Citrus Sinensis ID: 021956

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MMISRRIWQKRPPTSSWIFLRPYTSQISVPSPSPSRFPVQTPSLIGFLSSYAASSFRSVYKISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGDSAVPTPSSDVLESVKPPGSENSPDSKLNKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQKGAADGPSTASVSADCREQLLGEEETYPQTFAEVKWYPDDKTVPLRFPQYWNCNGYSTWSSCT
ccEEEcccccccccccEEEEEcccEEEEcccccccEEcEEEccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEEEEEEcccccEEcccccEEEEEccEEEEEEcccccEEEEEEEEccccEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHcHHEEEcccccc
ccHHHHHHHccccccccEEEcccccccccccccccEEccccccEEEEEEEEEEccEEEEEccccccccccccccccccccccccccccEEEEEccccccccEEEEEEEEEEccccEEcccccEEEEEcccEEEEEccccccEEEEEEEEcccEEEEcEEEEEEEccccccccccccccccccccccccccHHHccccccccEcccHHHHHHHHHccccHHEEccccccccEEHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccccccc
mmisrriwqkrpptsswiflrpytsqisvpspspsrfpvqtpsligFLSSYAASSFRSVYKISslempsmvsrccysnhaladlpasgivdvplaqtgegiaECELLKWFVKEGDeieefqplcavqsdkatIEITSRYKGKVAQllhapgnivKVGETLLKLVvgdsavptpssdvlesvkppgsenspdsklnkdtvggvlatpTVRNLAKLYginlydvdatgkdgrvLKEDVLKYAVQkgaadgpstasvSADCREQLlgeeetypqtfaevkwypddktvplrfpqywncngystwssct
mmisrriwqkrpptsswiflrPYTSQISVPSPSPSRFPVQTPSLIGFLSSYAASSFRSVYKISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFqplcavqsdKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGDsavptpssdvlesvkppgsenspdsklnkdtvggvlatptvrnLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQkgaadgpstasvSADCREQLLGEEETYPQTFAEVKWYPDDKTVPLRFPQYwncngystwssct
MMISRRIWQKRPPTSSWIFLRPYTSQIsvpspspsrfpvQTPSLIGFLSSYAASSFRSVYKISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGDSAVPTPSSDVLESVKPPGSENSPDSKLNKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQKGAADGPSTASVSADCREQLLGEEETYPQTFAEVKWYPDDKTVPLRFPQYWNCNGYSTWSSCT
*******************************************LIGFLSSYAASSFRSVYKISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGD*******************************VGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQK******************LLGEEETYPQTFAEVKWYPDDKTVPLRFPQYWNCNGYSTW****
**ISRRIWQKRPPTSSWIFLRPYTSQISVPSPSPSRFPVQTPSLIGFLS*****************************************DVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLK********************************************TVRNLAKLYGINLYDVDATGKDGRVLKEDVL***************************************************FPQYWNCNGYSTWSS**
**********RPPTSSWIFLRPYTSQI*********FPVQTPSLIGFLSSYAASSFRSVYKISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGDSAVP**********************LNKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQ*************ADCREQLLGEEETYPQTFAEVKWYPDDKTVPLRFPQYWNCNGYSTWSSCT
MMISRRIWQKRPPTSSWIFLRPYTSQISVPSPSPSRFPVQTPSLIGFLSSYAASSFRSVYKIS***********************SGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGD**********************************VLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQK******************************AEVKWYPDDKTVPLRFPQYWNCNGYSTWSSCT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMISRRIWQKRPPTSSWIFLRPYTSQISVPSPSPSRFPVQTPSLIGFLSSYAASSFRSVYKISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGDSAVPTPSSDVLESVKPPGSENSPDSKLNKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQKGAADGPSTASVSADCREQLLGEEETYPQTFAEVKWYPDDKTVPLRFPQYWNCNGYSTWSSCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
Q23571 448 Lipoamide acyltransferase yes no 0.504 0.343 0.416 3e-25
P11182 482 Lipoamide acyltransferase yes no 0.511 0.323 0.398 9e-23
P53395 482 Lipoamide acyltransferase yes no 0.521 0.329 0.391 2e-22
P11181 482 Lipoamide acyltransferase yes no 0.511 0.323 0.398 5e-22
Q8CT13 433 Dihydrolipoyllysine-resid yes no 0.537 0.378 0.338 1e-17
P11961 428 Dihydrolipoyllysine-resid N/A no 0.409 0.292 0.348 5e-17
Q59821 430 Dihydrolipoyllysine-resid yes no 0.527 0.374 0.356 6e-17
Q8NX76 430 Dihydrolipoyllysine-resid yes no 0.544 0.386 0.346 7e-17
Q6GAB9 430 Dihydrolipoyllysine-resid yes no 0.544 0.386 0.346 7e-17
P65636 430 Dihydrolipoyllysine-resid yes no 0.544 0.386 0.346 7e-17
>sp|Q23571|ODB2_CAEEL Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Caenorhabditis elegans GN=ZK669.4 PE=3 SV=1 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 92/156 (58%), Gaps = 2/156 (1%)

Query: 89  IVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLH 148
           +V   L+  GEGIAE ++ +W+VKEGD I +F  +C VQSDKA + I+ RY G V +L H
Sbjct: 30  VVQFKLSDIGEGIAEVQVKEWYVKEGDTISQFDKVCEVQSDKAAVTISCRYDGIVKKLYH 89

Query: 149 APGNIVKVGETLLKL-VVGDSAVP-TPSSDVLESVKPPGSENSPDSKLNKDTVGGVLATP 206
               + +VG+ L+ + + G+   P  P  +   S       ++P +  +  + G VLATP
Sbjct: 90  EVDGMARVGQALIDVEIEGNVEEPEQPKKEAASSSPEAPKSSAPKAPESAHSEGKVLATP 149

Query: 207 TVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQ 242
            VR +A    I L +V  TGKDGRVLKEDVLK+  Q
Sbjct: 150 AVRRIAIENKIKLAEVRGTGKDGRVLKEDVLKFLGQ 185
The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 6EC: 8
>sp|P11182|ODB2_HUMAN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Homo sapiens GN=DBT PE=1 SV=3 Back     alignment and function description
>sp|P53395|ODB2_MOUSE Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Mus musculus GN=Dbt PE=2 SV=2 Back     alignment and function description
>sp|P11181|ODB2_BOVIN Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial OS=Bos taurus GN=DBT PE=1 SV=2 Back     alignment and function description
>sp|Q8CT13|ODP2_STAES Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|P11961|ODP2_GEOSE Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Geobacillus stearothermophilus GN=pdhC PE=1 SV=3 Back     alignment and function description
>sp|Q59821|ODP2_STAAU Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|Q8NX76|ODP2_STAAW Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MW2) GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|Q6GAB9|ODP2_STAAS Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain MSSA476) GN=pdhC PE=3 SV=1 Back     alignment and function description
>sp|P65636|ODP2_STAAN Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Staphylococcus aureus (strain N315) GN=pdhC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
359477250 506 PREDICTED: lipoamide acyltransferase com 0.901 0.543 0.542 2e-73
255551811 504 lipoamide acyltransferase component of b 0.911 0.551 0.534 4e-70
296083342 463 unnamed protein product [Vitis vinifera] 0.760 0.501 0.575 8e-68
147792119 527 hypothetical protein VITISV_019281 [Viti 0.731 0.423 0.586 2e-67
224110406 490 predicted protein [Populus trichocarpa] 0.865 0.538 0.508 3e-64
356521841 515 PREDICTED: lipoamide acyltransferase com 0.885 0.524 0.462 2e-57
193290668 505 putative branched-chain alpha-keto acid 0.586 0.354 0.601 3e-57
3138972 483 dihydrolipoylacyltransferase subunit of 0.829 0.523 0.476 3e-55
15231314 483 2-oxoisovalerate dehydrogenase E2 compon 0.829 0.523 0.476 3e-55
356564223 515 PREDICTED: lipoamide acyltransferase com 0.885 0.524 0.452 5e-55
>gi|359477250|ref|XP_002270598.2| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 197/293 (67%), Gaps = 18/293 (6%)

Query: 2   MISRRIWQKRPPTSSWIFLRPYTSQISVPSPSPSRFPVQTPSLIGF-----LSSYAASSF 56
           MISR IWQ++   +   +LR   +Q S  SPSP    +   S IGF     +S YA +SF
Sbjct: 1   MISRGIWQQKCRNAIRRWLRSCAAQTSPLSPSPV-VSLGNSSYIGFCSQPIVSRYAMASF 59

Query: 57  RSVY-KISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGD 115
             V  K+  L +P  + R C+S+HAL DLPASGIV +PLAQTGEGIAECELLKWFVKEGD
Sbjct: 60  SMVNDKLMDLNIPYSIKRSCFSSHALLDLPASGIVSIPLAQTGEGIAECELLKWFVKEGD 119

Query: 116 EIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGDSAVPTPSS 175
           ++EEFQPLC VQSDKATIEITSRYKG V+Q+++ PG+IVKVGE+LLK+VV +S     +S
Sbjct: 120 QVEEFQPLCEVQSDKATIEITSRYKGTVSQIIYVPGDIVKVGESLLKMVVEESQGSNLTS 179

Query: 176 DVLESVKPPGSENSPDSKLNKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKED 235
           +       P    S D  L     GGVLATP VRNLAK YG+++  +  TG+DGRVLKED
Sbjct: 180 NA------PDDMKSMD--LRHSNTGGVLATPAVRNLAKQYGVDINHILGTGQDGRVLKED 231

Query: 236 VLKYAVQKGAADGPSTASVSADCREQLLGEEETYPQTFAEVKWYPDDKTVPLR 288
           VL +AVQKG    PS+ SV++   E   GEE+ Y  T A   W  +DKTVP+R
Sbjct: 232 VLTHAVQKGLCKEPSSLSVNS--VEHFQGEEK-YSHTLAADGWQYEDKTVPIR 281

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255551811|ref|XP_002516951.1| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase, putative [Ricinus communis] gi|223544039|gb|EEF45565.1| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296083342|emb|CBI22978.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147792119|emb|CAN68576.1| hypothetical protein VITISV_019281 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110406|ref|XP_002315510.1| predicted protein [Populus trichocarpa] gi|222864550|gb|EEF01681.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356521841|ref|XP_003529559.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|193290668|gb|ACF17642.1| putative branched-chain alpha-keto acid dehydrogenase E2 subunit [Capsicum annuum] Back     alignment and taxonomy information
>gi|3138972|gb|AAC16694.1| dihydrolipoylacyltransferase subunit of the branched-chain alpha-keto acid dehydrogenase complex [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15231314|ref|NP_187341.1| 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [Arabidopsis thaliana] gi|30680036|ref|NP_850527.1| 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [Arabidopsis thaliana] gi|7549628|gb|AAF63813.1| branched chain alpha-keto acid dehydrogenase E2 subunit [Arabidopsis thaliana] gi|21554337|gb|AAM63444.1| branched chain alpha-keto acid dehydrogenase E2 subunit [Arabidopsis thaliana] gi|222423008|dbj|BAH19487.1| AT3G06850 [Arabidopsis thaliana] gi|222424240|dbj|BAH20078.1| AT3G06850 [Arabidopsis thaliana] gi|332640945|gb|AEE74466.1| 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [Arabidopsis thaliana] gi|332640946|gb|AEE74467.1| 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356564223|ref|XP_003550355.1| PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
TAIR|locus:2083358 483 BCE2 "AT3G06850" [Arabidopsis 0.845 0.534 0.480 2.1e-52
WB|WBGene00014054 448 ZK669.4 [Caenorhabditis elegan 0.504 0.343 0.416 5.8e-26
ZFIN|ZDB-GENE-050320-85 493 dbt "dihydrolipoamide branched 0.527 0.326 0.409 1.1e-25
FB|FBgn0030612 462 CG5599 [Drosophila melanogaste 0.501 0.331 0.438 4.8e-25
ASPGD|ASPL0000010467 471 AN3639 [Emericella nidulans (t 0.472 0.305 0.333 3.1e-24
UNIPROTKB|F1P1X9 493 DBT "Uncharacterized protein" 0.567 0.350 0.391 3.2e-24
MGI|MGI:105386 482 Dbt "dihydrolipoamide branched 0.622 0.394 0.366 6.2e-24
UNIPROTKB|Q5VVL7320 DBT "Lipoamide acyltransferase 0.511 0.487 0.398 1.1e-23
UNIPROTKB|E2RQG4 482 DBT "Uncharacterized protein" 0.550 0.348 0.408 1.3e-23
UNIPROTKB|P11182 482 DBT "Lipoamide acyltransferase 0.511 0.323 0.398 3.8e-23
TAIR|locus:2083358 BCE2 "AT3G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 543 (196.2 bits), Expect = 2.1e-52, P = 2.1e-52
 Identities = 138/287 (48%), Positives = 179/287 (62%)

Query:     2 MISRRIWQKRPPTSSWIFLRPYTSQIXXXXXXXXXXXXQTPSLIGFLSSYAASSFRSVYK 61
             MI+RRIW+      S  FLRP++S              + P  +   SS  AS    V+ 
Sbjct:     1 MIARRIWR------SHRFLRPFSSS------SVCSPPFRVPEYLSQSSSSPASRPFFVHP 48

Query:    62 ISSLEMPSMVSRCCYSNHALADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQ 121
              + ++     SR  +SN A+A    SG++DVPLAQTGEGIAECELLKWFVKEGD +EEFQ
Sbjct:    49 PTLMKWGGG-SRSWFSNEAMATDSNSGLIDVPLAQTGEGIAECELLKWFVKEGDSVEEFQ 107

Query:   122 PLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVGDSAVPTPSSDVLESV 181
             PLC VQSDKATIEITSR+KGKVA + H+PG+I+KVGETL++L V DS     ++D  E V
Sbjct:   108 PLCEVQSDKATIEITSRFKGKVALISHSPGDIIKVGETLVRLAVEDSQDSLLTTDSSEIV 167

Query:   182 KPPGSENSPDSKLNKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAV 241
                GS+   ++ L      G L+TP VRNLAK  GI++  +  TGKDGRVLKEDVL+++ 
Sbjct:   168 TLGGSKQGTENLL------GALSTPAVRNLAKDLGIDINVITGTGKDGRVLKEDVLRFSD 221

Query:   242 QKGAADGPSTASVSADCREQLLGEEETYPQTFAEVKWYPDDKTVPLR 288
             QKG      T SVS++    ++G +     T A   +  +DKTVPLR
Sbjct:   222 QKGFV----TDSVSSE--HAVIGGDSV--STKASSNF--EDKTVPLR 258
GO:0003826 "alpha-ketoacid dehydrogenase activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA;TAS
GO:0008152 "metabolic process" evidence=IEA
GO:0016746 "transferase activity, transferring acyl groups" evidence=IEA
GO:0043754 "dihydrolipoyllysine-residue (2-methylpropanoyl)transferase activity" evidence=IEA
GO:0046949 "fatty-acyl-CoA biosynthetic process" evidence=IEA
GO:0048037 "cofactor binding" evidence=IEA
GO:0016407 "acetyltransferase activity" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0004147 "dihydrolipoamide branched chain acyltransferase activity" evidence=TAS
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
WB|WBGene00014054 ZK669.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050320-85 dbt "dihydrolipoamide branched chain transacylase E2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030612 CG5599 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000010467 AN3639 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1X9 DBT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:105386 Dbt "dihydrolipoamide branched chain transacylase E2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VVL7 DBT "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQG4 DBT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P11182 DBT "Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!
3rd Layer2.3.1.12LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
PLN02528 416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 5e-87
PRK11856 411 PRK11856, PRK11856, branched-chain alpha-keto acid 5e-39
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 5e-35
COG0508 404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 1e-33
PRK05704 407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 2e-24
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 7e-24
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 9e-23
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 1e-20
TIGR01347 403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 7e-18
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 8e-17
TIGR01349 436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 1e-15
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 6e-15
PLN02744 539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 1e-14
TIGR02927 579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 1e-12
pfam0281739 pfam02817, E3_binding, e3 binding domain 6e-10
PTZ00144 418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 2e-08
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 4e-08
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 4e-08
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 4e-08
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 2e-07
PRK11857 306 PRK11857, PRK11857, dihydrolipoamide acetyltransfe 2e-06
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 5e-06
PRK14875 371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 1e-05
PRK14843 347 PRK14843, PRK14843, dihydrolipoamide acetyltransfe 2e-05
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 3e-05
PRK11892 464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 7e-05
PRK0822570 PRK08225, PRK08225, acetyl-CoA carboxylase biotin 3e-04
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 5e-04
PLN02226 463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 6e-04
PRK09282592 PRK09282, PRK09282, pyruvate carboxylase subunit B 0.003
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information 
 Score =  266 bits (681), Expect = 5e-87
 Identities = 112/197 (56%), Positives = 134/197 (68%), Gaps = 6/197 (3%)

Query: 92  VPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPG 151
           VPLAQTGEGIAECELL+WFVKEGD++EEFQPLC VQSDKATIEITSRYKGKVAQ+  +PG
Sbjct: 1   VPLAQTGEGIAECELLRWFVKEGDQVEEFQPLCEVQSDKATIEITSRYKGKVAQINFSPG 60

Query: 152 NIVKVGETLLKLVVGDSAVPTPSSDVLESVKPPGSENSPDSKLNKDTVGGVLATPTVRNL 211
           +IVKVGETLLK++V DS      S +L +          +S      + GVL+TP VR+L
Sbjct: 61  DIVKVGETLLKIMVEDSQHLRSDSLLLPTDSSNIVS-LAESDERGSNLSGVLSTPAVRHL 119

Query: 212 AKLYGINLYDVDATGKDGRVLKEDVLKYAVQKGAADGPSTASVSADCREQLLGEEETYPQ 271
           AK YGI+L D+  TGKDGRVLKEDVLKYA QKG     S+A  +         +EE    
Sbjct: 120 AKQYGIDLNDILGTGKDGRVLKEDVLKYAAQKGVVKDSSSAEEATIAE-----QEEFSTS 174

Query: 272 TFAEVKWYPDDKTVPLR 288
                +   +DKT+PLR
Sbjct: 175 VSTPTEQSYEDKTIPLR 191

Length = 416
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
KOG0558 474 consensus Dihydrolipoamide transacylase (alpha-ket 100.0
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 99.97
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 99.96
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 99.96
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 99.95
KOG0557 470 consensus Dihydrolipoamide acetyltransferase [Ener 99.95
PLN02744 539 dihydrolipoyllysine-residue acetyltransferase comp 99.95
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 99.95
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 99.95
TIGR01349 435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 99.94
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.94
PRK11856 411 branched-chain alpha-keto acid dehydrogenase subun 99.93
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 99.93
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 99.8
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.77
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 99.76
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.74
PRK0674883 hypothetical protein; Validated 99.62
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.54
KOG0559 457 consensus Dihydrolipoamide succinyltransferase (2- 99.54
PRK11892 464 pyruvate dehydrogenase subunit beta; Provisional 99.5
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.49
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.47
PRK11854 633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.44
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.43
TIGR02927 590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 99.4
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.33
PRK11855 547 dihydrolipoamide acetyltransferase; Reviewed 99.32
PF0281739 E3_binding: e3 binding domain; InterPro: IPR004167 99.32
PRK0705180 hypothetical protein; Validated 99.28
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 99.28
TIGR01348 546 PDHac_trf_long pyruvate dehydrogenase complex dihy 99.28
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.27
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 99.23
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.2
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.2
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.13
PRK14042596 pyruvate carboxylase subunit B; Provisional 99.12
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 99.03
PRK14040593 oxaloacetate decarboxylase; Provisional 98.95
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 98.94
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 98.93
PRK11857 306 dihydrolipoamide acetyltransferase; Reviewed 98.89
PRK09282592 pyruvate carboxylase subunit B; Validated 98.84
PRK129991146 pyruvate carboxylase; Reviewed 98.76
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 98.73
PRK14843 347 dihydrolipoamide acetyltransferase; Provisional 98.71
COG10381149 PycA Pyruvate carboxylase [Energy production and c 98.56
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 98.2
KOG03691176 consensus Pyruvate carboxylase [Energy production 98.2
PRK09783409 copper/silver efflux system membrane fusion protei 98.0
KOG0238670 consensus 3-Methylcrotonyl-CoA carboxylase, biotin 97.97
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 97.97
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 97.92
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 97.88
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 97.88
PRK10476346 multidrug resistance protein MdtN; Provisional 97.84
KOG0368 2196 consensus Acetyl-CoA carboxylase [Lipid transport 97.83
PRK00624114 glycine cleavage system protein H; Provisional 97.81
PRK13380144 glycine cleavage system protein H; Provisional 97.76
PRK15030397 multidrug efflux system transporter AcrA; Provisio 97.68
PRK15136390 multidrug efflux system protein EmrA; Provisional 97.66
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 97.63
PRK01202127 glycine cleavage system protein H; Provisional 97.63
PRK14843 347 dihydrolipoamide acetyltransferase; Provisional 97.61
PRK03598331 putative efflux pump membrane fusion protein; Prov 97.6
PRK09859385 multidrug efflux system protein MdtE; Provisional 97.57
PRK11556415 multidrug efflux system subunit MdtA; Provisional 97.41
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.38
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.38
PRK1278484 hypothetical protein; Provisional 97.36
PRK11578370 macrolide transporter subunit MacA; Provisional 97.36
TIGR00527127 gcvH glycine cleavage system H protein. The genome 97.36
PF12700328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 97.19
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 97.16
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 97.0
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxyla 96.64
COG0509131 GcvH Glycine cleavage system H protein (lipoate-bi 96.59
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 96.44
TIGR00999265 8a0102 Membrane Fusion Protein cluster 2 (function 96.35
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 96.28
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 95.97
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 95.95
PF13375101 RnfC_N: RnfC Barrel sandwich hybrid domain 95.9
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 95.7
COG1566352 EmrA Multidrug resistance efflux pump [Defense mec 95.7
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 95.66
PRK0674883 hypothetical protein; Validated 95.65
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 95.48
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 95.45
PF05896257 NQRA: Na(+)-translocating NADH-quinone reductase s 95.23
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 95.17
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 94.98
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 94.63
PF00529305 HlyD: HlyD family secretion protein the correspond 94.51
PF13437105 HlyD_3: HlyD family secretion protein 94.48
PRK0705180 hypothetical protein; Validated 94.46
TIGR02971 327 heterocyst_DevB ABC exporter membrane fusion prote 94.37
PF00529 305 HlyD: HlyD family secretion protein the correspond 94.35
COG3608331 Predicted deacylase [General function prediction o 94.03
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 94.01
PRK11556 415 multidrug efflux system subunit MdtA; Provisional 93.92
PRK10476 346 multidrug resistance protein MdtN; Provisional 93.87
KOG3373172 consensus Glycine cleavage system H protein (lipoa 93.81
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 93.75
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 93.67
PF12700 328 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 93.65
PF09891150 DUF2118: Uncharacterized protein conserved in arch 93.46
PRK11578 370 macrolide transporter subunit MacA; Provisional 93.44
PRK09859 385 multidrug efflux system protein MdtE; Provisional 93.44
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 93.02
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 93.0
PRK09578 385 periplasmic multidrug efflux lipoprotein precursor 92.94
TIGR01730 322 RND_mfp RND family efflux transporter, MFP subunit 92.89
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 92.84
TIGR01936 447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 92.69
COG1726 447 NqrA Na+-transporting NADH:ubiquinone oxidoreducta 92.61
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 92.28
PRK05352 448 Na(+)-translocating NADH-quinone reductase subunit 92.08
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 92.02
PRK15136 390 multidrug efflux system protein EmrA; Provisional 91.88
PRK03598 331 putative efflux pump membrane fusion protein; Prov 91.78
PRK14042596 pyruvate carboxylase subunit B; Provisional 91.67
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 91.24
PRK15030 397 multidrug efflux system transporter AcrA; Provisio 91.23
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 91.17
TIGR01945 435 rnfC electron transport complex, RnfABCDGE type, C 91.1
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 91.03
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 91.01
TIGR03794421 NHPM_micro_HlyD NHPM bacteriocin system secretion 90.61
PF04952292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 90.58
PLN02226 463 2-oxoglutarate dehydrogenase E2 component 90.23
PF0783175 PYNP_C: Pyrimidine nucleoside phosphorylase C-term 90.19
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 90.07
PRK09783 409 copper/silver efflux system membrane fusion protei 90.05
PF13437105 HlyD_3: HlyD family secretion protein 89.47
COG0845 372 AcrA Membrane-fusion protein [Cell envelope biogen 89.14
PRK09282592 pyruvate carboxylase subunit B; Validated 88.82
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 88.56
COG0845372 AcrA Membrane-fusion protein [Cell envelope biogen 88.24
COG2190156 NagE Phosphotransferase system IIA components [Car 88.03
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 87.6
PRK05035 695 electron transport complex protein RnfC; Provision 87.54
PRK14040593 oxaloacetate decarboxylase; Provisional 86.82
PF00358132 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph 86.7
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 86.57
TIGR00164189 PS_decarb_rel phosphatidylserine decarboxylase pre 86.56
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 86.22
PF02666202 PS_Dcarbxylase: Phosphatidylserine decarboxylase; 86.12
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 85.84
PF0274988 QRPTase_N: Quinolinate phosphoribosyl transferase, 85.83
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 85.78
PRK09439169 PTS system glucose-specific transporter subunit; P 85.57
TIGR01347 403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 85.16
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 85.09
PRK05305206 phosphatidylserine decarboxylase; Provisional 85.0
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 84.72
PRK05704 407 dihydrolipoamide succinyltransferase; Validated 84.7
PRK09439169 PTS system glucose-specific transporter subunit; P 84.0
PLN02528 416 2-oxoisovalerate dehydrogenase E2 component 83.87
COG1566 352 EmrA Multidrug resistance efflux pump [Defense mec 83.79
TIGR01995610 PTS-II-ABC-beta PTS system, beta-glucoside-specifi 82.92
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 82.86
PRK129991146 pyruvate carboxylase; Reviewed 82.76
KOG0559 457 consensus Dihydrolipoamide succinyltransferase (2- 82.36
COG4072161 Uncharacterized protein conserved in archaea [Func 82.19
TIGR00830121 PTBA PTS system, glucose subfamily, IIA component. 82.17
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 82.09
cd00210124 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s 81.74
COG2190156 NagE Phosphotransferase system IIA components [Car 81.2
>KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=6.1e-39  Score=303.63  Aligned_cols=213  Identities=46%  Similarity=0.664  Sum_probs=167.0

Q ss_pred             chhhhhhhcCCCCccccccccccccccCCCCCCCCCCcccCccccCCccccccCCcccchhcccCCCcccccceeccccc
Q 021956            2 MISRRIWQKRPPTSSWIFLRPYTSQISVPSPSPSRFPVQTPSLIGFLSSYAASSFRSVYKISSLEMPSMVSRCCYSNHAL   81 (305)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (305)
                      |+.+|||+.|++++      .  ++            .|.++++..-+..+.+.++..   .-|+|+. .+|.||++++.
T Consensus         1 m~A~rllrt~s~~~------~--~~------------~Cv~~~~~~~~~~h~skp~~v---~l~~~~~-~~~s~~~~~~~   56 (474)
T KOG0558|consen    1 MMARRLLRTHSRLS------S--SS------------VCVPEYFSLSSSLHVSKPFFV---TLMKWGG-GSRSWFSNEAM   56 (474)
T ss_pred             ChhHHhhhhccccc------c--cc------------hhHHHHHhhccCccccCcceE---EEeccCC-ccccccchhhh
Confidence            77899999999987      1  11            344444333344444444444   3578887 67889999998


Q ss_pred             cCCCCCceEEEeecCCCCCCceeEEEEEEccCCCEEecCCeEEEEecCceeeEEecCCCcEEEEEeeCCCCeeecCceEE
Q 021956           82 ADLPASGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLL  161 (305)
Q Consensus        82 ~~~~~~~~~~i~lP~lges~~eG~I~~w~v~eGD~V~~Gd~L~eIEtdK~~~eI~Ap~~Gvv~~i~v~~Gd~V~vG~~La  161 (305)
                      +.....+.++|+|.|+||+|.|++|.+|+|+|||+|++.|.||||++||++++|++.++|+|++|+.+.+|.+.+|++|.
T Consensus        57 ~t~s~~gvv~f~LsdiGEGI~Ev~vkeWfVKEGDtVeqFd~lCEVQSDKAsvtItsRydG~v~ki~h~~ddia~VGk~Lv  136 (474)
T KOG0558|consen   57 ATDSNSGVVQFKLSDIGEGIAEVTVKEWFVKEGDTVEQFDPLCEVQSDKASVTITSRYDGKVKKIYHSPDDIAKVGKPLV  136 (474)
T ss_pred             hcccccceEEEEhhhccccceeeeeeeehhhcCCcHHHhcchhhcccccceEEEEeeecceEEEEeeCchhhhHhCccee
Confidence            88888889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccChHHHHHHHHhCCCccccccCCCCCceehHHHHHHHH
Q 021956          162 KLVVGDSAVPTPSSDVLESVKPPGSENSPDSKLNKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAV  241 (305)
Q Consensus       162 ~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AsPaaRklA~e~gIDLs~V~GTG~~GRItkeDV~~~~~  241 (305)
                      .++.++.+.......+...... ..  .   ........+++|||++|+||+|+||||+.|+|||+||||+||||++|+.
T Consensus       137 d~eve~~~ds~e~s~es~~vs~-~~--~---~~~~~~~~~tlaTPaVRrlA~e~~idla~v~gtGKdGRvLKeDvL~fl~  210 (474)
T KOG0558|consen  137 DLEVEDSQDSPEDSDESPAVSL-GE--S---KQGEESLLKTLATPAVRRLAKENGIDLAEVTGTGKDGRVLKEDVLRFLG  210 (474)
T ss_pred             eeeeccCcCCcccCCccccccC-CC--C---chhhhhccccccCHHHHHHHHHhCCceEeeeccCCCCcchHHHHHHHhc
Confidence            9998765433222111110000 00  0   0001122457899999999999999999999999999999999999997


Q ss_pred             hcC
Q 021956          242 QKG  244 (305)
Q Consensus       242 ~~~  244 (305)
                      +..
T Consensus       211 q~p  213 (474)
T KOG0558|consen  211 QVP  213 (474)
T ss_pred             cCC
Confidence            653

>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK14843 dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK14843 dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C Back     alignment and domain information
>PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK15030 multidrug efflux system transporter AcrA; Provisional Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PF13437 HlyD_3: HlyD family secretion protein Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>PF02666 PS_Dcarbxylase: Phosphatidylserine decarboxylase; InterPro: IPR003817 Phosphatidylserine decarboxylase plays a pivotal role in the synthesis of phospholipid by the mitochondria Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PRK05305 phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PRK09439 PTS system glucose-specific transporter subunit; Provisional Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>COG4072 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit Back     alignment and domain information
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3duf_I 428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 4e-18
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 9e-14
1k8o_A93 Solution Structure Of The Lipoic Acid-Bearing Domai 8e-13
2l5t_A77 Solution Nmr Structure Of E2 Lipoyl Domain From The 1e-11
3rnm_E58 The Crystal Structure Of The Subunit Binding Of Hum 3e-06
2coo_A70 Solution Structure Of The E3_binding Domain Of Dihy 5e-06
1zwv_A58 Solution Structure Of The Subunit Binding Domain (H 1e-05
1zy8_L229 The Crystal Structure Of Dihydrolipoamide Dehydroge 5e-04
1w85_I49 The Crystal Structure Of Pyruvate Dehydrogenase E1 5e-04
2pdd_A43 The High Resolution Structure Of The Peripheral Sub 5e-04
1w4f_A47 Peripheral-Subunit Binding Domains From Mesophilic, 6e-04
1w4g_A47 Peripheral-Subunit Binding Domains From Mesophilic, 6e-04
1w3d_A55 Nmr Structure Of The Peripheral-Subunit Binding Dom 7e-04
>pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure 
Iteration: 1

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 82/175 (46%), Gaps = 50/175 (28%)
Query: 94  LAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNI 153
           L   GEGI E E++KWFVK GDE+ E   LC VQ+DKA +EI S  KGKV ++L   G +
Sbjct: 7   LPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTV 66
Query: 154 VKVGETLLKLVVGDSAVPTPSSDVLESVKPPGSEN--------------------SPDSK 193
             VG+TL+ L                    PG EN                    S + K
Sbjct: 67  ATVGQTLITL------------------DAPGYENMTFKGQEQEEAKKEEKTETVSKEEK 108
Query: 194 LNKDTVGG------------VLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDV 236
           ++                  V+A P+VR  A+  G+++  V  TGK+GRVLKED+
Sbjct: 109 VDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDI 163
>pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 Back     alignment and structure
>pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 Back     alignment and structure
>pdb|3RNM|E Chain E, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 58 Back     alignment and structure
>pdb|2COO|A Chain A, Solution Structure Of The E3_binding Domain Of Dihydrolipoamide Branched Chaintransacylase Length = 70 Back     alignment and structure
>pdb|1ZWV|A Chain A, Solution Structure Of The Subunit Binding Domain (Hbsbd) Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 58 Back     alignment and structure
>pdb|1W85|I Chain I, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 49 Back     alignment and structure
>pdb|2PDD|A Chain A, The High Resolution Structure Of The Peripheral Subunit- Binding Domain Of Dihydrolipoamide Acetyltransferase From The Pyruvate Dehydrogenase Multienzyme Complex Of Bacillus Stearothermophilus Length = 43 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 1e-39
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 8e-35
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 1e-27
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 3e-26
2coo_A70 Lipoamide acyltransferase component of branched- c 1e-15
3rnm_E58 Lipoamide acyltransferase component of branched-C 9e-15
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 1e-12
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 1e-12
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 2e-11
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 3e-11
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 5e-11
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 9e-11
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 2e-10
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 2e-10
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 3e-10
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 3e-10
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 6e-10
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 7e-10
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 1e-09
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 2e-09
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 3e-09
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 4e-09
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 7e-09
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 1e-07
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 3e-07
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 2e-06
2f60_K64 Pyruvate dehydrogenase protein X component; protei 8e-06
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 2e-05
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 2e-05
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 3e-05
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 4e-05
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 1e-04
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 1e-04
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 2e-04
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
 Score =  143 bits (362), Expect = 1e-39
 Identities = 61/182 (33%), Positives = 87/182 (47%), Gaps = 14/182 (7%)

Query: 89  IVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLH 148
             +  L   GEGI E E++KWFVK GDE+ E   LC VQ+DKA +EI S  KGKV ++L 
Sbjct: 2   AFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILV 61

Query: 149 APGNIVKVGETLLKLVVGDSAVPTPSSDVLESVK--------------PPGSENSPDSKL 194
             G +  VG+TL+ L        T      E  K                 + N+P ++ 
Sbjct: 62  PEGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEA 121

Query: 195 NKDTVGGVLATPTVRNLAKLYGINLYDVDATGKDGRVLKEDVLKYAVQKGAADGPSTASV 254
                  V+A P+VR  A+  G+++  V  TGK+GRVLKED+  +          +    
Sbjct: 122 EAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEK 181

Query: 255 SA 256
           +A
Sbjct: 182 AA 183
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Length = 41 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Length = 40 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 99.96
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 99.96
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.75
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.75
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.75
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.74
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.72
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.71
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.68
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.66
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.64
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.63
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.6
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.46
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.4
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.35
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.32
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.31
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 99.31
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 99.3
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 99.28
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 99.27
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 99.22
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 99.2
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 99.17
3rnm_E58 Lipoamide acyltransferase component of branched-C 99.16
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 99.15
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 99.15
2coo_A70 Lipoamide acyltransferase component of branched- c 99.11
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 99.11
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 99.07
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 99.06
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 99.04
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 99.01
2f60_K64 Pyruvate dehydrogenase protein X component; protei 99.0
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.89
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 98.8
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 98.74
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.74
1hpc_A131 H protein of the glycine cleavage system; transit 98.29
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.26
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.21
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 98.11
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 98.08
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 98.07
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 98.02
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 97.79
3klr_A125 Glycine cleavage system H protein; antiparallel be 97.72
3mxu_A143 Glycine cleavage system H protein; seattle structu 97.59
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 97.54
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 97.45
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 97.29
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 96.93
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 96.92
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 96.83
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 96.73
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 96.12
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 96.05
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 96.0
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 95.86
2qj8_A332 MLR6093 protein; structural genomics, joint center 95.76
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 95.48
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 95.44
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 95.36
2gpr_A154 Glucose-permease IIA component; phosphotransferase 95.06
2xha_A193 NUSG, transcription antitermination protein NUSG; 94.98
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 94.8
3lnn_A 359 Membrane fusion protein (MFP) heavy metal cation Z 94.78
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 94.63
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 94.48
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 94.39
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 94.26
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 93.75
2xhc_A352 Transcription antitermination protein NUSG; 2.45A 93.49
3ne5_B 413 Cation efflux system protein CUSB; transmembrane h 92.96
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 92.91
1vf7_A 369 Multidrug resistance protein MEXA; alpha hairpin, 92.84
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 92.68
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 92.22
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 92.15
3d4r_A169 Domain of unknown function from the PFAM-B_34464; 92.15
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 92.06
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 91.95
2auk_A190 DNA-directed RNA polymerase beta' chain; sandwich- 91.57
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 91.28
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 91.27
2xha_A193 NUSG, transcription antitermination protein NUSG; 89.89
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 89.77
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 89.71
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 89.53
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 88.25
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 86.95
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 86.54
3our_B183 EIIA, phosphotransferase system IIA component; exh 86.32
2gpr_A154 Glucose-permease IIA component; phosphotransferase 85.0
3lu0_D 1407 DNA-directed RNA polymerase subunit beta'; E. coli 83.76
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 82.83
2bco_A350 Succinylglutamate desuccinylase; NESG, VPR14, stru 81.08
2xhc_A352 Transcription antitermination protein NUSG; 2.45A 81.04
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 80.83
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 305
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 1e-18
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 2e-18
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 2e-18
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 1e-17
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 6e-16
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 3e-15
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-14
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 9e-14
d1w85i_42 a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl 8e-12
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 8e-11
d2cyua139 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa 3e-10
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure

class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Lipoyl domain of the 2-oxoglutarate dehydrogenase complex
species: Escherichia coli [TaxId: 562]

 Score = 76.7 bits (189), Expect = 1e-18
 Identities = 19/78 (24%), Positives = 37/78 (47%)

Query: 90  VDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHA 149
           VD+ +    E +A+  +  W  K GD +   + L  +++DK  +E+ +   G +  +L  
Sbjct: 3   VDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAVLED 62

Query: 150 PGNIVKVGETLLKLVVGD 167
            G  V   + L +L  G+
Sbjct: 63  EGTTVTSRQILGRLREGN 80
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.86
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.86
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.86
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.84
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.82
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.8
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.79
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.78
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.58
d1w85i_42 E3/E1 binding domain of dihydrolipoyl acetyltransf 99.47
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.42
d2cyua139 E3-binding domain of dihydrolipoamide succinyltran 99.41
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 97.19
d1onla_127 Protein H of glycine cleavage system {Thermus ther 97.17
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 97.09
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 96.36
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 95.96
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 95.93
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 95.85
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 95.76
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 95.31
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 95.28
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 94.98
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 94.73
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 93.24
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 91.83
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 90.15
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 88.1
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 86.8
d1gpra_158 Glucose permease IIa domain, IIa-glc {Bacillus sub 86.47
d1qpoa2115 Quinolinic acid phosphoribosyltransferase (Nicotin 84.99
d2gpra_154 Glucose permease IIa domain, IIa-glc {Mycoplasma c 84.81
d2f3ga_150 Glucose-specific factor III (glsIII) {Escherichia 84.64
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 83.25
d1o4ua2103 Quinolinic acid phosphoribosyltransferase (Nicotin 81.67
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 81.34
d1qapa2122 Quinolinic acid phosphoribosyltransferase (Nicotin 81.29
d1e2wa264 Cytochrome f, small domain {Chlamydomonas reinhard 80.17
d1uoua3105 Thymidine phosphorylase {Human (Homo sapiens) [Tax 80.08
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Barrel-sandwich hybrid
superfamily: Single hybrid motif
family: Biotinyl/lipoyl-carrier proteins and domains
domain: Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=6e-22  Score=153.68  Aligned_cols=82  Identities=39%  Similarity=0.721  Sum_probs=78.3

Q ss_pred             CceEEEeecCCCCCCceeEEEEEEccCCCEEecCCeEEEEecCceeeEEecCCCcEEEEEeeCCCCeeecCceEEEEecC
Q 021956           87 SGIVDVPLAQTGEGIAECELLKWFVKEGDEIEEFQPLCAVQSDKATIEITSRYKGKVAQLLHAPGNIVKVGETLLKLVVG  166 (305)
Q Consensus        87 ~~~~~i~lP~lges~~eG~I~~w~v~eGD~V~~Gd~L~eIEtdK~~~eI~Ap~~Gvv~~i~v~~Gd~V~vG~~La~i~~~  166 (305)
                      +.+++|+||+||+++++|+|.+|++++||.|++||+||+|||||+.++|+||++|+|.++++++|+.|++|++|+.|+.+
T Consensus         2 ~~~~~~~lP~lg~~~~eg~i~~w~v~~Gd~V~~g~~l~~vEt~K~~~~v~A~~~G~I~~i~v~~G~~v~~G~~l~~i~~~   81 (87)
T d1k8ma_           2 GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETE   81 (87)
T ss_dssp             CCCEEEECCSSCTTSCCEEEEEECCCTTCEECSSSCCEEEECSSCEEECCCSSCEEEEEECCCSSCEECTTSEEEEEECS
T ss_pred             CccEEEECCCCCCCceeEEEEEEEcCCCCEEecCCEEEEEEccCceEEEEeCCCEEEEEEEeCCCCEECCCCEEEEEEcC
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999999999875


Q ss_pred             CC
Q 021956          167 DS  168 (305)
Q Consensus       167 ~~  168 (305)
                      +.
T Consensus        82 ~~   83 (87)
T d1k8ma_          82 AL   83 (87)
T ss_dssp             CC
T ss_pred             Cc
Confidence            43
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} Back     information, alignment and structure
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure