Citrus Sinensis ID: 021834

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MAIQAAHGYSENNIGLGLGFGYGINPLLGGGGSSPQDLIVDNACCGVGVNGSNGFCFDMQPQKLRQHPQHMQQQQLQHQQQRNQNFDSMPFSQSLALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEEIAKATNRTMELEILLKKLEMESQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNGVEDAESCCDVEEEETEQNRVIGIGFGESNNNYNYKGAAETEQEQRSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALIF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHccccccccccccccccEEEEEccccHHccHHHHHccccccccccccccEEEEEcc
cHHHHHHHccccccccccccccccccccccccccHHHHHHHcccccccEcccccEEEcccHHHHHcccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccccHHHHHHHcccccccccccccccHcccccccccccccccccHHHcccccEEEEEEccccEEccHHHHHHHccccccccccccEEEEEEc
maiqaahgysenniglglgfgyginpllggggsspqdlivdnaccgvgvngsngfcfdmqpqklrqhpqhMQQQQLQHQQQrnqnfdsmpfsqSLALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEEIAKATNRTMELEILLKKLEMESQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCfnngvedaesccdveeeeteqNRVIGigfgesnnnynykgaaeteqeQRSTKMVMVCkgcnsrdscvlflpcrhlcacraceafldtcpvcltpkkASIEALIF
MAIQAAHGYSENNIGLGLGFGYGINPLLGGGGSSPQDLIVDNACCGVGVNGSNGFCFDMQPQKLRQHPQHMQQQQLQHQQQRNQNFDSMPFSQSLALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKieiktsallrqkdeeiakatnrTMELEILLKKLEMESQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNGVEDAESCCDVEEEETEQNrvigigfgesnnnyNYKGAAETEQEQRSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALIF
MAIQAAHGYSENNIGLGLgfgyginpllggggSSPQDLIVDNACCGVGVNGSNGFCFDMQPqklrqhpqhmqqqqlqhqqqrnqnFDSMPFSQSLALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEEIAKATNRTmeleillkklemeSQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNGvedaesccdveeeeteQNRVIGIGFGESNNNYNYKGAAETEQEQRSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALIF
********YSENNIGLGLGFGYGINPLLGGGGSSPQDLIVDNACCGVGVNGSNGFCFD***********************************************IDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQ****IAKATNRTMELEILLKKLEMESQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNGVEDAESCCDVE******NRVIGIGFGES**NY***************KMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKA*******
*AI****GYSENNIGLGLGFGY*****************************************************************************EKQRQEIDHYIISQNE***********************************IAKATNRTMELEILLKKLEMESQ***************L*NS*******************ESCCDVEEEETE************************************CKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALIF
MAIQAAHGYSENNIGLGLGFGYGINPLLGGGGSSPQDLIVDNACCGVGVNGSNGFCFDMQPQK********************QNFDSMPFSQSLALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEEIAKATNRTMELEILLKKLEMESQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNGVEDA************QNRVIGIGFGESNNNYNYKGA***********MVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALIF
MAIQAAHGYSENNIGLGLGFGYGINPLLGGGGSSPQDLIVDNACCGVGVNGSNGFCFDMQPQKLRQHPQHM************Q*FDSMPFSQSLALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEEIAKATNRTMELEILLKKLEMESQAWQRIAQENEAMVFSLNNSLEQLKEKAF*******************************************************VMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIQAAHGYSENNIGLGLGFGYGINPLLGGGGSSPQDLIVDNACCGVGVNGSNGFCFDMQPQKLRQHPQHMQQQQLQHQQQRNQNFDSMPFSQSLALQAEKQRQEIDHYIISQNERLRxxxxxxxxxxxxxxxxxxxxxTSALxxxxxxxxxxxxxxxxxxxxxxxxxxxxSQAWQRIxxxxxxxxxxxxxxxxxxxxxAFCCFNNGVEDAESCCDVEEEETEQNRVIGIGFGESNNNYNYKGAAETEQEQRSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
Q8JHV9401 Baculoviral IAP repeat-co N/A no 0.420 0.321 0.294 1e-05
A5D8Q0488 E3 ubiquitin-protein liga N/A no 0.159 0.100 0.428 8e-05
P98170497 E3 ubiquitin-protein liga yes no 0.162 0.100 0.38 0.0001
Q5BKL8492 E3 ubiquitin-protein liga yes no 0.159 0.099 0.408 0.0001
Q60989496 E3 ubiquitin-protein liga yes no 0.162 0.100 0.38 0.0001
A9ULZ2345 Baculoviral IAP repeat-co N/A no 0.241 0.214 0.32 0.0002
Q9R0I6496 E3 ubiquitin-protein liga yes no 0.162 0.100 0.38 0.0002
A9JTP3365 Baculoviral IAP repeat-co no no 0.195 0.164 0.35 0.0003
O08863600 Baculoviral IAP repeat-co no no 0.208 0.106 0.296 0.0006
Q13489604 Baculoviral IAP repeat-co no no 0.195 0.099 0.283 0.0007
>sp|Q8JHV9|BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis GN=birc7-a PE=1 SV=1 Back     alignment and function desciption
 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 56/136 (41%), Gaps = 7/136 (5%)

Query: 178 IAQENEAMVF--SLNNSLEQLKEKAFCCFNNGVEDAESCCDVEEEETEQNRVIGIGFG-- 233
           +AQ+   M F  SL  SL Q K        + V D  +   V EEET     + +     
Sbjct: 265 VAQDALQMGFKQSLVASLIQSKFLLTGSSYSSVSDLVTDLLVAEEETHSTESVSVSRAPT 324

Query: 234 ---ESNNNYNYKGAAETEQEQRSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDT 290
               S           TE++ R  K   +CK C  +D  +LF+PC HL  C  C   L  
Sbjct: 325 RMERSEPPKESAPPLSTEEQLRRLKEERMCKVCMDKDVSMLFVPCGHLVVCTECAPNLRH 384

Query: 291 CPVCLTPKKASIEALI 306
           CP+C    + S+ A +
Sbjct: 385 CPICRAAIRGSVRAFM 400
Weak apoptotic suppressor. Has E3 ubiquitin-protein ligase activity. Weak inhibitor of caspase activity.
Xenopus laevis (taxid: 8355)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|A5D8Q0|XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis GN=xiap PE=2 SV=2 Back     alignment and function description
>sp|P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens GN=XIAP PE=1 SV=2 Back     alignment and function description
>sp|Q5BKL8|XIAP_XENTR E3 ubiquitin-protein ligase XIAP OS=Xenopus tropicalis GN=xiap PE=2 SV=1 Back     alignment and function description
>sp|Q60989|XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus GN=Xiap PE=1 SV=2 Back     alignment and function description
>sp|A9ULZ2|BIR7B_XENLA Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis GN=birc7-b PE=2 SV=2 Back     alignment and function description
>sp|Q9R0I6|XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus GN=Xiap PE=2 SV=1 Back     alignment and function description
>sp|A9JTP3|BIRC7_XENTR Baculoviral IAP repeat-containing protein 7 OS=Xenopus tropicalis GN=birc7 PE=2 SV=1 Back     alignment and function description
>sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 Back     alignment and function description
>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
118482189271 unknown [Populus trichocarpa] 0.811 0.918 0.538 3e-67
224078329255 predicted protein [Populus trichocarpa] 0.693 0.835 0.584 6e-67
225428035286 PREDICTED: uncharacterized protein LOC10 0.885 0.951 0.507 2e-60
297744606216 unnamed protein product [Vitis vinifera] 0.661 0.939 0.597 7e-58
449454209273 PREDICTED: uncharacterized protein LOC10 0.651 0.732 0.548 9e-55
356507786292 PREDICTED: uncharacterized protein LOC10 0.687 0.722 0.520 3e-51
356516533287 PREDICTED: uncharacterized protein LOC10 0.667 0.714 0.532 5e-51
255646167287 unknown [Glycine max] 0.667 0.714 0.527 1e-50
224083097268 predicted protein [Populus trichocarpa] 0.768 0.880 0.411 2e-46
30690197265 SBP (S-ribonuclease binding protein) fam 0.846 0.981 0.419 4e-44
>gi|118482189|gb|ABK93023.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 159/295 (53%), Positives = 188/295 (63%), Gaps = 46/295 (15%)

Query: 26  PLLGGGGSSPQDLIVDNACCGVGVNGSNGFCFDMQPQKLRQHPQHMQQQQLQHQQQRNQN 85
           P  GG     QDL+        G  G N + F++Q QK +   Q    Q L +Q QRNQN
Sbjct: 8   PYCGGS----QDLM------DYGCGGLNQY-FNVQQQKQQLQQQCNTHQLLNYQLQRNQN 56

Query: 86  --FDSMPFSQS------------LALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEV 131
             FDS   S S            +A   EKQRQEIDHYI  QNERLRLVLQEQ++QQL +
Sbjct: 57  LFFDSTLASASKNNNSDHLSMGTMASYDEKQRQEIDHYIRLQNERLRLVLQEQKRQQLSL 116

Query: 132 LLKKIEIKTSALLRQKDEEIAKATNRTMELEILLKKLEMESQAWQRIAQENEAMVFSLNN 191
           LLKK+E K   +L+QKDEEIA+A  RT+ELE  LKKLE E+Q WQR+A ENEA V SLNN
Sbjct: 117 LLKKVESKALPILKQKDEEIAQAAKRTVELEDFLKKLEFENQTWQRMALENEAKVISLNN 176

Query: 192 SLEQLKEKAFCCFNNGVEDAESCCDVEEEETEQNRVIGIGFGESNNNYNYKGAAETEQEQ 251
           ++EQL+E A  CFNNG EDAESCCDV  EE                 +    A +T    
Sbjct: 177 TIEQLRENASSCFNNGAEDAESCCDVSREE----------------EWFLDDADDT---- 216

Query: 252 RSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALI 306
            + KMVMVCK CNSR+SC+LFLPCRHLC+C+AC+A LD CPVC TPKKASIEAL+
Sbjct: 217 -ARKMVMVCKRCNSRNSCILFLPCRHLCSCKACDACLDACPVCQTPKKASIEALM 270

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224078329|ref|XP_002305522.1| predicted protein [Populus trichocarpa] gi|222848486|gb|EEE86033.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225428035|ref|XP_002277843.1| PREDICTED: uncharacterized protein LOC100262284 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744606|emb|CBI37868.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454209|ref|XP_004144848.1| PREDICTED: uncharacterized protein LOC101208647 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356507786|ref|XP_003522645.1| PREDICTED: uncharacterized protein LOC100776899 [Glycine max] Back     alignment and taxonomy information
>gi|356516533|ref|XP_003526948.1| PREDICTED: uncharacterized protein LOC100815248 [Glycine max] Back     alignment and taxonomy information
>gi|255646167|gb|ACU23569.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224083097|ref|XP_002306946.1| predicted protein [Populus trichocarpa] gi|222856395|gb|EEE93942.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30690197|ref|NP_195233.2| SBP (S-ribonuclease binding protein) family protein [Arabidopsis thaliana] gi|51536446|gb|AAU05461.1| At4g35070 [Arabidopsis thaliana] gi|51972074|gb|AAU15141.1| At4g35070 [Arabidopsis thaliana] gi|110738622|dbj|BAF01236.1| hypothetical protein [Arabidopsis thaliana] gi|332661057|gb|AEE86457.1| SBP (S-ribonuclease binding protein) family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
TAIR|locus:2131571265 AT4G35070 "AT4G35070" [Arabido 0.377 0.437 0.504 8.4e-41
TAIR|locus:2207385358 BRG2 "BOI-related gene 2" [Ara 0.644 0.553 0.286 2.7e-20
TAIR|locus:2089225335 BRG3 "BOI-related gene 3" [Ara 0.224 0.205 0.380 1.8e-19
TAIR|locus:2825812325 SBP1 "S-ribonuclease binding p 0.182 0.172 0.392 3.6e-17
TAIR|locus:2133990304 RING [Arabidopsis thaliana (ta 0.361 0.365 0.295 4.8e-17
TAIR|locus:2035564312 AT1G32740 "AT1G32740" [Arabido 0.325 0.320 0.32 8.9e-17
TAIR|locus:2153227294 BRG1 "BOI-related gene 1" [Ara 0.332 0.346 0.294 2.7e-15
TAIR|locus:2171042300 AT5G47050 [Arabidopsis thalian 0.358 0.366 0.3 2.9e-15
TAIR|locus:2019983339 AT1G10650 [Arabidopsis thalian 0.635 0.575 0.252 2.2e-14
TAIR|locus:2129336314 AT4G17680 [Arabidopsis thalian 0.351 0.343 0.318 2.4e-13
TAIR|locus:2131571 AT4G35070 "AT4G35070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 287 (106.1 bits), Expect = 8.4e-41, Sum P(2) = 8.4e-41
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query:    92 SQS-LALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEE 150
             SQS LA Q EKQ+QEID +I  QNERLR VLQEQRK+++E++L+K+E K   L+ QK+EE
Sbjct:    70 SQSFLAAQMEKQKQEIDQFIKIQNERLRYVLQEQRKREMEMILRKMESKALLLMSQKEEE 129

Query:   151 IAKATNRTXXXXXXXXXXXXXSQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNG 207
             ++KA N+              +Q WQR+A+ENEA+V +LN +LEQ++E+A  C++ G
Sbjct:   130 MSKALNKNMELEDLLRKMEMENQTWQRMARENEAIVQTLNTTLEQVRERAATCYDAG 186
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2207385 BRG2 "BOI-related gene 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089225 BRG3 "BOI-related gene 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825812 SBP1 "S-ribonuclease binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133990 RING [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035564 AT1G32740 "AT1G32740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153227 BRG1 "BOI-related gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171042 AT5G47050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019983 AT1G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129336 AT4G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.IV.1197.1
SubName- Full=Putative uncharacterized protein; (195 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 4e-08
COG3264 835 COG3264, COG3264, Small-conductance mechanosensiti 1e-04
pfam12037276 pfam12037, DUF3523, Domain of unknown function (DU 7e-04
PRK00286438 PRK00286, xseA, exodeoxyribonuclease VII large sub 0.001
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 48.5 bits (116), Expect = 4e-08
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 260 CKGCNSRDSCVLFLPCRHLCACRACEAFL---DTCPVCLTPKKAS 301
           C  C  R   V+FLPC HLC C  C   L     CP+C  P ++ 
Sbjct: 5   CVICLERPRNVVFLPCGHLCLCEECAKRLRSKKKCPICRQPIESV 49

Length = 49
>gnl|CDD|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) Back     alignment and domain information
>gnl|CDD|234714 PRK00286, xseA, exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.23
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.07
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 99.02
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.94
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.75
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.77
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.73
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 97.51
PHA02929238 N1R/p28-like protein; Provisional 97.46
PF1463444 zf-RING_5: zinc-RING finger domain 97.41
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.39
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.34
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.07
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.05
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.03
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.0
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.68
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 96.53
PHA02926242 zinc finger-like protein; Provisional 96.47
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.47
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 96.25
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 96.01
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.0
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.96
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 95.57
smart0050463 Ubox Modified RING finger domain. Modified RING fi 95.53
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 95.19
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.8
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 94.47
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 94.38
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 93.91
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 93.84
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 92.73
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 92.12
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 92.1
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 91.61
KOG2113394 consensus Predicted RNA binding protein, contains 90.9
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 90.79
PF00038312 Filament: Intermediate filament protein; InterPro: 89.65
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 89.44
PF12240205 Angiomotin_C: Angiomotin C terminal; InterPro: IPR 89.07
KOG3039303 consensus Uncharacterized conserved protein [Funct 88.85
PF04641260 Rtf2: Rtf2 RING-finger 87.95
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 87.82
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.82
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 87.7
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 87.54
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 85.64
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 83.83
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 82.5
KOG3002 299 consensus Zn finger protein [General function pred 82.49
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 82.38
COG5152259 Uncharacterized conserved protein, contains RING a 81.98
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 81.87
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 80.6
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=5e-40  Score=298.05  Aligned_cols=193  Identities=37%  Similarity=0.622  Sum_probs=165.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHhhhHHHHHHHHHHHHHHH
Q 021834           94 SLALQAEKQRQEIDHYIISQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEEIAKATNRTMELEILLKKLEMESQ  173 (307)
Q Consensus        94 ~l~~~l~qQ~~EID~~i~~q~ErLR~~L~E~r~Rh~r~ll~avE~~~~~rLReKe~Eier~~rrn~ELeErlrqL~~E~Q  173 (307)
                      ++++++++|..|||+|++.|.++||..+.+.++|+++.++.++|..+.++||+|++||++++++|++|+++++++++|+|
T Consensus        15 ~~~~~~~~q~~~id~f~~~~~~~l~~~~~~~~~~~~~~~l~~~e~~~~~~l~~k~~ei~~~~~~~~~l~~~~~~~~~e~~   94 (207)
T KOG1100|consen   15 DLASDIQRQSDEIDRFLKIQGEQLRRELEENRQRELRNLLKAVEEALVKKLREKDEEIERIGNLNWELEERVKSLYVEAQ   94 (207)
T ss_pred             cceeecccccchhhHHHHhhHHHHHHHHHHhChHHHHHHHHHHHHHHHHHhhcchhHHHhcccccceehhhhhhhhhhHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhHHHHHHHHHhHHHHHHHhhhccCCCCCcccccccchhhhhhhhhhhcccccCCCCCcccCCchhhHHhhhc
Q 021834          174 AWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNGVEDAESCCDVEEEETEQNRVIGIGFGESNNNYNYKGAAETEQEQRS  253 (307)
Q Consensus       174 ~Wq~~Ak~nEA~a~~Lr~~LqQv~~~~~~~~~~~~dDAeScc~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~e~~~~~~~  253 (307)
                      .|+++|++||+++++|+.+|+|++.+. ......++++.++|+....++.          .+    .|.+.   +.  ..
T Consensus        95 ~w~~~a~~ne~~~~~l~~nl~q~~~~~-~~~~~~~~~~~~~~g~~~~~~~----------~s----~~~~~---~~--~~  154 (207)
T KOG1100|consen   95 IWRDRAQTNEATVNSLRTNLDQVLAQC-PASAPAEERGQKSCGDREADDG----------KS----SYVDP---SV--DN  154 (207)
T ss_pred             HHHHHHHhChHHHHHHHHHHHHHHHhc-ccccCchhhhccccCccccccc----------cc----cccch---hh--hh
Confidence            999999999999999999999999986 2222345677777666653321          00    01100   01  11


Q ss_pred             cccccccccccccccceEEeCCCCcccchhhHhcCCCCCCCCccccceEEEee
Q 021834          254 TKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALI  306 (307)
Q Consensus       254 ~~~~~~C~iC~~~~a~vlLlPCrHlclC~~C~~~l~~CPvCR~~i~~sV~V~l  306 (307)
                      ......|+.|.+++++|+|+||+|+|+|..|...+.+||+|+.+++++++||+
T Consensus       155 ~~~~~~Cr~C~~~~~~VlllPCrHl~lC~~C~~~~~~CPiC~~~~~s~~~v~~  207 (207)
T KOG1100|consen  155 FKRMRSCRKCGEREATVLLLPCRHLCLCGICDESLRICPICRSPKTSSVEVNF  207 (207)
T ss_pred             hhccccceecCcCCceEEeecccceEecccccccCccCCCCcChhhceeeccC
Confidence            22222399999999999999999999999999989999999999999999986

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 5e-05
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 9e-05
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 9e-05
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 1e-04
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 1e-04
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 31/59 (52%)
Query: 248 EQEQRSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALI 306
           E++ R  +    CK C  ++  ++F+PC HL  C+ C   L  CP+C +  K ++   +
Sbjct: 15  EEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFL 73
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 9e-13
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 2e-11
2ea5_A68 Cell growth regulator with ring finger domain prot 9e-11
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 7e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 2e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 8e-05
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 2e-04
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
 Score = 66.9 bits (161), Expect = 9e-13
 Identities = 30/255 (11%), Positives = 70/255 (27%), Gaps = 10/255 (3%)

Query: 52  SNGFCFDMQPQKLRQHPQHMQQQQLQHQQQRNQNFDSMPFSQSLALQAEKQRQEIDHYII 111
                +                      +            QS  L   +  + ++  + 
Sbjct: 100 PPIIHYGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVS 159

Query: 112 SQNERLRLVLQEQRKQQLEVLLKKIEIKTSALLRQKDEEIAKATNRTMELEILLKKLEME 171
           +         +E++++Q E +                +++         L       + E
Sbjct: 160 ALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQE 219

Query: 172 SQAWQRIAQENEAMVFSLNNSLEQLKEKAFCCFNNGVEDAESCCDVEEEETEQNRVIGIG 231
               ++  Q        ++  L +    A    N+  E   +       +     +    
Sbjct: 220 HDIIKQKTQIPLQARELIDTILVKGNAAANIFKNSLKEIDSTLYKNLFVDKNMKYIPTED 279

Query: 232 FGESNNNYNYKGAAETEQEQRSTKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTC 291
               +            ++ R  +    CK C  ++  V+F+PC HL  C+ C   L  C
Sbjct: 280 VSGLSLE----------EQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKC 329

Query: 292 PVCLTPKKASIEALI 306
           P+C    K ++   +
Sbjct: 330 PICRGIIKGTVRTFL 344
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
2ea5_A68 Cell growth regulator with ring finger domain prot 99.43
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.35
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.33
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.32
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.32
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.29
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.99
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.46
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.31
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.3
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.26
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.21
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.17
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.13
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.1
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.08
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.02
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.0
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.98
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.98
2ect_A78 Ring finger protein 126; metal binding protein, st 97.96
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.95
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.95
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.9
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.89
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.87
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.84
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.8
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.79
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.78
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.77
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.72
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.71
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.7
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.67
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.64
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.64
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.62
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.61
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.58
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.58
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.53
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.53
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.44
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.43
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.42
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.35
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.3
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.29
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.28
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.08
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.78
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.77
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.7
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.6
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.5
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.45
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.38
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.19
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 95.55
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 95.4
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 94.94
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.9
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 94.52
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 94.33
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 91.24
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 90.71
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 88.77
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 87.89
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 87.56
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 86.23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 85.81
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 85.72
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 81.79
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 81.6
1ez3_A127 Syntaxin-1A; three helix bundle, endocytosis/exocy 81.28
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.43  E-value=3.6e-14  Score=106.33  Aligned_cols=53  Identities=26%  Similarity=0.652  Sum_probs=49.6

Q ss_pred             cccccccccccccccceEEeCCCCcccchhhHhcCCCCCCCCccccceEEEee
Q 021834          254 TKMVMVCKGCNSRDSCVLFLPCRHLCACRACEAFLDTCPVCLTPKKASIEALI  306 (307)
Q Consensus       254 ~~~~~~C~iC~~~~a~vlLlPCrHlclC~~C~~~l~~CPvCR~~i~~sV~V~l  306 (307)
                      ......|+||+++.++++|+||+|+++|..|...+..||+||.+|...++||.
T Consensus        12 ~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~   64 (68)
T 2ea5_A           12 EENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSG   64 (68)
T ss_dssp             CCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCS
T ss_pred             CCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeec
Confidence            44567999999999999999999999999999999999999999999999985
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.15
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.03
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.9
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.81
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.79
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.61
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.58
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.43
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.37
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.1
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.01
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.89
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.63
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.53
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.14
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.18
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.35  E-value=7.7e-08  Score=72.00  Aligned_cols=48  Identities=31%  Similarity=0.653  Sum_probs=40.4

Q ss_pred             ccccccccccccceEEeCCCCcccchhhHhc-----CCCCCCCCccccceEEEe
Q 021834          257 VMVCKGCNSRDSCVLFLPCRHLCACRACEAF-----LDTCPVCLTPKKASIEAL  305 (307)
Q Consensus       257 ~~~C~iC~~~~a~vlLlPCrHlclC~~C~~~-----l~~CPvCR~~i~~sV~V~  305 (307)
                      ...|.||++...+.+++||+|. +|..|...     ..+||+||..|+..-.|.
T Consensus        23 ~~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~   75 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIV   75 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred             CCCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence            3579999999999999999997 69999743     468999999998765554
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure