Citrus Sinensis ID: 021719
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| 255539483 | 316 | conserved hypothetical protein [Ricinus | 0.974 | 0.949 | 0.83 | 1e-146 | |
| 388512841 | 305 | unknown [Medicago truncatula] | 0.974 | 0.983 | 0.763 | 1e-133 | |
| 217074224 | 305 | unknown [Medicago truncatula] | 0.974 | 0.983 | 0.756 | 1e-132 | |
| 356575953 | 305 | PREDICTED: F-box/LRR-repeat protein At3g | 0.974 | 0.983 | 0.753 | 1e-132 | |
| 356535883 | 304 | PREDICTED: F-box/LRR-repeat protein At3g | 0.967 | 0.980 | 0.751 | 1e-130 | |
| 225470694 | 321 | PREDICTED: F-box/LRR-repeat protein At3g | 0.970 | 0.931 | 0.722 | 1e-128 | |
| 297741053 | 310 | unnamed protein product [Vitis vinifera] | 0.970 | 0.964 | 0.722 | 1e-128 | |
| 224122416 | 291 | predicted protein [Populus trichocarpa] | 0.928 | 0.982 | 0.749 | 1e-125 | |
| 224134733 | 291 | predicted protein [Populus trichocarpa] | 0.928 | 0.982 | 0.728 | 1e-122 | |
| 297816094 | 309 | F-box family protein [Arabidopsis lyrata | 0.974 | 0.970 | 0.687 | 1e-122 |
| >gi|255539483|ref|XP_002510806.1| conserved hypothetical protein [Ricinus communis] gi|223549921|gb|EEF51408.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 523 bits (1347), Expect = e-146, Method: Compositional matrix adjust.
Identities = 249/300 (83%), Positives = 278/300 (92%)
Query: 1 MEESASTVRRWEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLDLSML 60
MEE S VRRWEDLD DILVKIFQSFDIF+LTSGIAHVCSSWR ACCDPLLWKTLDLSML
Sbjct: 12 MEEGDSLVRRWEDLDTDILVKIFQSFDIFQLTSGIAHVCSSWRLACCDPLLWKTLDLSML 71
Query: 61 ISNYIKIPLEPYVYVHGHSDKQLTRILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTAER 120
SN+IKIPLEPYVYV G SDK LTR+LKISL+LS+G+I +LIFHFNLYVSD+QLTYTAER
Sbjct: 72 KSNFIKIPLEPYVYVDGRSDKTLTRVLKISLNLSQGNITSLIFHFNLYVSDEQLTYTAER 131
Query: 121 CPQLKRLVMPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLMEEIAQNCRNFRELKI 180
CP+L+RLV+PAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYL+EEIA NCRNF ELKI
Sbjct: 132 CPRLRRLVLPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLIEEIANNCRNFSELKI 191
Query: 181 MGPFDLLFASTLNMYLPKLKVLSLRCTTLNRDALILILDGLQNLEVLNISHCLLIDVPLA 240
MGPF++ FASTL YLPKL+VLSLRC+ L +DALILILD LQ+LEVLNISHCLLI+VP
Sbjct: 192 MGPFEIFFASTLAAYLPKLRVLSLRCSMLIKDALILILDSLQSLEVLNISHCLLIEVPAP 251
Query: 241 PAPKKIIKKLDRTILQKAARLRKFLTCMEDSCIMCQRTKNDEGIMRWYKYEEGLWKDDEV 300
PAPK+II++LD TIL+KA+RLR+FLTCM++SCIMCQRTK+DEG+MRWYKYEEGLWK DEV
Sbjct: 252 PAPKRIIRELDHTILEKASRLREFLTCMDESCIMCQRTKSDEGLMRWYKYEEGLWKTDEV 311
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|388512841|gb|AFK44482.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217074224|gb|ACJ85472.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356575953|ref|XP_003556100.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356535883|ref|XP_003536472.1| PREDICTED: F-box/LRR-repeat protein At3g48880-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225470694|ref|XP_002262912.1| PREDICTED: F-box/LRR-repeat protein At3g48880 [Vitis vinifera] gi|147841766|emb|CAN62210.1| hypothetical protein VITISV_008091 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741053|emb|CBI31784.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224122416|ref|XP_002318828.1| predicted protein [Populus trichocarpa] gi|222859501|gb|EEE97048.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224134733|ref|XP_002321893.1| predicted protein [Populus trichocarpa] gi|222868889|gb|EEF06020.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297816094|ref|XP_002875930.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297321768|gb|EFH52189.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 308 | ||||||
| TAIR|locus:2099443 | 309 | AT3G48880 "AT3G48880" [Arabido | 0.974 | 0.970 | 0.671 | 4.6e-112 | |
| TAIR|locus:2139697 | 333 | AT4G11580 [Arabidopsis thalian | 0.75 | 0.693 | 0.270 | 3.5e-20 | |
| TAIR|locus:1005716270 | 246 | AT4G05497 "AT4G05497" [Arabido | 0.701 | 0.878 | 0.259 | 2.9e-10 | |
| TAIR|locus:2174398 | 300 | SKIP1 "SKP1 interacting partne | 0.542 | 0.556 | 0.280 | 2.1e-09 | |
| TAIR|locus:2115979 | 307 | AT4G05490 "AT4G05490" [Arabido | 0.681 | 0.684 | 0.273 | 2.3e-09 | |
| TAIR|locus:2122308 | 317 | FBW2 "AT4G08980" [Arabidopsis | 0.698 | 0.678 | 0.236 | 1.3e-08 | |
| TAIR|locus:2115949 | 302 | AT4G05460 "AT4G05460" [Arabido | 0.707 | 0.721 | 0.253 | 9.8e-08 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.454 | 0.321 | 0.256 | 1.4e-05 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.454 | 0.321 | 0.256 | 1.4e-05 | |
| MGI|MGI:1919444 | 436 | Fbxl20 "F-box and leucine-rich | 0.454 | 0.321 | 0.256 | 1.4e-05 |
| TAIR|locus:2099443 AT3G48880 "AT3G48880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1106 (394.4 bits), Expect = 4.6e-112, P = 4.6e-112
Identities = 204/304 (67%), Positives = 252/304 (82%)
Query: 1 MEESAST--VRRWEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLDLS 58
MEE + +RRWE+LD DILV+IFQ F +FELTSG+AHVC WR+ACCDP+LWKT+DLS
Sbjct: 1 MEEEYESRRLRRWEELDTDILVRIFQKFSVFELTSGLAHVCRGWRAACCDPILWKTVDLS 60
Query: 59 MLISNYIKIPLEPYVYVHGHSDKQLTRILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTA 118
+ S++IKIPLEPYVYV SD+ LTRILK+S++LS GS RTLIFHFNL++SDDQLTYTA
Sbjct: 61 NMRSSFIKIPLEPYVYVERRSDEALTRILKLSMNLSGGSTRTLIFHFNLFLSDDQLTYTA 120
Query: 119 ERCPQLKRLVMPAWNRIKKTGICKAIRMWRDLESLTMPSIANPPYLMEEIAQNCRNFREL 178
ERCP L+R+V+PAWNRIKKTGICKAIR+W+DLESLTMPSIANPPYL+ EIA+NC+NF+EL
Sbjct: 121 ERCPGLRRVVLPAWNRIKKTGICKAIRIWKDLESLTMPSIANPPYLLTEIAKNCKNFKEL 180
Query: 179 KIMGPFDLLFASTLNMYLPKLKVLSLRCTTLNRDALILILDGLQNLEVLNISHCLLIDVX 238
KIMGPF++ FA+TL LP +K LS+RC+ + R+AL+ ILDGL +LEVLNISH L++
Sbjct: 181 KIMGPFEVFFANTLITCLPNIKTLSIRCSAIKREALMKILDGLPSLEVLNISHSHLVEYS 240
Query: 239 XXX-XXXXXXXXXDRTILQKAARLRKFLTCMED-SCIMCQRTKNDEGIMRWYKYEEGLWK 296
D+TI++K ARL+KFLTCM+ +C+MCQRT+NDEGI+RWYKYEEG WK
Sbjct: 241 GWQPQQKVIVRELDKTIMEKTARLKKFLTCMDHKTCVMCQRTENDEGIVRWYKYEEGDWK 300
Query: 297 DDEV 300
DEV
Sbjct: 301 VDEV 304
|
|
| TAIR|locus:2139697 AT4G11580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716270 AT4G05497 "AT4G05497" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174398 SKIP1 "SKP1 interacting partner 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115979 AT4G05490 "AT4G05490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122308 FBW2 "AT4G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115949 AT4G05460 "AT4G05460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919444 Fbxl20 "F-box and leucine-rich repeat protein 20" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_XII001171 | hypothetical protein (291 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 9e-07 |
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Score = 44.8 bits (107), Expect = 9e-07
Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
Query: 11 WEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLDLS 58
DL ++IL++IF D +L +A VC WR D LW+ L L
Sbjct: 1 LSDLPDEILLQIFSYLDPRDLLR-LALVCRRWRELASDDSLWRRLCLR 47
|
This is an F-box-like family. Length = 47 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.92 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.9 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.61 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.41 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.17 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.17 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.0 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.95 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.88 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.82 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.78 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.53 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.39 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.36 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.33 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.13 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.12 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.08 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.96 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.7 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 97.69 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.64 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.64 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.63 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.56 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.16 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.15 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.14 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.08 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.07 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.01 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 97.01 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 96.92 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.69 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 96.6 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.47 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.45 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.39 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.3 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.29 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.22 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.08 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.98 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.84 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 95.83 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.54 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.22 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.13 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.07 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 95.07 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.06 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.79 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.56 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 93.26 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 93.26 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 93.22 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 93.08 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 92.83 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 92.21 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 90.85 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 90.67 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 90.53 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 89.32 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 89.25 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 89.21 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 88.42 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 88.38 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 88.37 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 88.25 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 88.24 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 87.57 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 87.44 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 87.43 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 85.88 | |
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 84.62 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 82.66 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 82.28 | |
| KOG3926 | 332 | consensus F-box proteins [Amino acid transport and | 81.89 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 81.46 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.92 E-value=1.2e-24 Score=181.96 Aligned_cols=226 Identities=20% Similarity=0.245 Sum_probs=168.7
Q ss_pred cCCCcCCCCHHHHHHHhcCCChHHHhhHHhHhhHHHHHhccCCCcceeeeccccccc-----------cc--ccC----C
Q 021719 7 TVRRWEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLDLSMLISN-----------YI--KIP----L 69 (308)
Q Consensus 7 ~~~~~~~LP~eiL~~If~~L~~~d~~~~~s~VCr~Wr~~~~~p~lw~~i~l~~~~~~-----------~~--~~~----~ 69 (308)
++.+|+.|||||+..||+.|..++++. ++.|||||++++.+.++|.++|+....-+ .. ..+ .
T Consensus 94 pgv~~~slpDEill~IFs~L~kk~LL~-~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p~~l~~l~~rgV~v~Rlar~~~~ 172 (419)
T KOG2120|consen 94 PGVSWDSLPDEILLGIFSCLCKKELLK-VSGVCKRFYRLASDESLWQTLDLTGRNIHPDVLGRLLSRGVIVFRLARSFMD 172 (419)
T ss_pred CCCCcccCCHHHHHHHHHhccHHHHHH-HHHHHHHHhhccccccceeeeccCCCccChhHHHHHHhCCeEEEEcchhhhc
Confidence 345699999999999999999999999 99999999999999999999998763100 00 000 0
Q ss_pred CC-ceeecCCChHHHH----------HHHHHHHHhcCCCccEEEccCCCCCCHHHHHHHHhhCCCCcEEEcCCCCCCCHH
Q 021719 70 EP-YVYVHGHSDKQLT----------RILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTAERCPQLKRLVMPAWNRIKKT 138 (308)
Q Consensus 70 ~~-~~~~~~~~~~~l~----------~~l~~~~~~s~~~l~~l~l~~~~~~~d~~l~~l~~~~~~L~~L~L~~~~~~~~~ 138 (308)
++ .+.+......++. .-....+-..|..++.+.+.+ ..++|.....++++ .+|+.|+|++|..++..
T Consensus 173 ~prlae~~~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg-~~LdD~I~~~iAkN-~~L~~lnlsm~sG~t~n 250 (419)
T KOG2120|consen 173 QPRLAEHFSPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLEG-LRLDDPIVNTIAKN-SNLVRLNLSMCSGFTEN 250 (419)
T ss_pred CchhhhhhhhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccccc-cccCcHHHHHHhcc-ccceeeccccccccchh
Confidence 00 0000000000000 000011222466777787765 36788888888875 89999999999999999
Q ss_pred HHHHHHhcCCCCCEEEeCCCCCChHHHH-HHHHcCCCCCeeEecCC---CCHHHHHHHHhcCCCCcEEEee-CCCCCHHH
Q 021719 139 GICKAIRMWRDLESLTMPSIANPPYLME-EIAQNCRNFRELKIMGP---FDLLFASTLNMYLPKLKVLSLR-CTTLNRDA 213 (308)
Q Consensus 139 ~l~~~~~~~~~L~~L~l~~~~~~~~~l~-~l~~~~~~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~-~~~it~~~ 213 (308)
++..++..|..|.+|++++|..+.+.+. +++.-.++|+.|+++|+ +.+..+..+.+.||+|.+|+|+ ++.+++ +
T Consensus 251 ~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~l~~-~ 329 (419)
T KOG2120|consen 251 ALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVMLKN-D 329 (419)
T ss_pred HHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhCCceeeeccccccccCc-h
Confidence 9999999999999999999976544444 34445689999999987 6677888888999999999999 777888 5
Q ss_pred HHHHHHcCCCCCEEecccCCCcC
Q 021719 214 LILILDGLQNLEVLNISHCLLID 236 (308)
Q Consensus 214 l~~l~~~~p~L~~L~l~~C~~i~ 236 (308)
+...+.+++.|++|.++.|..+.
T Consensus 330 ~~~~~~kf~~L~~lSlsRCY~i~ 352 (419)
T KOG2120|consen 330 CFQEFFKFNYLQHLSLSRCYDII 352 (419)
T ss_pred HHHHHHhcchheeeehhhhcCCC
Confidence 55556679999999999999876
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3926 consensus F-box proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 308 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 6e-17 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-09 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-05 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 5e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-04 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 7e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 9e-05 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 79.2 bits (195), Expect = 6e-17
Identities = 39/234 (16%), Positives = 83/234 (35%), Gaps = 14/234 (5%)
Query: 11 WEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLDLSMLISNYIKIPLE 70
W+ L +++L+ IF + EL ++ VC W D LW+TLDL+ +
Sbjct: 9 WDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRL 67
Query: 71 PYVYVHGHSDKQLTRILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTAERCPQLKRLVMP 130
V + ++ S ++ + N + L +C +L+ L +
Sbjct: 68 LSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLS-NSVIEVSTLHGILSQCSKLQNLSL- 125
Query: 131 AWNRIKKTGICKAIRMWRDLESLTM---PSIANPPYLMEEIAQNCRNFRELKIMGPF--- 184
R+ + +L L + + ++ + +C EL + F
Sbjct: 126 EGLRLSDPI-VNTLAKNSNLVRLNLSGCSGFSEFA--LQTLLSSCSRLDELNLSWCFDFT 182
Query: 185 DLLFASTLNMYLPKLKVLSLR--CTTLNRDALILILDGLQNLEVLNISHCLLID 236
+ + + L+L L + L ++ NL L++S +++
Sbjct: 183 EKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLK 236
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.93 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.84 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.78 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.46 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.45 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.43 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.42 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.39 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.3 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.2 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.19 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.11 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.1 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.0 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.97 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.82 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.81 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.78 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.74 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.73 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.67 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.62 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.61 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.58 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.55 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.54 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.53 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.52 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.44 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.41 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.3 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.25 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.22 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.16 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.16 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.15 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.15 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.14 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.13 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.11 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.1 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.08 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.07 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 98.06 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.03 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.02 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.01 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.0 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.99 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.98 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.95 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.95 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.93 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.92 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.92 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.91 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.9 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.86 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.84 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.83 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.81 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.8 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.78 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.77 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.76 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.76 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.75 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.73 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.73 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.71 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.71 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.7 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.69 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.69 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.69 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.68 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.67 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.66 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.66 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.65 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.64 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.64 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.63 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.63 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.63 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.62 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.61 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.61 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.61 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.59 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.59 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.58 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.58 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.56 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.56 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.56 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.55 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.54 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.54 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.54 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.54 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.54 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.53 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.52 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.51 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.5 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.49 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.49 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.49 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.48 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.48 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.47 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.46 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.42 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.42 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.42 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.41 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.41 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.38 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.37 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.36 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.36 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.35 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.34 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.34 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.33 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.31 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.26 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.16 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.15 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.13 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.08 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.02 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.88 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.82 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.81 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.77 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.63 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.59 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 96.57 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.5 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.47 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.38 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.31 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.29 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.23 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.16 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.06 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.03 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 95.85 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 95.67 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.35 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.21 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 93.52 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 88.41 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 86.61 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 86.33 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 85.62 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.93 E-value=3.8e-24 Score=190.08 Aligned_cols=223 Identities=21% Similarity=0.255 Sum_probs=133.4
Q ss_pred cCCCcCCCCHHHHHHHhcCCChHHHhhHHhHhhHHHHHhccCCCcceeeecccccc-----------cccccCCCCce--
Q 021719 7 TVRRWEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLWKTLDLSMLIS-----------NYIKIPLEPYV-- 73 (308)
Q Consensus 7 ~~~~~~~LP~eiL~~If~~L~~~d~~~~~s~VCr~Wr~~~~~p~lw~~i~l~~~~~-----------~~~~~~~~~~~-- 73 (308)
+..+|++||+|++.+||+||+.+|+.+ ++.|||+|+.++.+|.+|+++++....- ...........
T Consensus 5 ~~~~~~~LP~eil~~If~~L~~~d~~~-~~~vc~~W~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~ 83 (336)
T 2ast_B 5 PGVSWDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMD 83 (336)
T ss_dssp --CCSSSSCHHHHHHHHTTSCHHHHHH-TTSSCHHHHHHHTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEEC
T ss_pred ccCChhhCCHHHHHHHHHhCCHHHHHH-HHHHHHHHHHHhcCchhheeeccccccCCHHHHHhhhhccceEEEcCCcccc
Confidence 467899999999999999999999999 9999999999999999999999975310 00000000000
Q ss_pred -------------ee-cCCChHHHH-HHHHHHHHhcCCCccEEEccCCCCCCHHHHHHHHhhCCCCcEEEcCCCCCCCHH
Q 021719 74 -------------YV-HGHSDKQLT-RILKISLSLSRGSIRTLIFHFNLYVSDDQLTYTAERCPQLKRLVMPAWNRIKKT 138 (308)
Q Consensus 74 -------------~~-~~~~~~~l~-~~l~~~~~~s~~~l~~l~l~~~~~~~d~~l~~l~~~~~~L~~L~L~~~~~~~~~ 138 (308)
.+ ..... +. ..+.. .-.....++.+.+..+ .+++.....++. +++|++|+++++..+++.
T Consensus 84 ~~~~~~~~~~~L~~L~L~~~~--l~~~~~~~-~~~~~~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~L~~~~~l~~~ 158 (336)
T 2ast_B 84 QPLAEHFSPFRVQHMDLSNSV--IEVSTLHG-ILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEF 158 (336)
T ss_dssp SCCCSCCCCBCCCEEECTTCE--ECHHHHHH-HHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHH
T ss_pred ccchhhccCCCCCEEEccCCC--cCHHHHHH-HHhhCCCCCEEeCcCc-ccCHHHHHHHhc-CCCCCEEECCCCCCCCHH
Confidence 00 00000 00 10111 1123456666666555 355555555543 666666666666556665
Q ss_pred HHHHHHhcCCCCCEEEeCCC-CCChHHHHHHHHcCC-CCCeeEecCC---CCHHHHHHHHhcCCCCcEEEeeCCC-CCHH
Q 021719 139 GICKAIRMWRDLESLTMPSI-ANPPYLMEEIAQNCR-NFRELKIMGP---FDLLFASTLNMYLPKLKVLSLRCTT-LNRD 212 (308)
Q Consensus 139 ~l~~~~~~~~~L~~L~l~~~-~~~~~~l~~l~~~~~-~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~~~~-it~~ 212 (308)
++...+..+++|++|++++| .+++..+..+...+| +|++|+++++ +++..+......+|+|++|+++++. +++.
T Consensus 159 ~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~ 238 (336)
T 2ast_B 159 ALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKND 238 (336)
T ss_dssp HHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGG
T ss_pred HHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHH
Confidence 66666666666666666666 666555555555566 6666666654 4545555555566666666666555 5555
Q ss_pred HHHHHHHcCCCCCEEecccCCCcC
Q 021719 213 ALILILDGLQNLEVLNISHCLLID 236 (308)
Q Consensus 213 ~l~~l~~~~p~L~~L~l~~C~~i~ 236 (308)
++..+ ..+++|++|++++|..++
T Consensus 239 ~~~~l-~~l~~L~~L~l~~~~~~~ 261 (336)
T 2ast_B 239 CFQEF-FQLNYLQHLSLSRCYDII 261 (336)
T ss_dssp GGGGG-GGCTTCCEEECTTCTTCC
T ss_pred HHHHH-hCCCCCCEeeCCCCCCCC
Confidence 54433 445666666666665444
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 308 | ||||
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 3e-06 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 4e-04 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 0.002 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.2 bits (97), Expect = 3e-06
Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%)
Query: 11 WEDLDNDILVKIFQSFDIFELTSGIAHVCSSWRSACCDPLLW 52
W+ L +++L+ IF + EL ++ VC W D LW
Sbjct: 1 WDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLW 41
|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 308 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.66 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.64 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.1 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.03 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 99.01 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.97 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.93 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.91 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.76 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.7 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.7 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.59 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.53 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.37 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.25 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.1 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.05 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.94 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.91 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.81 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.65 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.63 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.52 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.47 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.39 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.39 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.34 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.28 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.23 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.0 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.65 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.55 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.34 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.34 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.21 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.08 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.97 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 95.93 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.79 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.4 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 93.92 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 93.86 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 90.87 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 90.25 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 89.76 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66 E-value=5.6e-16 Score=132.41 Aligned_cols=143 Identities=19% Similarity=0.177 Sum_probs=106.9
Q ss_pred HhcCCCccEEEccCCCCCCHHHHHHHHhhCCCCcEEEcCCCCCCCHHHHHHHHhcCCCCCEEEeCCC-CCChHHHH-HHH
Q 021719 92 SLSRGSIRTLIFHFNLYVSDDQLTYTAERCPQLKRLVMPAWNRIKKTGICKAIRMWRDLESLTMPSI-ANPPYLME-EIA 169 (308)
Q Consensus 92 ~~s~~~l~~l~l~~~~~~~d~~l~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~l~~~-~~~~~~l~-~l~ 169 (308)
...+.+++++.+.++ .+++..+..++ .+++|++|++++|..+++.++..++..||+|++|++++| .++++.+. .+.
T Consensus 67 ~~~c~~L~~L~L~~~-~l~~~~~~~l~-~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~ 144 (284)
T d2astb2 67 LSQCSKLQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVA 144 (284)
T ss_dssp HTTBCCCSEEECTTC-BCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHH
T ss_pred HHhCCCccccccccc-CCCcHHHHHHh-cCCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhc
Confidence 334677888888776 46777777766 477888888888888888888888888888888888887 56666654 345
Q ss_pred HcCCCCCeeEecCC---CCHHHHHHHHhcCCCCcEEEee-CCCCCHHHHHHHHHcCCCCCEEecccCCCcCC
Q 021719 170 QNCRNFRELKIMGP---FDLLFASTLNMYLPKLKVLSLR-CTTLNRDALILILDGLQNLEVLNISHCLLIDV 237 (308)
Q Consensus 170 ~~~~~L~~L~l~~~---~~~~~~~~l~~~~p~L~~L~L~-~~~it~~~l~~l~~~~p~L~~L~l~~C~~i~~ 237 (308)
..+++|+.|++.++ +++.++..++.+||+|++|+++ +..+++.++..+ ..||+|++|++++|..+++
T Consensus 145 ~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l-~~~~~L~~L~L~~C~~i~~ 215 (284)
T d2astb2 145 HVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF-FQLNYLQHLSLSRCYDIIP 215 (284)
T ss_dssp HSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGG-GGCTTCCEEECTTCTTCCG
T ss_pred ccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhh-cccCcCCEEECCCCCCCCh
Confidence 55678888888764 6777777777788888888887 456787776665 3578888888888887775
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|