Citrus Sinensis ID: 022044

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MSNSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQENFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccEEccccEEEEEEcccc
cccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccEEEEEcEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEEcccc
msnslysfendslpkvrkpytitkQREKWTEEEHQRFLDALKMYGrgwrqiegtKTAVQIRSHAQKFFSKVVresngssessimpieippprpkrkpvhpyprksvdslkatsvsnqqenftssnalvsdkdrqsptsvvsafnsdtlgcaasdqqngcssptscttemhsvnllpiekeneyvtsisfpkeekistlpahlsassNVEELasvskdsvypkgdaaaapsctsiklfgrtvlvsdswkpyslgadsykspiskssqenldvdkkilssqphqsiWIHIYYLGWFLAIVIHPHI
msnslysfendslpkvrkpytitkqrekwteeEHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFFSKVvresngssessimpieippprpkrkpvhPYPRKSVDSlkatsvsnqqenftssnalvsdkdrqSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDaaaapsctsiklFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
MSNSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFFSKVVRESNGSSESSimpieippprpkrkpvhpyprkSVDSLKATSVSNQQENFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
****************************W***EHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFF*********************************************************************************************************LL*****************************************************PSCTSIKLFGRTVLVSDSWKPYSL*****************************QSIWIHIYYLGWFLAIVIH***
********************************EHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFF****************************************************************************************************************************************************************************************************************************YYLGWFLAIVIHP**
********ENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFFSK************IMPIEIPPPR************SVDSLKATSVSNQQENFTSSNA************VVSAFNSDTLGCA**************TTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
****************RKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFFSKVVRES**********IEIPPPR******************************************************************************************************************************************CTSIKLFGRTVLVSDS**********************************HQSIWIHIYYLGWFLAIVIHPH*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEGTKTAVQIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQENFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEKENEYVTSISFPKEEKISTLPAHLSASSNVEELASVSKDSVYPKGDAAAAPSCTSIKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWIHIYYLGWFLAIVIHPHI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query303 2.2.26 [Sep-21-2011]
Q6R0H0287 Transcription factor ASG4 no no 0.316 0.334 0.551 3e-26
Q54IF9 423 Myb-like protein G OS=Dic yes no 0.270 0.193 0.569 1e-25
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.303 0.142 0.670 6e-25
P92973 608 Protein CCA1 OS=Arabidops no no 0.409 0.203 0.540 5e-24
Q869R9734 Myb-like protein J OS=Dic no no 0.174 0.072 0.421 9e-08
Q54HX6 977 Myb-like protein I OS=Dic no no 0.191 0.059 0.419 3e-06
Q8S9H7307 Transcription factor DIVA N/A no 0.237 0.234 0.388 3e-06
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.194 0.048 0.349 1e-05
Q2V9B0297 Transcription factor MYB1 N/A no 0.132 0.134 0.511 0.0001
Q5RGA4 822 Histone H2A deubiquitinas yes no 0.234 0.086 0.337 0.0002
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 11/107 (10%)

Query: 2   SNSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIE---GTKTAV 58
           SN   SF  D   KVRKPYTITK RE WTE+EH +FL+AL ++ R W++I+   G+KT +
Sbjct: 37  SNRTMSFFEDPTKKVRKPYTITKSRENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVI 96

Query: 59  QIRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKS 105
           QIRSHAQK+F KV  + NG+ E       +PPPRPKRK  HPYP+K+
Sbjct: 97  QIRSHAQKYFLKV--QKNGTKE------HLPPPRPKRKANHPYPQKA 135
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q2V9B0|MY1R1_SOLTU Transcription factor MYB1R1 OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
224125856 472 predicted protein [Populus trichocarpa] 0.917 0.588 0.576 3e-71
224118068 487 predicted protein [Populus trichocarpa] 0.891 0.554 0.582 1e-69
110931850321 MYB transcription factor MYB131 [Glycine 0.772 0.728 0.609 1e-68
356560061 477 PREDICTED: uncharacterized protein LOC77 0.943 0.599 0.543 3e-66
302398987 461 MYBR domain class transcription factor [ 0.947 0.622 0.546 8e-63
356531046 466 PREDICTED: uncharacterized protein LOC10 0.861 0.560 0.576 2e-61
356531048 450 PREDICTED: uncharacterized protein LOC10 0.858 0.577 0.571 4e-60
449507174 480 PREDICTED: uncharacterized LOC101217341 0.811 0.512 0.566 7e-57
449439603 490 PREDICTED: uncharacterized protein LOC10 0.811 0.502 0.566 1e-56
255570631 463 conserved hypothetical protein [Ricinus 0.838 0.548 0.498 3e-47
>gi|224125856|ref|XP_002329734.1| predicted protein [Populus trichocarpa] gi|222870642|gb|EEF07773.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 169/293 (57%), Positives = 206/293 (70%), Gaps = 15/293 (5%)

Query: 3   NSLYSFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIE---GTKTAVQ 59
           N L SF +D++PKVRKPYTITKQREKWTEEEHQRFL+ALK+YGRGWR+I+   GTKTAVQ
Sbjct: 38  NELNSFGSDNIPKVRKPYTITKQREKWTEEEHQRFLEALKLYGRGWRKIQEHVGTKTAVQ 97

Query: 60  IRSHAQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQE 119
           IRSHAQK FSKVV ES+G +ESS+ PIEIPPPRPKRKP HPYPRKSVD  K T  S+Q +
Sbjct: 98  IRSHAQKIFSKVVWESSGGNESSLKPIEIPPPRPKRKPAHPYPRKSVDIRKGTPASSQLD 157

Query: 120 NFTSSNALVSDKDRQSPTSVVSAFNSDTLGCAASDQQNGCSSPTSCTTEMHSVNLLPIEK 179
              S N+  S+KD  SPTSV+SA  SDTLG A S+Q N CSSPTSCTT+MHS++L P  K
Sbjct: 158 GSPSPNSSASEKDNLSPTSVLSALASDTLGTALSEQHNACSSPTSCTTDMHSISLPPSVK 217

Query: 180 ENEYVTSISFPKEEKISTLPAHLSAS------SNVEELASVSKDSVYPKGDAAAAPSCTS 233
           E E++TS S  +E+K +     +S S      S   EL   S D+V  +GDA    S TS
Sbjct: 218 EAEHLTSNSSREEDKETFSLIEMSCSPLEKFLSKKFELG--SDDTVCAEGDATKEASSTS 275

Query: 234 IKLFGRTVLVSDSWKPYSLGADSYKSPISKSSQENLDVDKKILSSQPHQSIWI 286
           IKLFG TV+V+ S K    GA+   S  S  +Q+N D DK+    +P Q++ +
Sbjct: 276 IKLFGMTVMVAASHKKSPPGAEFVLSMTSNENQDNADTDKE----KPAQTLLL 324

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224118068|ref|XP_002317724.1| predicted protein [Populus trichocarpa] gi|222858397|gb|EEE95944.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|110931850|gb|ABH02924.1| MYB transcription factor MYB131 [Glycine max] Back     alignment and taxonomy information
>gi|356560061|ref|XP_003548314.1| PREDICTED: uncharacterized protein LOC778089 [Glycine max] Back     alignment and taxonomy information
>gi|302398987|gb|ADL36788.1| MYBR domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|356531046|ref|XP_003534089.1| PREDICTED: uncharacterized protein LOC100101861 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356531048|ref|XP_003534090.1| PREDICTED: uncharacterized protein LOC100101861 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449507174|ref|XP_004162953.1| PREDICTED: uncharacterized LOC101217341 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439603|ref|XP_004137575.1| PREDICTED: uncharacterized protein LOC101217341 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255570631|ref|XP_002526271.1| conserved hypothetical protein [Ricinus communis] gi|223534402|gb|EEF36108.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
TAIR|locus:2014114372 EPR1 "EARLY-PHYTOCHROME-RESPON 0.237 0.193 0.706 7.4e-40
TAIR|locus:2169135287 RVE2 "REVEILLE 2" [Arabidopsis 0.264 0.278 0.662 4.3e-32
TAIR|locus:2167210387 RVE1 "REVEILLE 1" [Arabidopsis 0.240 0.188 0.710 6.9e-32
TAIR|locus:504955668336 AT3G10113 [Arabidopsis thalian 0.237 0.214 0.706 4.7e-29
TAIR|locus:2200970 645 LHY "LATE ELONGATED HYPOCOTYL" 0.207 0.097 0.712 1.1e-22
TAIR|locus:2044345 608 CCA1 "circadian clock associat 0.214 0.106 0.705 7.1e-21
TAIR|locus:2151251293 LCL1 "LHY/CCA1-like 1" [Arabid 0.204 0.211 0.597 1.7e-20
TAIR|locus:2025411287 ASG4 "ALTERED SEED GERMINATION 0.254 0.268 0.560 9.2e-20
TAIR|locus:2149589331 AT5G52660 [Arabidopsis thalian 0.234 0.214 0.567 1.1e-18
TAIR|locus:2124928303 AT4G01280 [Arabidopsis thalian 0.247 0.247 0.537 1.4e-18
TAIR|locus:2014114 EPR1 "EARLY-PHYTOCHROME-RESPONSIVE1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 287 (106.1 bits), Expect = 7.4e-40, Sum P(2) = 7.4e-40
 Identities = 53/75 (70%), Positives = 66/75 (88%)

Query:    11 DSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIE---GTKTAVQIRSHAQKF 67
             +++ KVRKPYT+TKQREKW+EEEH RFL+A+K+YGRGWRQI+   GTKTAVQIRSHAQKF
Sbjct:    61 ENVVKVRKPYTVTKQREKWSEEEHDRFLEAIKLYGRGWRQIQEHIGTKTAVQIRSHAQKF 120

Query:    68 FSKVVRESNGSSESS 82
             FSK+ +E++  SE S
Sbjct:   121 FSKMAQEADSRSEGS 135
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0007623 "circadian rhythm" evidence=IEP
TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955668 AT3G10113 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200970 LHY "LATE ELONGATED HYPOCOTYL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149589 AT5G52660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 1e-11
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-08
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 7e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 6e-07
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 5e-04
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 59.0 bits (143), Expect = 1e-11
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 24 KQREKWTEEEHQRFLDALKMYGRG-W-------RQIEGTK-TAVQIRSHAQKFFSKV 71
          K R  WTE+ H RFL A++  G   W         +     T  Q+ SH QK+  K 
Sbjct: 1  KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 303
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.66
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.32
KOG0724335 consensus Zuotin and related molecular chaperones 99.04
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.81
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.81
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.47
PLN03212249 Transcription repressor MYB5; Provisional 98.11
PLN03091 459 hypothetical protein; Provisional 97.84
PLN03212249 Transcription repressor MYB5; Provisional 97.67
PLN03091 459 hypothetical protein; Provisional 97.55
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.48
PLN03162526 golden-2 like transcription factor; Provisional 97.29
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.17
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.17
KOG1279506 consensus Chromatin remodeling factor subunit and 96.95
KOG0048238 consensus Transcription factor, Myb superfamily [T 95.96
KOG0724335 consensus Zuotin and related molecular chaperones 95.84
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 95.58
KOG4468 782 consensus Polycomb-group transcriptional regulator 95.06
KOG0049 939 consensus Transcription factor, Myb superfamily [T 93.99
KOG0049 939 consensus Transcription factor, Myb superfamily [T 93.45
KOG4329445 consensus DNA-binding protein [General function pr 93.42
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 93.17
smart0042668 TEA TEA domain. 92.31
KOG0051607 consensus RNA polymerase I termination factor, Myb 91.58
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 89.34
PF01285431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 88.8
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 87.74
KOG0051607 consensus RNA polymerase I termination factor, Myb 87.63
KOG3841455 consensus TEF-1 and related transcription factor, 86.82
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 86.8
PLN031421033 Probable chromatin-remodeling complex ATPase chain 85.78
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 83.12
KOG4167907 consensus Predicted DNA-binding protein, contains 81.5
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.66  E-value=6.7e-17  Score=119.73  Aligned_cols=47  Identities=43%  Similarity=0.649  Sum_probs=43.2

Q ss_pred             cCCCCCCHHHHHHHHHHHHHhCcC-c---eecc----CCC-CHHHHHhHHHHHhHH
Q 022044           24 KQREKWTEEEHQRFLDALKMYGRG-W---RQIE----GTK-TAVQIRSHAQKFFSK   70 (303)
Q Consensus        24 K~r~~WTeEEH~rFLegLe~yGr~-W---kkIa----gTR-T~~QVRSHAQKYF~K   70 (303)
                      |.+..||+|||++||+||+.||++ |   ++|+    .+| |+.||+|||||||.|
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k   56 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK   56 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence            467889999999999999999994 9   9997    578 999999999999986

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 1e-19
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 8e-15
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 5e-14
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 5e-13
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 2e-12
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-10
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 4e-10
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 4e-08
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 3e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 6e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 7e-05
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 9e-05
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 3e-04
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-04
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 4e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 80.6 bits (199), Expect = 1e-19
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 23 TKQREKWTEEEHQRFLDALKMYGRGWRQIE---GTKTAVQIRSHAQKFFSKVVRESNGSS 79
          +    KWT EE + F   L  +GR W +I    G++T +Q++S+A+++F   V+      
Sbjct: 6  SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65

Query: 80 ESS 82
            +
Sbjct: 66 TPN 68
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.49
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.43
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.41
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.32
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.22
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.2
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.18
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.16
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.03
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.0
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.97
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.95
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.92
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.45
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.86
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.84
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.83
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.83
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.75
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.72
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.65
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.64
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.63
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.63
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.59
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.58
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.58
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.55
2crg_A70 Metastasis associated protein MTA3; transcription 98.52
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.51
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.45
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.43
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.42
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.39
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.37
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.35
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.33
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.32
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.29
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.25
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.21
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.17
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.16
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.12
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.57
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.34
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.51
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 95.37
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 95.04
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 94.89
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 94.79
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 92.92
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 92.43
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 91.93
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 90.76
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 90.3
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 88.99
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 84.17
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
Probab=99.49  E-value=1.2e-14  Score=111.93  Aligned_cols=60  Identities=22%  Similarity=0.368  Sum_probs=54.6

Q ss_pred             CCCCCCCCCCeecccCCCCCCHHHHHHHHHHHHHhCcCceecc---CCCCHHHHHhHHHHHhH
Q 022044           10 NDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIE---GTKTAVQIRSHAQKFFS   69 (303)
Q Consensus        10 ~d~~~K~rKPytitK~r~~WTeEEH~rFLegLe~yGr~WkkIa---gTRT~~QVRSHAQKYF~   69 (303)
                      ...++|.++++.....++.||+||+++||+||++||.+|.+||   ++||+.|||.|+++|++
T Consensus         2 ssg~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~i   64 (79)
T 2yus_A            2 SSGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPI   64 (79)
T ss_dssp             CCSSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSCC
T ss_pred             CCcccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhcc
Confidence            3456788999988899999999999999999999997799999   99999999999999854
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 303
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 2e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-09
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 4e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 7e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 5e-06
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-04
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 4e-04
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 0.001
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 0.004
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.004
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 64.9 bits (158), Expect = 2e-14
 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 8/60 (13%)

Query: 24 KQREKWTEEEHQRFLDALKMYGRGWRQIEG--------TKTAVQIRSHAQKFFSKVVRES 75
          K R  WT E H +FL A+   G      +           T   + SH QKF   + + S
Sbjct: 5  KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS 64
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.6
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.37
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.3
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.11
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.08
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.96
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.94
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.91
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.79
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.77
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.74
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.73
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.67
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.38
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.1
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.83
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.3
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.11
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 93.54
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 87.97
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.60  E-value=3e-16  Score=116.37  Aligned_cols=52  Identities=33%  Similarity=0.452  Sum_probs=45.5

Q ss_pred             ccCCCCCCHHHHHHHHHHHHHhCcCc---eecc-----CCCCHHHHHhHHHHHhHHHHHh
Q 022044           23 TKQREKWTEEEHQRFLDALKMYGRGW---RQIE-----GTKTAVQIRSHAQKFFSKVVRE   74 (303)
Q Consensus        23 tK~r~~WTeEEH~rFLegLe~yGr~W---kkIa-----gTRT~~QVRSHAQKYF~Kl~k~   74 (303)
                      .|.+..||+|||++|++||+.||.+|   +.|.     +++|..||+||+||||.++.+.
T Consensus         4 kk~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQKYrl~l~k~   63 (64)
T d1irza_           4 KKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKV   63 (64)
T ss_dssp             CCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHHHHHHHHHSC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHHHHHHHHHhc
Confidence            35567899999999999999999996   4664     7899999999999999999763
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure