Citrus Sinensis ID: 021797
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| 225461677 | 457 | PREDICTED: rab3 GTPase-activating protei | 0.996 | 0.669 | 0.867 | 1e-156 | |
| 224116998 | 354 | predicted protein [Populus trichocarpa] | 0.996 | 0.864 | 0.809 | 1e-146 | |
| 255567076 | 484 | rab3 gtpase-activating protein non-catal | 0.967 | 0.613 | 0.810 | 1e-141 | |
| 15231948 | 455 | uncharacterized protein [Arabidopsis tha | 1.0 | 0.674 | 0.783 | 1e-141 | |
| 356543215 | 459 | PREDICTED: rab3 GTPase-activating protei | 0.993 | 0.664 | 0.802 | 1e-141 | |
| 297830038 | 455 | hypothetical protein ARALYDRAFT_478912 [ | 1.0 | 0.674 | 0.779 | 1e-141 | |
| 449456579 | 456 | PREDICTED: rab3 GTPase-activating protei | 0.993 | 0.668 | 0.774 | 1e-140 | |
| 449516756 | 456 | PREDICTED: rab3 GTPase-activating protei | 0.993 | 0.668 | 0.774 | 1e-140 | |
| 356514563 | 460 | PREDICTED: rab3 GTPase-activating protei | 0.993 | 0.663 | 0.786 | 1e-138 | |
| 115478506 | 469 | Os09g0315800 [Oryza sativa Japonica Grou | 0.993 | 0.650 | 0.726 | 1e-128 |
| >gi|225461677|ref|XP_002285458.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit [Vitis vinifera] gi|302142895|emb|CBI20190.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 558 bits (1438), Expect = e-156, Method: Compositional matrix adjust.
Identities = 268/309 (86%), Positives = 294/309 (95%), Gaps = 3/309 (0%)
Query: 1 MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGP 60
MPGV+ARFDG+++Q MLQRWFQD++S FWD+KPK+RD ED E SY RLP+QLWNVSKYGP
Sbjct: 150 MPGVIARFDGADLQSMLQRWFQDTHSQFWDEKPKRRDQEDSEKSYGRLPYQLWNVSKYGP 209
Query: 61 CADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPAT 120
CADAAITG MPPPLME+QSSQRY+CAVTIG+D+VISAFRLSEDR+RSLVGAILSKVVPAT
Sbjct: 210 CADAAITGTMPPPLMELQSSQRYYCAVTIGDDAVISAFRLSEDRNRSLVGAILSKVVPAT 269
Query: 121 FSTISSLSKMIWRSEQ-SPKKSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAIT 179
FSTI+S SKMIWRSEQ SPK+SEPKPQ FARASPLTCLKDHPRKGE+LTLSPSG+LAAIT
Sbjct: 270 FSTIASFSKMIWRSEQKSPKRSEPKPQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAIT 329
Query: 180 DSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKD-AATSSAYYAPVKSDYCLCLAI 238
DSLGRILLLDTQALVVVRLWKGYRDASC+F EMLV+KD AA+SS+YY PVKSDYCLCLAI
Sbjct: 330 DSLGRILLLDTQALVVVRLWKGYRDASCLFTEMLVSKDTAASSSSYYEPVKSDYCLCLAI 389
Query: 239 HAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQ 298
HAPRKGI+EVWQMRTGPRLLT+QC+KGSKILQPTYRFGSSM SPYVPLEVFLLNGDSGQ
Sbjct: 390 HAPRKGIVEVWQMRTGPRLLTVQCSKGSKILQPTYRFGSSMG-SPYVPLEVFLLNGDSGQ 448
Query: 299 LSVLNRSLS 307
LSVLNRSL+
Sbjct: 449 LSVLNRSLN 457
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224116998|ref|XP_002331804.1| predicted protein [Populus trichocarpa] gi|222874500|gb|EEF11631.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255567076|ref|XP_002524520.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] gi|223536194|gb|EEF37847.1| rab3 gtpase-activating protein non-catalytic subunit, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15231948|ref|NP_188109.1| uncharacterized protein [Arabidopsis thaliana] gi|8777474|dbj|BAA97054.1| unnamed protein product [Arabidopsis thaliana] gi|63147384|gb|AAY34165.1| At3g14910 [Arabidopsis thaliana] gi|115646783|gb|ABJ17116.1| At3g14910 [Arabidopsis thaliana] gi|332642066|gb|AEE75587.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356543215|ref|XP_003540058.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297830038|ref|XP_002882901.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] gi|297328741|gb|EFH59160.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449456579|ref|XP_004146026.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449516756|ref|XP_004165412.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356514563|ref|XP_003525975.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|115478506|ref|NP_001062848.1| Os09g0315800 [Oryza sativa Japonica Group] gi|51091645|dbj|BAD36414.1| rab3-GAP regulatory domain-like [Oryza sativa Japonica Group] gi|113631081|dbj|BAF24762.1| Os09g0315800 [Oryza sativa Japonica Group] gi|218201904|gb|EEC84331.1| hypothetical protein OsI_30840 [Oryza sativa Indica Group] gi|222641308|gb|EEE69440.1| hypothetical protein OsJ_28835 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| TAIR|locus:2086390 | 455 | AT3G14910 "AT3G14910" [Arabido | 1.0 | 0.674 | 0.783 | 9.3e-130 | |
| UNIPROTKB|E1BVG8 | 1386 | RAB3GAP2 "Uncharacterized prot | 0.697 | 0.154 | 0.316 | 9.9e-23 | |
| UNIPROTKB|E2R4W9 | 1540 | RAB3GAP2 "Uncharacterized prot | 0.690 | 0.137 | 0.308 | 8.1e-22 | |
| UNIPROTKB|Q9H2M9 | 1393 | RAB3GAP2 "Rab3 GTPase-activati | 0.690 | 0.152 | 0.308 | 1.2e-21 | |
| UNIPROTKB|D4ABP4 | 1367 | Rab3gap2 "Rab3 GTPase-activati | 0.690 | 0.155 | 0.308 | 1.8e-21 | |
| ZFIN|ZDB-GENE-030616-610 | 1373 | rab3gap2 "RAB3 GTPase activati | 0.589 | 0.131 | 0.341 | 4.3e-21 | |
| RGD|1311518 | 1386 | Rab3gap2 "RAB3 GTPase activati | 0.690 | 0.152 | 0.303 | 5e-21 | |
| MGI|MGI:1916043 | 1366 | Rab3gap2 "RAB3 GTPase activati | 0.690 | 0.155 | 0.303 | 8e-21 | |
| UNIPROTKB|F1S9J9 | 1391 | RAB3GAP2 "Uncharacterized prot | 0.690 | 0.152 | 0.303 | 8.2e-21 | |
| UNIPROTKB|G5E601 | 1392 | RAB3GAP2 "Uncharacterized prot | 0.690 | 0.152 | 0.299 | 1.7e-20 |
| TAIR|locus:2086390 AT3G14910 "AT3G14910" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1273 (453.2 bits), Expect = 9.3e-130, P = 9.3e-130
Identities = 242/309 (78%), Positives = 275/309 (88%)
Query: 1 MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGP 60
+PGV+ARFDGS IQ M+Q+W Q+ NSNFWDQK ++ D+ED + Y+RLP+Q+WNV+K G
Sbjct: 147 LPGVIARFDGSNIQSMVQKWVQEKNSNFWDQKNRKGDAEDTGSLYQRLPYQIWNVNKNGV 206
Query: 61 CADAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPAT 120
C DA +TG+MPPPL+E+QSSQRY+CAVTIGEDSVISA+RLSEDR RSLVGAILSKVVPA
Sbjct: 207 CVDATVTGVMPPPLLELQSSQRYYCAVTIGEDSVISAYRLSEDRGRSLVGAILSKVVPAA 266
Query: 121 FSTISSLSKMIWRS-EQSPK-KSEPKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAI 178
STI+S SK+IWRS +QSPK K E K QSFARAS LTC+KD+PRKGE+LTLSPSG+LAAI
Sbjct: 267 ASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAI 326
Query: 179 TDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLCLAI 238
TDSLGRILLLDTQALVVVRLWKGYRDASCVFMEML KD S + PVKSDYCLCLAI
Sbjct: 327 TDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGKSVIHTEPVKSDYCLCLAI 386
Query: 239 HAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMASSPYVPLEVFLLNGDSGQ 298
HAPRKGIIEVWQMRTGPRLLTIQCAKGSK+LQP YRFGS+ +SSPY+PLEVFLLNGDSGQ
Sbjct: 387 HAPRKGIIEVWQMRTGPRLLTIQCAKGSKLLQPAYRFGSNSSSSPYIPLEVFLLNGDSGQ 446
Query: 299 LSVLNRSLS 307
+S+LNRSLS
Sbjct: 447 VSMLNRSLS 455
|
|
| UNIPROTKB|E1BVG8 RAB3GAP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4W9 RAB3GAP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H2M9 RAB3GAP2 "Rab3 GTPase-activating protein non-catalytic subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4ABP4 Rab3gap2 "Rab3 GTPase-activating protein non-catalytic subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030616-610 rab3gap2 "RAB3 GTPase activating protein subunit 2 (non-catalytic)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1311518 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916043 Rab3gap2 "RAB3 GTPase activating protein subunit 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S9J9 RAB3GAP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E601 RAB3GAP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| PF14655 | 415 | RAB3GAP2_N: Rab3 GTPase-activating protein regulat | 100.0 | |
| KOG2727 | 1244 | consensus Rab3 GTPase-activating protein, non-cata | 100.0 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 97.07 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 97.05 | |
| KOG0266 | 456 | consensus WD40 repeat-containing protein [General | 96.98 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 96.92 | |
| PTZ00421 | 493 | coronin; Provisional | 96.79 | |
| KOG0649 | 325 | consensus WD40 repeat protein [General function pr | 96.75 | |
| KOG0299 | 479 | consensus U3 snoRNP-associated protein (contains W | 96.75 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 96.36 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 96.32 | |
| PTZ00421 | 493 | coronin; Provisional | 96.25 | |
| PTZ00420 | 568 | coronin; Provisional | 95.94 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 95.91 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 95.85 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 95.77 | |
| KOG0263 | 707 | consensus Transcription initiation factor TFIID, s | 95.61 | |
| KOG0271 | 480 | consensus Notchless-like WD40 repeat-containing pr | 95.55 | |
| PTZ00420 | 568 | coronin; Provisional | 95.33 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 95.08 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 94.92 | |
| KOG0639 | 705 | consensus Transducin-like enhancer of split protei | 94.82 | |
| KOG0272 | 459 | consensus U4/U6 small nuclear ribonucleoprotein Pr | 94.59 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 94.56 | |
| KOG0265 | 338 | consensus U5 snRNP-specific protein-like factor an | 94.53 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 94.42 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 94.33 | |
| KOG2727 | 1244 | consensus Rab3 GTPase-activating protein, non-cata | 94.19 | |
| KOG0284 | 464 | consensus Polyadenylation factor I complex, subuni | 94.15 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 94.15 | |
| KOG0315 | 311 | consensus G-protein beta subunit-like protein (con | 94.05 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 93.69 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 93.6 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 93.19 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 93.12 | |
| KOG0279 | 315 | consensus G protein beta subunit-like protein [Sig | 93.1 | |
| KOG1273 | 405 | consensus WD40 repeat protein [General function pr | 92.84 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 92.52 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 92.24 | |
| KOG0291 | 893 | consensus WD40-repeat-containing subunit of the 18 | 92.18 | |
| KOG0277 | 311 | consensus Peroxisomal targeting signal type 2 rece | 92.17 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 92.13 | |
| KOG1407 | 313 | consensus WD40 repeat protein [Function unknown] | 92.01 | |
| KOG0285 | 460 | consensus Pleiotropic regulator 1 [RNA processing | 91.72 | |
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 91.45 | |
| KOG1912 | 1062 | consensus WD40 repeat protein [General function pr | 91.43 | |
| KOG0319 | 775 | consensus WD40-repeat-containing subunit of the 18 | 91.28 | |
| PF15492 | 282 | Nbas_N: Neuroblastoma-amplified sequence, N termin | 91.07 | |
| KOG0308 | 735 | consensus Conserved WD40 repeat-containing protein | 90.95 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 90.89 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 90.83 | |
| KOG0310 | 487 | consensus Conserved WD40 repeat-containing protein | 90.71 | |
| KOG1188 | 376 | consensus WD40 repeat protein [General function pr | 90.5 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 89.88 | |
| KOG0273 | 524 | consensus Beta-transducin family (WD-40 repeat) pr | 89.74 | |
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 89.46 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 89.44 | |
| KOG0282 | 503 | consensus mRNA splicing factor [Function unknown] | 89.01 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 88.77 | |
| KOG0316 | 307 | consensus Conserved WD40 repeat-containing protein | 88.76 | |
| KOG0318 | 603 | consensus WD40 repeat stress protein/actin interac | 88.52 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 87.26 | |
| KOG0275 | 508 | consensus Conserved WD40 repeat-containing protein | 86.57 | |
| KOG0286 | 343 | consensus G-protein beta subunit [General function | 86.19 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 86.13 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 86.09 | |
| KOG1539 | 910 | consensus WD repeat protein [General function pred | 85.83 | |
| KOG0295 | 406 | consensus WD40 repeat-containing protein [Function | 85.36 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 85.13 | |
| KOG1274 | 933 | consensus WD40 repeat protein [General function pr | 85.05 | |
| KOG0264 | 422 | consensus Nucleosome remodeling factor, subunit CA | 83.58 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 83.3 | |
| KOG0280 | 339 | consensus Uncharacterized conserved protein [Amino | 83.3 | |
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 82.88 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 82.85 | |
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 82.73 | |
| KOG0296 | 399 | consensus Angio-associated migratory cell protein | 82.69 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 82.53 | |
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 82.25 | |
| KOG0267 | 825 | consensus Microtubule severing protein katanin p80 | 82.0 | |
| KOG1408 | 1080 | consensus WD40 repeat protein [Function unknown] | 81.77 | |
| KOG1446 | 311 | consensus Histone H3 (Lys4) methyltransferase comp | 81.6 | |
| KOG0306 | 888 | consensus WD40-repeat-containing subunit of the 18 | 81.56 | |
| KOG3914 | 390 | consensus WD repeat protein WDR4 [Function unknown | 81.37 | |
| KOG0301 | 745 | consensus Phospholipase A2-activating protein (con | 80.31 | |
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 80.19 |
| >PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-73 Score=559.48 Aligned_cols=257 Identities=36% Similarity=0.550 Sum_probs=212.7
Q ss_pred CCceEEEEechhHHHHHHHHHHhhccccCCCCCccCCcccccCCCCCccccccccCCCcceeeeEEeccCCCCchhhh--
Q 021797 1 MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ-- 78 (307)
Q Consensus 1 y~~~i~~i~G~~l~~~L~~c~~q~~~~~~~~~~~~~~~~~~~~~~~~L~ykKW~~~~~~~i~Daa~~G~~~pp~~~~~-- 78 (307)
||++||+|||+||+++|++|++|++++.|+. .+ ...+++|+||||+|++++.|+|++++|+++|++|||.
T Consensus 136 y~~~v~~Idg~sL~~~L~~~~~~~~~~~~~~-------~~-~~~~~~L~ykKw~l~~~~~i~D~~~~G~~~~~~fd~l~~ 207 (415)
T PF14655_consen 136 YPSAVVIIDGFSLFSVLRACRNQVARGAASG-------SD-SPAPPPLSYKKWNLQSQDTINDAAICGPMPPSTFDHLVT 207 (415)
T ss_pred ECCEEEEEecHHHHHHHHHHHHhhhhhhhcc-------cc-cCCCCccceeEecCCCCCcEeeEEEecCCCCcHHHHHHh
Confidence 8999999999999999999999999984222 22 3457889999999999999999999999999999973
Q ss_pred ------------ccccceeEEEecCCceeEEEeecCCCCcchhhHHHhhhhh-HHHHHHHhhhhhhccC--CCCCCC-CC
Q 021797 79 ------------SSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVP-ATFSTISSLSKMIWRS--EQSPKK-SE 142 (307)
Q Consensus 79 ------------s~~~~~~~i~vG~~P~la~y~~~~~~~~s~~~a~~s~va~-Av~s~~~s~ak~~W~~--~~~~~~-~e 142 (307)
+...++++|++|++||+|||+++|+.+++ ++++|+. +|+++++++.+.+|+. +.++++ ++
T Consensus 208 aS~~gf~a~~~~s~~~~~~~i~~G~~P~v~f~~~~e~~s~~----~ls~va~~aVas~l~sav~~~lg~~~~~~~~~~~~ 283 (415)
T PF14655_consen 208 ASIGGFNAKYRSSPPRMSRYITVGSSPFVSFYYASEGSSQP----LLSDVASSAVASKLTSAVSGWLGWGSWRSEQQPQE 283 (415)
T ss_pred hhcccccceeecCCcceEEEEEecCCceEEEEEccCCCCcc----cHHHHHHHHHHHHHHhhhHhhcccCCCCCcccccc
Confidence 34577899999999999999988877775 5667777 8888888876644433 332221 11
Q ss_pred -----CCCCCcccCCCCccccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCCceeEEeecccccceeeEEEEEeccc
Q 021797 143 -----PKPQSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKD 217 (307)
Q Consensus 143 -----~~p~~~~~a~pl~~l~D~~R~~~~I~lsP~~~lAavtDslGRV~LiD~~~~~ivRmWKGyRDAqc~Wi~~~~~~~ 217 (307)
+++++.++....++|+|++|++++|++||+++|||+||+||||+|+|+++++|||||||||||||+|+++.++.+
T Consensus 284 ~~~~~~~~~~~~~l~~r~~l~D~~R~~~~i~~sP~~~laA~tDslGRV~LiD~~~~~vvrmWKGYRdAqc~wi~~~~~~~ 363 (415)
T PF14655_consen 284 KQPPEPKPEPAAPLPMRFGLPDSKREGESICLSPSGRLAAVTDSLGRVLLIDVARGIVVRMWKGYRDAQCGWIEVPEEGD 363 (415)
T ss_pred ccccccCcCCCcccceEEeeccCCceEEEEEECCCCCEEEEEcCCCcEEEEECCCChhhhhhccCccceEEEEEeecccc
Confidence 122332222233679999999999999999999999999999999999999999999999999999999999876
Q ss_pred ccccccccCCCCCCcceEEEEEcCCCCeEEEeecCCCCeEEEEEecCCeEEe
Q 021797 218 AATSSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKIL 269 (307)
Q Consensus 218 ~~~~~~~~~~~k~~~~l~LVIyaprRg~lEVW~~~~G~RV~a~~v~~~~~Ll 269 (307)
+..+..+....+.+.+|||||||||||+||||+||||+||+||+|+|+||||
T Consensus 364 ~~~~~~~~~~~~~~~~l~LvIyaprRg~lEvW~~~~g~Rv~a~~v~k~~rLl 415 (415)
T PF14655_consen 364 RDRSNSNSPKSSSRFALFLVIYAPRRGILEVWSMRQGPRVAAFNVGKGCRLL 415 (415)
T ss_pred cccccccccCCCCcceEEEEEEeccCCeEEEEecCCCCEEEEEEeCCCcEEC
Confidence 5333334444556679999999999999999999999999999999999997
|
|
| >KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0266 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0649 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG2727 consensus Rab3 GTPase-activating protein, non-catalytic subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1273 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >KOG1407 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1912 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal | Back alignment and domain information |
|---|
| >KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1188 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0282 consensus mRNA splicing factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0286 consensus G-protein beta subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG1539 consensus WD repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0295 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1274 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1408 consensus WD40 repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3914 consensus WD repeat protein WDR4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 307 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 40.2 bits (93), Expect = 8e-04
Identities = 49/292 (16%), Positives = 86/292 (29%), Gaps = 83/292 (28%)
Query: 2 PGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERL-PHQLWNVSKYGP 60
P L+ I+ L W + W + + +E+S L P + + +
Sbjct: 327 PRRLSII-AESIRDGLATW------DNWKHVNCDKLTTIIESSLNVLEPAEYRKM--FDR 377
Query: 61 CA----DAAITGLMPPPLMEVQSSQRYFCAVTIGEDSVISAFRLSEDRSRSLV------G 110
+ A I P L+ + + V + V+ +++ SLV
Sbjct: 378 LSVFPPSAHI----PTILLSL-----IWFDVIKSDVMVV----VNKLHKYSLVEKQPKES 424
Query: 111 AI----LSKVVPATFSTISSLSKMIWRSEQSPKKSEP----KPQ------SFARASPLTC 156
I + + +L + I PK + P S
Sbjct: 425 TISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSH-------- 476
Query: 157 LKDH---PRKGERLTLSPSGSL----------AAITDSLGRILLLDTQALVVVRLWKGYR 203
+ H ER+TL L T +L+T L ++ +K Y
Sbjct: 477 IGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNT--LQQLKFYKPYI 534
Query: 204 DASCVFMEMLVN------KDAATSSAYYAPVKSDYC--LCLAIHAPRKGIIE 247
+ E LVN + + S Y L +A+ A + I E
Sbjct: 535 CDNDPKYERLVNAILDFLPKIEENL-----ICSKYTDLLRIALMAEDEAIFE 581
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.97 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.83 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.82 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 97.7 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 97.67 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 97.67 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.63 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 97.63 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.62 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 97.47 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 97.47 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.43 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 97.37 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.36 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 97.36 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 97.35 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 97.34 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 97.33 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 97.32 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 97.31 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.3 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 97.29 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.28 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 97.27 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 97.27 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 97.27 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 97.24 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 97.23 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.23 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 97.21 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.2 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.2 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 97.18 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 97.18 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 97.18 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 97.17 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 97.16 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 97.16 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 97.16 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 97.15 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 97.14 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 97.12 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.11 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 97.11 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 97.09 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.09 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.07 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 97.05 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 97.04 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 97.04 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.04 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 97.0 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.0 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 96.97 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 96.95 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 96.93 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 96.93 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 96.87 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 96.85 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 96.82 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.8 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 96.79 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 96.78 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 96.78 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 96.77 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 96.75 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 96.74 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 96.74 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 96.72 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 96.72 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 96.71 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 96.7 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 96.63 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 96.62 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 96.62 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 96.57 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 96.57 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 96.56 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 96.56 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 96.55 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 96.54 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 96.54 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 96.54 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 96.51 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 96.49 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 96.47 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 96.46 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 96.44 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 96.41 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 96.41 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 96.37 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 96.36 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 96.36 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 96.36 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 96.35 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 96.32 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 96.32 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 96.31 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 96.31 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 96.28 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 96.28 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 96.26 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 96.26 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 96.18 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 96.14 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 96.13 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 96.13 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 96.11 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 96.1 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 96.08 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 96.05 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 96.04 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 96.0 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 95.86 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 95.85 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 95.84 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 95.81 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 95.75 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 95.65 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 95.65 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 95.64 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 95.6 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 95.58 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 95.5 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 95.45 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 95.44 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 95.42 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 95.38 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 95.37 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 95.31 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 95.0 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 94.88 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 94.85 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 94.84 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 94.69 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 94.66 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 94.64 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 94.61 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 94.59 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 94.55 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 94.21 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 94.18 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 94.1 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 93.99 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 93.99 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 93.95 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 93.87 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 93.77 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 93.57 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 93.53 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 93.37 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 93.37 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 93.26 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 93.24 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 93.17 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 93.0 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 92.86 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 92.76 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 92.73 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 92.48 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 92.35 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 92.34 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 92.33 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 92.33 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 92.25 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 92.23 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 92.05 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 91.94 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 91.76 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 91.67 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 91.6 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 91.39 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 91.31 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 91.14 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 90.95 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 90.81 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 90.1 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 90.09 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 89.82 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 89.7 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 89.47 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 89.08 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 88.6 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 88.37 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 88.3 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 88.28 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 88.24 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 88.2 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 88.09 | |
| 2ece_A | 462 | 462AA long hypothetical selenium-binding protein; | 87.2 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 86.68 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 86.55 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 86.29 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 86.0 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 85.47 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 85.26 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 84.87 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 84.71 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 84.63 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 84.5 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 84.4 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 84.37 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 84.21 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 82.9 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 82.46 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 81.96 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 81.6 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 81.42 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 81.33 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 80.82 |
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=97.97 E-value=0.0002 Score=62.57 Aligned_cols=90 Identities=11% Similarity=0.066 Sum_probs=71.8
Q ss_pred cccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCCceeEEeecccccceeeEEEEEecccccccccccCCCCCCcceE
Q 021797 156 CLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCLC 235 (307)
Q Consensus 156 ~l~D~~R~~~~I~lsP~~~lAavtDslGRV~LiD~~~~~ivRmWKGyRDAqc~Wi~~~~~~~~~~~~~~~~~~k~~~~l~ 235 (307)
.|..+...+.+|+.+|+++++++++..|.|.++|+.++..++.++|+.+. |....-. ++..
T Consensus 27 ~l~~h~~~v~~~~~s~~~~~l~~~~~dg~i~vwd~~~~~~~~~~~~h~~~----v~~~~~~-------------~~~~-- 87 (369)
T 3zwl_B 27 KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGT----IWSIDVD-------------CFTK-- 87 (369)
T ss_dssp EEECCSSCEEEEEECTTSCEEEEEESSSCEEEEETTTCCEEEEECCCSSC----EEEEEEC-------------TTSS--
T ss_pred EEEEeeceEEEEEEcCCCCEEEEEeCCCEEEEEeCCCchhhhhhhhcCCc----EEEEEEc-------------CCCC--
Confidence 38889999999999999999999999999999999999999999998873 3221110 0111
Q ss_pred EEEEcCCCCeEEEeecCCCCeEEEEEecC
Q 021797 236 LAIHAPRKGIIEVWQMRTGPRLLTIQCAK 264 (307)
Q Consensus 236 LVIyaprRg~lEVW~~~~G~RV~a~~v~~ 264 (307)
+++.+-.+|.|.||+++++..+..+....
T Consensus 88 ~l~s~~~dg~i~iwd~~~~~~~~~~~~~~ 116 (369)
T 3zwl_B 88 YCVTGSADYSIKLWDVSNGQCVATWKSPV 116 (369)
T ss_dssp EEEEEETTTEEEEEETTTCCEEEEEECSS
T ss_pred EEEEEeCCCeEEEEECCCCcEEEEeecCC
Confidence 33566779999999999999998887433
|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 97.69 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 97.64 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.55 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 97.51 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.46 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.43 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.36 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 97.27 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.25 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 97.19 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 97.13 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 97.07 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.98 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 96.9 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 96.88 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 96.88 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 96.87 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 96.86 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 96.83 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 96.83 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 96.81 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.72 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 96.67 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 96.55 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.4 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.7 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 95.7 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 95.67 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 95.59 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 95.54 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 95.46 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 95.39 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 95.38 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 95.33 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 95.29 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 95.28 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 95.21 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.03 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.95 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 94.52 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.27 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 92.84 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 92.78 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 91.35 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 91.22 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 90.64 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 87.62 |
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: F-box/WD-repeat protein 1 (beta-TRCP1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.69 E-value=0.00021 Score=57.15 Aligned_cols=87 Identities=18% Similarity=0.204 Sum_probs=64.7
Q ss_pred ccccCCCceeeEEEECCCCCEEEEEcCCCcEEEEEcCCceeEEeecccccceeeEEEEEecccccccccccCCCCCCcce
Q 021797 155 TCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAATSSAYYAPVKSDYCL 234 (307)
Q Consensus 155 ~~l~D~~R~~~~I~lsP~~~lAavtDslGRV~LiD~~~~~ivRmWKGyRDAqc~Wi~~~~~~~~~~~~~~~~~~k~~~~l 234 (307)
.++.+..+.+. |++|+|+++|+....|.|.|+|+.++..++.++|+.+. |..... + ..
T Consensus 9 ~~~~~~~~~V~--c~~~d~~~l~sgs~Dg~i~vWd~~~~~~~~~l~~H~~~----V~~v~~-~--------------~~- 66 (293)
T d1p22a2 9 HCRSETSKGVY--CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGS----VLCLQY-D--------------ER- 66 (293)
T ss_dssp ECCCSSCCCEE--EEECCSSEEEEEESSSCEEEEESSSCCEEEEECCCSSC----EEEEEC-C--------------SS-
T ss_pred eccCCCCCCEE--EEEEcCCEEEEEeCCCeEEEEECCCCcEEEEEecCCCC----Eeeeec-c--------------cc-
Confidence 44555555554 57899999999999999999999999999999999883 332221 1 01
Q ss_pred EEEEEcCCCCeEEEeecCCCCeEEEEEecC
Q 021797 235 CLAIHAPRKGIIEVWQMRTGPRLLTIQCAK 264 (307)
Q Consensus 235 ~LVIyaprRg~lEVW~~~~G~RV~a~~v~~ 264 (307)
+++-+..+|.|.+|+++.+..........
T Consensus 67 -~l~s~s~D~~i~~~~~~~~~~~~~~~~~~ 95 (293)
T d1p22a2 67 -VIITGSSDSTVRVWDVNTGEMLNTLIHHC 95 (293)
T ss_dssp -EEEEEETTSCEEEEESSSCCEEEEECCCC
T ss_pred -eeecccccccccccccccccccccccccc
Confidence 34567789999999999888776665443
|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|