41/77 (53%) Query: 130 RGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNP 189 G+L + G+ S+ F+KAI+LDP + Y +G +LY L+R+EE + + + Sbjct: 12 EGVLQYDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIE 71 Query: 190 NDTEESIWCFLCEAQLY 206 ++ + +W +A Y Sbjct: 72 DEYNKDVWAAKADALRY 88
>pdb|1XNF|A Chain A, Crystal Structure Of E.Coli Tpr-Protein Nlpi Length = 275 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query310
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-06
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-06
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-04
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-06
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-06
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-05
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 1e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 8e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 2e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-05
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 5e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 6e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-04
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
 Score = 56.2 bits (136), Expect = 2e-09
 Identities = 34/153 (22%), Positives = 57/153 (37%), Gaps = 9/153 (5%)

Query: 130 RGMLLFRQGDVVGSVAEFDKAIELDPR-QKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQN 188
            G+ L + G+   +   FD  +ELDP    A+L  RG++LYY  R +   +        +
Sbjct: 83  LGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHL-NRGIALYYGGRDKLAQDDLLAFYQDD 141

Query: 189 PNDTEESIWCFLCEAQL--YGVDEARNRFLEVGRDPRPVMREAYNMFKGGGDPEKLVAAF 246
           PND   S+W +L E +L      E   +  E     +              +   +    
Sbjct: 142 PNDPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLK 201

Query: 247 SSGREN-----EYFYASLYAGLFYESQKKADAA 274
           +   +N          + Y G +Y S    D+A
Sbjct: 202 ADATDNTSLAEHLSETNFYLGKYYLSLGDLDSA 234


>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.84
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.81
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.78
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.78
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.77
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.76
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.75
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.72
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.72
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.71
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.7
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.69
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.69
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.68
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.68
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.68
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.67
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.67
3u4t_A272 TPR repeat-containing protein; structural genomics 99.66
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.66
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.66
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.66
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.66
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.65
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.64
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.63
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.63
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.62
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.62
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.61
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.6
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.59
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.58
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.58
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.57
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.57
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.56
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.55
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.54
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.53
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.53
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.52
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.52
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.5
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.5
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.49
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.49
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.49
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.48
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.48
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.48
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.48
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.46
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.46
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.46
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.45
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.45
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.45
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.45
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.44
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.43
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.43
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.43
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.43
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.42
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.41
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.41
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.4
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.4
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.39
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.39
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.38
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.38
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.38
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.37
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.37
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.37
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.37
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.37
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.36
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.36
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.36
3k9i_A117 BH0479 protein; putative protein binding protein, 99.36
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.36
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.36
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.34
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.34
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.34
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.33
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.33
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.33
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.33
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.33
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.33
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.32
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.32
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.32
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.32
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.31
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.3
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.3
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.3
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.29
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.29
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.28
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.28
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.27
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.26
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.24
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.23
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.23
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.22
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.22
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.21
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.21
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.2
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.19
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.19
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.17
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.17
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.17
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.17
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.15
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.15
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.15
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.15
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.13
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.13
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.13
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.12
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.12
3k9i_A117 BH0479 protein; putative protein binding protein, 99.12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.12
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.11
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.1
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.1
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.1
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.09
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.07
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.05
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.04
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.03
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.03
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.01
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.0
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.0
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.97
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.96
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.95
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.93
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.93
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.92
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.87
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.83
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.82
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.81
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.78
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.78
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.69
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.63
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.51
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.5
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.45
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.42
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.41
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.33
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.32
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.26
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.24
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.12
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.05
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.01
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.99
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.92
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.87
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.84
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.76
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.67
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.66
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.54
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.44
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.35
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.72
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.2
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.93
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.86
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.6
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.53
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.27
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 94.28
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 92.83
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.8
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.72
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 91.56
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.21
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 90.4
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.79
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.43
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 85.9
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 85.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 84.96
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 83.18
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 82.78
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 82.72
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 81.53
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
Probab=99.84  E-value=1e-21  Score=172.27  Aligned_cols=185  Identities=16%  Similarity=0.104  Sum_probs=114.0

Q ss_pred             hhHHHHHHHhhhhheeccccccchhhhhhccccCcchhhHHHhhccchhhhhhhhhhhhhhhhhhccCCCCCccceeeee
Q 021611          121 SREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFRIDVAQNPNDTEESIWCFL  200 (310)
Q Consensus       121 P~~~~a~~~rG~~~~~~g~~~eAl~~f~kAl~l~P~~~~a~~~~G~a~~~lg~~~eA~~~f~~Al~l~P~d~~~~~~~~l  200 (310)
                      |+++.+++.+|.++...|++++|+..|+++++++|+++.+++++|.++..+|++++|+..|+++++++|+++.++...+.
T Consensus         2 p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~~~A~~~~~~al~~~P~~~~a~~~lg~   81 (217)
T 2pl2_A            2 QTAEQNPLRLGVQLYALGRYDAALTLFERALKENPQDPEALYWLARTQLKLGLVNPALENGKTLVARTPRYLGGYMVLSE   81 (217)
T ss_dssp             --CCHHHHHHHHHHHHTTCHHHHHHHHHHHHTTSSSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHH
T ss_pred             CCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHH
Confidence            55566666666666666666666666666666666666666666666666666666666666666666666553333333


Q ss_pred             hhhhh-----------cChHHHHHhHHHh---cCCChhhHHHHHHhhcCCCChHHHHHHhcCC--CCcchhHhhhhhhhh
Q 021611          201 CEAQL-----------YGVDEARNRFLEV---GRDPRPVMREAYNMFKGGGDPEKLVAAFSSG--RENEYFYASLYAGLF  264 (310)
Q Consensus       201 ~~a~l-----------~~~~eA~~~l~~~---~~d~~~~~~~a~~l~~~~~~~e~al~~~~~~--~~~d~~~a~~~lG~~  264 (310)
                      +....           |++++|+..+.++   .|+....+......+...|++++|+..+...  .+ +...+++.+|.+
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~-~~~~~~~~la~~  160 (217)
T 2pl2_A           82 AYVALYRQAEDRERGKGYLEQALSVLKDAERVNPRYAPLHLQRGLVYALLGERDKAEASLKQALALE-DTPEIRSALAEL  160 (217)
T ss_dssp             HHHHHHHTCSSHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-CCHHHHHHHHHH
T ss_pred             HHHHhhhhhhhhcccccCHHHHHHHHHHHHHhCcccHHHHHHHHHHHHHcCChHHHHHHHHHHHhcc-cchHHHHHHHHH
Confidence            33355           6666666655542   2332222222223344456666665555421  12 445667789999


Q ss_pred             hhhccchhhHHHHHHHhhcCCCCCCChHHHHHHHHHhhcccCCc
Q 021611          265 YESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRNWS  308 (310)
Q Consensus       265 ~~~~G~~d~A~~~~~kAl~~~~~~~s~~~~~~la~~~~~~~~~~  308 (310)
                      +..+|++++|+..|++++++.  +.+.+.+.+++.++...|++.
T Consensus       161 ~~~~g~~~~A~~~~~~al~~~--P~~~~~~~~la~~~~~~g~~~  202 (217)
T 2pl2_A          161 YLSMGRLDEALAQYAKALEQA--PKDLDLRVRYASALLLKGKAE  202 (217)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHS--TTCHHHHHHHHHHHTC-----
T ss_pred             HHHcCCHHHHHHHHHHHHHhC--CCChHHHHHHHHHHHHccCHH
Confidence            999999999999999999844  346688889999999998874



>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 310
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-06
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 0.002
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.7 bits (109), Expect = 2e-06
 Identities = 26/190 (13%), Positives = 49/190 (25%), Gaps = 14/190 (7%)

Query: 118 NNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEG 177
            N  R+       G+   ++GD+  +V  F+ A++ DP+        G +    ++    
Sbjct: 13  ENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLA 72

Query: 178 AEQFRIDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEVGRDPRPVMREAYNMFKGGG 237
               R  +   P++    +   +                      R       +  +   
Sbjct: 73  ISALRRCLELKPDNQTALMALAVSFTNES--------------LQRQACEILRDWLRYTP 118

Query: 238 DPEKLVAAFSSGRENEYFYASLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAAL 297
               LV     G        S        S       K   LAA          D    L
Sbjct: 119 AYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGL 178

Query: 298 AKVHSLCRNW 307
             + +L   +
Sbjct: 179 GVLFNLSGEY 188


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query310
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.76
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.74
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.7
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.67
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.66
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.64
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.61
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.47
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.45
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.43
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.42
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.39
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.36
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.35
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.33
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.28
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.25
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.25
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.23
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.2
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.19
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.09
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.05
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.02
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.99
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.96
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.94
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.89
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.85
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.73
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.7
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.66
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.64
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.56
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.5
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.47
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.38
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.21
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.9
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.37
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.79
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.37
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 84.43
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81  E-value=3.9e-20  Score=166.47  Aligned_cols=200  Identities=14%  Similarity=0.058  Sum_probs=168.0

Q ss_pred             cccchhhhhhhhcCCCCchhHHHHHHHhhhhheeccccccchhhhhhccccCcchhhHHHhhccchhhhhhhhhhhhhhh
Q 021611          103 FIPSVSGIWDALTGGNNNSREAVVAIRRGMLLFRQGDVVGSVAEFDKAIELDPRQKAYLWQRGLSLYYLDRFEEGAEQFR  182 (310)
Q Consensus       103 ~~~~a~~~~~~ai~~~~~P~~~~a~~~rG~~~~~~g~~~eAl~~f~kAl~l~P~~~~a~~~~G~a~~~lg~~~eA~~~f~  182 (310)
                      ....|...+.+++.  ++|+++.+|..+|.++...|++++|+..|+++++++|.....+..+|.++...|++++|++.|+
T Consensus       184 ~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~  261 (388)
T d1w3ba_         184 EIWLAIHHFEKAVT--LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYR  261 (388)
T ss_dssp             CHHHHHHHHHHHHH--HCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHH--hCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHH
Confidence            55668888888888  9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccCCCCCccceeeeehhhhhcChHHHHHhHHHh---cCCChhhHHHHHHhhcCCCChHHHHHHhc--CCCCcchhHh
Q 021611          183 IDVAQNPNDTEESIWCFLCEAQLYGVDEARNRFLEV---GRDPRPVMREAYNMFKGGGDPEKLVAAFS--SGRENEYFYA  257 (310)
Q Consensus       183 ~Al~l~P~d~~~~~~~~l~~a~l~~~~eA~~~l~~~---~~d~~~~~~~a~~l~~~~~~~e~al~~~~--~~~~~d~~~a  257 (310)
                      ++++++|+++.++...+.+....|++++|+..+.++   .+.....+......+...|++++|+..+.  ....|+...+
T Consensus       262 ~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~  341 (388)
T d1w3ba_         262 RAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAA  341 (388)
T ss_dssp             HHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHH
T ss_pred             HHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHH
Confidence            999999999875443334444789999999988764   23333333333345566789999988886  3345667788


Q ss_pred             hhhhhhhhhhccchhhHHHHHHHhhcCCCCCCChHHHHHHHHHhhcccC
Q 021611          258 SLYAGLFYESQKKADAAKLHILAACESPYGQRSDDYMAALAKVHSLCRN  306 (310)
Q Consensus       258 ~~~lG~~~~~~G~~d~A~~~~~kAl~~~~~~~s~~~~~~la~~~~~~~~  306 (310)
                      ++.+|.++..+|++++|+.+|++|+++.  +...+.+.+||.++..+|+
T Consensus       342 ~~~la~~~~~~g~~~~A~~~~~~al~l~--P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         342 HSNLASVLQQQGKLQEALMHYKEAIRIS--PTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHTTTCCHHHHHHHHHHHTTC--TTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHHHHcCC
Confidence            8899999999999999999999999965  3567899999999999886



>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure