Citrus Sinensis ID: 022288


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MFCSQKNEGEVKDCAATRKMQKADREKLRRDRLNEHFTELGNALDPDRPKNDKATILADTVQLLKDLTSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRAMVPWAAMDHSVMMAPPSYPYPVPMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTFVPYMAPNTLVEQQSAQYASAVAQPSGRSQGSAKEDSGNKSSGESKIEKNEDSNDVTTDLELKTPGSTTDQDLPSGQRKSKKSLRKENSFTNGSSSSRCSSSRSVQDSSSNSVAGGRKADDLG
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mfcsqknegevkDCAATRKMQKADREKLRRDRLNEHFTElgnaldpdrpkndkatILADTVQLLKDLTSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRAMVPwaamdhsvmmappsypypvpmpmppgaipmhppmqpypmfgnqnpgvipnpcstfvpymapntlVEQQSAQYASavaqpsgrsqgsakedsgnkssgeskieknedsndvttdlelktpgsttdqdlpsgqrkskkslrkensftngssssrcsssrsvqdsssnsvaggrkaddlg
mfcsqknegevkdcaatrkmqkadreklrrdrLNEHftelgnaldpdrpknDKATILADTVQLLKDLTSQVEKLKTEhaalteesreltqeknDLREEKLSLRSEIENLNIQYQQRVRAMVPWAAMDHSVMMAPPSYPYPVPMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTFVPYMAPNTLVEQQSAQYASAVAqpsgrsqgsakedsgnkssgeskieknedsndvttdlelktpgsttdqdlpsgqrkskkslrkensftngssssrcsssrsvqdsssnsvaggrkaddlg
MFCSQKNEGEVKDCAATRKMQKADREKLRRDRLNEHFTELGNALDPDRPKNDKATILADTVQLLKDLTSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRAMVPWAAMDHSVmmappsypypvpmpmppgaipmhppmqpYPMFGNQNPGVIPNPCSTFVPYMAPNTLVEqqsaqyasavaqpsGRSQGSAKEDSGNKSSGESKIEKNEDSNDVTTDLELKTPGSTTDQDLPSGQRKSKKSLRKENSFTNGssssrcsssrsvqdsssnsVAGGRKADDLG
*******************************************************ILADTVQLLK*****************************************ENLNIQYQQRVRAMVPWAAMDHSV**************************************VIPNPCSTFVPYMAPNT******************************************************************************************************************
***********************************HFTELGNALD********ATILADTVQLLKDLTS************************************************************************PMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTF**************************************************************************************************************************
*************CAATRKMQKADREKLRRDRLNEHFTELGNALDPDRPKNDKATILADTVQLLKDLTSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRAMVPWAAMDHSVMMAPPSYPYPVPMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTFVPYMAPNTLVEQQ*****************************************VTTDLELKTPG*********************************************************
*************************EKLRRDRLNEHFTELGNALDPDRPKNDKATILADTVQLLKDLTSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRAMVPWAAMDHSVMMAPPSYPYPVPMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTFVPYMAPNT********************************************NDVTTDLELKT***********************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFCSQKNEGEVKDCAATRKMQKADREKLRRDRLNEHFTELGNALDPDRPKNDKATIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYQQRVRAMVPWAAMDHSVMMAPPSYPYPVPMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTFVPYMAPNTLVEQQSAQYASAVAQPSGRSQGSAKEDSGNKSSGESKIEKNEDSNDVTTDLELKTPGSTTDQDLPSGQRKSKKSLRKENSFTNGSSSSRCSSSRSVQDSSSNSVAGGRKADDLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query299 2.2.26 [Sep-21-2011]
Q9LT23337 Transcription factor bHLH yes no 0.939 0.833 0.644 2e-81
Q8W2F2286 Transcription factor bHLH no no 0.739 0.772 0.423 6e-42
Q9FH37234 Transcription factor ILR3 no no 0.528 0.675 0.371 4e-17
Q9LTC7320 Transcription factor bHLH no no 0.401 0.375 0.382 1e-16
Q8L467283 Transcription factor bHLH no no 0.391 0.413 0.410 3e-16
Q9SN74240 Transcription factor bHLH no no 0.331 0.412 0.414 3e-15
Q9C682226 Transcription factor bHLH no no 0.347 0.460 0.419 4e-14
>sp|Q9LT23|BH121_ARATH Transcription factor bHLH121 OS=Arabidopsis thaliana GN=BHLH121 PE=2 SV=1 Back     alignment and function desciption
 Score =  302 bits (774), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 225/295 (76%), Gaps = 14/295 (4%)

Query: 8   EGEVKDCAATRKMQKADREKLRRDRLNEHFTELGNALDPDRPKNDKATILADTVQLLKDL 67
           E EV D +A RK QKA REKLRR++LNEHF ELGN LDP+RPKNDKATIL DTVQLLK+L
Sbjct: 50  EEEVMDVSA-RKSQKAGREKLRREKLNEHFVELGNVLDPERPKNDKATILTDTVQLLKEL 108

Query: 68  TSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRAMVPW-AAM 126
           TS+V KLK+E+ ALT+ESRELTQEKNDLREEK SL+S+IENLN+QYQQR+R+M PW AAM
Sbjct: 109 TSEVNKLKSEYTALTDESRELTQEKNDLREEKTSLKSDIENLNLQYQQRLRSMSPWGAAM 168

Query: 127 DHSVMMA-PPSYPYPVPMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTFVPYMAPNT 185
           DH+VMMA PPS+PYP+P+ MPPG+IPMHP M  Y  FGNQNP +IP PC T++PYM PNT
Sbjct: 169 DHTVMMAPPPSFPYPMPIAMPPGSIPMHPSMPSYTYFGNQNPSMIPAPCPTYMPYMPPNT 228

Query: 186 LVEQQSAQYASAVAQPSGRSQGSAKEDSGNKSSGESKIEKNEDSNDVTTDLELKTPGSTT 245
           +VEQQS         P  RS+     +   K S ES+ EK EDSN+V T LELKTPGST+
Sbjct: 229 VVEQQSVHIPQ---NPGNRSR-----EPRAKVSRESRSEKAEDSNEVATQLELKTPGSTS 280

Query: 246 DQDLPSGQRKSKKSLR--KENSFTNGSSSSRCSSSRSVQD-SSSNSVAGGRKADD 297
           D+D      K+K+  R    NS    S SS+CSSS SV+D SSS+SVAGG+K DD
Sbjct: 281 DKDTLQRPEKTKRCKRNNNNNSIEESSHSSKCSSSPSVRDHSSSSSVAGGQKPDD 335





Arabidopsis thaliana (taxid: 3702)
>sp|Q8W2F2|BH011_ARATH Transcription factor bHLH11 OS=Arabidopsis thaliana GN=BHLH11 PE=2 SV=2 Back     alignment and function description
>sp|Q9FH37|ILR3_ARATH Transcription factor ILR3 OS=Arabidopsis thaliana GN=ILR3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTC7|BH034_ARATH Transcription factor bHLH34 OS=Arabidopsis thaliana GN=BHLH34 PE=2 SV=1 Back     alignment and function description
>sp|Q8L467|BH104_ARATH Transcription factor bHLH104 OS=Arabidopsis thaliana GN=BHLH104 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN74|BH047_ARATH Transcription factor bHLH47 OS=Arabidopsis thaliana GN=BHLH47 PE=2 SV=1 Back     alignment and function description
>sp|Q9C682|BH115_ARATH Transcription factor bHLH115 OS=Arabidopsis thaliana GN=BHLH115 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
255576719316 DNA binding protein, putative [Ricinus c 0.989 0.936 0.729 1e-105
224080584326 predicted protein [Populus trichocarpa] 0.852 0.782 0.772 1e-105
224103239283 predicted protein [Populus trichocarpa] 0.946 1.0 0.784 1e-104
356525604282 PREDICTED: transcription factor bHLH121- 0.866 0.918 0.741 1e-103
147815026378 hypothetical protein VITISV_018451 [Viti 0.983 0.777 0.714 8e-99
359475051329 PREDICTED: transcription factor bHLH121- 0.983 0.893 0.714 1e-98
356556676281 PREDICTED: transcription factor bHLH121- 0.866 0.921 0.703 7e-98
225431132327 PREDICTED: transcription factor bHLH121- 0.963 0.880 0.631 3e-84
297735012326 unnamed protein product [Vitis vinifera] 0.963 0.883 0.631 3e-84
449458566335 PREDICTED: transcription factor bHLH121- 0.979 0.874 0.640 4e-84
>gi|255576719|ref|XP_002529247.1| DNA binding protein, putative [Ricinus communis] gi|223531283|gb|EEF33125.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  389 bits (999), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 218/299 (72%), Positives = 241/299 (80%), Gaps = 3/299 (1%)

Query: 2   FC--SQKNEGEVKDCAATRKMQKADREKLRRDRLNEHFTELGNALDPDRPKNDKATILAD 59
           FC  SQ  E EVKD  A RK +KADREKLRRDRLNEHF ELG+ALDPD+PKNDKATIL D
Sbjct: 17  FCFDSQGLESEVKDSVAVRKSEKADREKLRRDRLNEHFIELGDALDPDKPKNDKATILTD 76

Query: 60  TVQLLKDLTSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRA 119
           T+QLLKDLTSQV KLK E+A LTEESRELTQEKNDLREEK SL+SEIENLNIQYQQR RA
Sbjct: 77  TIQLLKDLTSQVNKLKVEYATLTEESRELTQEKNDLREEKASLKSEIENLNIQYQQRARA 136

Query: 120 MVPWAAMDHSVMMAPPSYPYPVPMPMPPGAIPMHPPMQPYPMFGNQNPGVIPNPCSTFVP 179
             PW AMDHSV+MAP SYP+ +PMP+PP  I +HP MQPYP FGNQNP VI NP S FVP
Sbjct: 137 TYPWVAMDHSVVMAPTSYPFLMPMPIPPRPISLHPTMQPYPFFGNQNPTVIHNPYSIFVP 196

Query: 180 YMAPNTLVEQQSAQYASAVAQPSGRSQGSAKEDSGNKSSGESKIEKNEDSNDVTTDLELK 239
           YM P+ LVEQQS Q+A++ A P+  S  S KEDS NKSS ESK  K+ DSNDVTT+LELK
Sbjct: 197 YMTPSALVEQQSTQHATSSALPASGSHVSGKEDSKNKSSRESKTGKSWDSNDVTTELELK 256

Query: 240 TPGSTTDQDLPSGQRKSKKSLRKENSFTNGSSSSRCSSSRSVQDSSSNSVAGGRKADDL 298
           TPGSTTD DL S QRKSKKSL KENS T+GSS+SRCSS      SSS+S+AG  KADD+
Sbjct: 257 TPGSTTDPDLSSRQRKSKKSLGKENSITDGSSTSRCSSRSVQD-SSSSSIAGSPKADDI 314




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224080584|ref|XP_002306170.1| predicted protein [Populus trichocarpa] gi|222849134|gb|EEE86681.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103239|ref|XP_002312979.1| predicted protein [Populus trichocarpa] gi|222849387|gb|EEE86934.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356525604|ref|XP_003531414.1| PREDICTED: transcription factor bHLH121-like [Glycine max] Back     alignment and taxonomy information
>gi|147815026|emb|CAN74571.1| hypothetical protein VITISV_018451 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475051|ref|XP_002277206.2| PREDICTED: transcription factor bHLH121-like [Vitis vinifera] gi|297744660|emb|CBI37922.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356556676|ref|XP_003546649.1| PREDICTED: transcription factor bHLH121-like [Glycine max] Back     alignment and taxonomy information
>gi|225431132|ref|XP_002265960.1| PREDICTED: transcription factor bHLH121-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735012|emb|CBI17374.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458566|ref|XP_004147018.1| PREDICTED: transcription factor bHLH121-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
TAIR|locus:2092216337 bHLH121 "AT3G19860" [Arabidops 0.408 0.362 0.766 1.8e-68
UNIPROTKB|Q67U21343 OSJNBa0065F08.2 "Basic helix-l 0.424 0.370 0.661 1.1e-56
TAIR|locus:2135169286 bHLH11 "AT4G36060" [Arabidopsi 0.344 0.360 0.650 6.5e-39
UNIPROTKB|Q69V10265 P0506F02.119 "cDNA clone:J0230 0.374 0.422 0.419 1.7e-20
UNIPROTKB|Q2R1K8278 Os11g0601700 "Helix-loop-helix 0.317 0.341 0.473 4e-19
TAIR|locus:2157538234 ILR3 "AT5G54680" [Arabidopsis 0.364 0.465 0.439 2.2e-18
UNIPROTKB|Q6ZGM4236 OJ1442_E05.19 "cDNA clone:006- 0.351 0.444 0.435 5.8e-18
UNIPROTKB|Q6ZKI8253 OJ1119_D01.9 "BHLH transcripti 0.384 0.454 0.386 3.2e-17
TAIR|locus:2079102240 PYE "AT3G47640" [Arabidopsis t 0.351 0.437 0.4 1.1e-16
TAIR|locus:2086198320 bHLH34 "AT3G23210" [Arabidopsi 0.374 0.35 0.383 9e-16
TAIR|locus:2092216 bHLH121 "AT3G19860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 477 (173.0 bits), Expect = 1.8e-68, Sum P(2) = 1.8e-68
 Identities = 95/124 (76%), Positives = 110/124 (88%)

Query:     8 EGEVKDCAATRKMQKADREKLRRDRLNEHFTELGNALDPDRPKNDKATILADTVQLLKDL 67
             E EV D +A RK QKA REKLRR++LNEHF ELGN LDP+RPKNDKATIL DTVQLLK+L
Sbjct:    50 EEEVMDVSA-RKSQKAGREKLRREKLNEHFVELGNVLDPERPKNDKATILTDTVQLLKEL 108

Query:    68 TSQVEKLKTEHAALTEESRELTQEKNDLREEKLSLRSEIENLNIQYQQRVRAMVPW-AAM 126
             TS+V KLK+E+ ALT+ESRELTQEKNDLREEK SL+S+IENLN+QYQQR+R+M PW AAM
Sbjct:   109 TSEVNKLKSEYTALTDESRELTQEKNDLREEKTSLKSDIENLNLQYQQRLRSMSPWGAAM 168

Query:   127 DHSV 130
             DH+V
Sbjct:   169 DHTV 172


GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
UNIPROTKB|Q67U21 OSJNBa0065F08.2 "Basic helix-loop-helix-like protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2135169 bHLH11 "AT4G36060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q69V10 P0506F02.119 "cDNA clone:J023068N18, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2R1K8 Os11g0601700 "Helix-loop-helix DNA-binding domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2157538 ILR3 "AT5G54680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZGM4 OJ1442_E05.19 "cDNA clone:006-303-B03, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZKI8 OJ1119_D01.9 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2079102 PYE "AT3G47640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086198 bHLH34 "AT3G23210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LT23BH121_ARATHNo assigned EC number0.64400.93970.8338yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.IV.993.1
hypothetical protein (291 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 6e-08
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 1e-07
smart0035353 smart00353, HLH, helix loop helix domain 7e-07
pfam01496 707 pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni 2e-04
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 5e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information
 Score = 47.8 bits (115), Expect = 6e-08
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 18 RKMQKADREKLRRDRLNEHFTELGNAL-DPDRPKNDKATILADTVQLLKDLT 68
          R+    +RE+ RRDR+N+ F EL   L  P   K  KA IL   ++ +K L 
Sbjct: 1  RRKAHNERERRRRDRINDAFEELRELLPTPPNKKLSKAEILRLAIEYIKHLQ 52


Length = 52

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information
>gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 299
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.33
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.3
smart0035353 HLH helix loop helix domain. 99.29
KOG1318411 consensus Helix loop helix transcription factor EB 99.17
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.55
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 98.35
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.22
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 97.93
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.44
KOG0561373 consensus bHLH transcription factor [Transcription 97.2
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.11
PRK1542279 septal ring assembly protein ZapB; Provisional 97.06
COG307479 Uncharacterized protein conserved in bacteria [Fun 96.99
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.79
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.63
KOG4029228 consensus Transcription factor HAND2/Transcription 96.47
PRK11637 428 AmiB activator; Provisional 96.39
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.22
PLN0321793 transcription factor ATBS1; Provisional 96.2
PRK0084677 hypothetical protein; Provisional 96.18
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 96.17
PRK0440675 hypothetical protein; Provisional 95.95
PRK0211973 hypothetical protein; Provisional 95.89
PRK0279372 phi X174 lysis protein; Provisional 95.39
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 95.35
COG3883265 Uncharacterized protein conserved in bacteria [Fun 95.34
PRK1542279 septal ring assembly protein ZapB; Provisional 95.11
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.09
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 95.06
smart0033865 BRLZ basic region leucin zipper. 95.03
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 94.97
PRK0073668 hypothetical protein; Provisional 94.96
PRK0029568 hypothetical protein; Provisional 94.86
PRK0432574 hypothetical protein; Provisional 94.58
PRK10884206 SH3 domain-containing protein; Provisional 94.58
KOG3910632 consensus Helix loop helix transcription factor [T 94.54
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.49
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 94.47
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 94.21
COG3883265 Uncharacterized protein conserved in bacteria [Fun 94.1
PRK10884206 SH3 domain-containing protein; Provisional 94.05
PRK13169110 DNA replication intiation control protein YabA; Re 93.98
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 93.87
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 93.5
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 93.43
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 93.35
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 93.1
PRK11637 428 AmiB activator; Provisional 93.03
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 92.77
COG4026290 Uncharacterized protein containing TOPRIM domain, 92.68
TIGR0244965 conserved hypothetical protein TIGR02449. Members 92.65
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 92.62
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.57
COG307479 Uncharacterized protein conserved in bacteria [Fun 92.41
PRK13169110 DNA replication intiation control protein YabA; Re 92.37
TIGR0244965 conserved hypothetical protein TIGR02449. Members 91.93
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 91.85
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 91.84
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 91.8
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.7
PRK05771 646 V-type ATP synthase subunit I; Validated 91.67
COG3937108 Uncharacterized conserved protein [Function unknow 91.61
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 91.61
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 91.22
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 91.2
COG557057 Uncharacterized small protein [Function unknown] 91.13
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 91.08
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 91.08
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 91.03
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.87
PHA02562562 46 endonuclease subunit; Provisional 90.75
PF10186302 Atg14: UV radiation resistance protein and autopha 90.74
PRK10869553 recombination and repair protein; Provisional 90.54
COG290072 SlyX Uncharacterized protein conserved in bacteria 90.51
PF13851201 GAS: Growth-arrest specific micro-tubule binding 90.45
KOG1962216 consensus B-cell receptor-associated protein and r 90.26
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 90.15
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 89.93
PF13851201 GAS: Growth-arrest specific micro-tubule binding 89.83
PF14662193 CCDC155: Coiled-coil region of CCDC155 89.77
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 89.7
PF05529192 Bap31: B-cell receptor-associated protein 31-like 89.61
PF0500879 V-SNARE: Vesicle transport v-SNARE protein N-termi 89.58
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 89.52
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 89.38
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 89.27
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 88.87
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 88.84
PRK13922276 rod shape-determining protein MreC; Provisional 88.81
PF06637442 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th 88.66
COG4942 420 Membrane-bound metallopeptidase [Cell division and 88.63
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 88.44
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 88.41
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 88.24
PRK09039343 hypothetical protein; Validated 88.22
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 88.09
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 87.93
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 87.92
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 87.89
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 87.89
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 87.87
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 87.87
PF14662193 CCDC155: Coiled-coil region of CCDC155 87.77
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 87.71
COG4467114 Regulator of replication initiation timing [Replic 87.68
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 87.64
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 87.63
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 87.38
PRK00888105 ftsB cell division protein FtsB; Reviewed 87.21
smart0033865 BRLZ basic region leucin zipper. 87.18
PF14282106 FlxA: FlxA-like protein 87.15
PF00038312 Filament: Intermediate filament protein; InterPro: 87.06
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 86.91
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 86.83
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 86.72
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 86.66
PF05565162 Sipho_Gp157: Siphovirus Gp157; InterPro: IPR008840 86.66
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 86.59
COG2919117 Septum formation initiator [Cell division and chro 86.47
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 86.4
PF07200150 Mod_r: Modifier of rudimentary (Mod(r)) protein; I 86.14
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 86.04
KOG4571294 consensus Activating transcription factor 4 [Trans 85.92
PHA03011120 hypothetical protein; Provisional 85.79
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 85.79
PF10186302 Atg14: UV radiation resistance protein and autopha 85.69
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 85.65
PRK00888105 ftsB cell division protein FtsB; Reviewed 85.58
PRK02195201 V-type ATP synthase subunit D; Provisional 85.53
PF06632342 XRCC4: DNA double-strand break repair and V(D)J re 85.52
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 85.42
PHA02047101 phage lambda Rz1-like protein 85.35
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 85.32
COG2433652 Uncharacterized conserved protein [Function unknow 85.18
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 85.14
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 85.05
PF14282106 FlxA: FlxA-like protein 85.0
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 84.95
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 84.91
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 84.89
PF13870177 DUF4201: Domain of unknown function (DUF4201) 84.82
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 84.71
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 84.68
PRK09039343 hypothetical protein; Validated 84.6
PF0610390 DUF948: Bacterial protein of unknown function (DUF 84.34
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 84.28
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 84.2
KOG3898254 consensus Transcription factor NeuroD and related 83.9
TIGR00634563 recN DNA repair protein RecN. All proteins in this 83.87
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 83.75
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 83.57
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 83.57
TIGR02231 525 conserved hypothetical protein. This family consis 83.54
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 83.47
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 83.44
PF00038312 Filament: Intermediate filament protein; InterPro: 83.36
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 83.35
PRK10803263 tol-pal system protein YbgF; Provisional 83.2
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 83.03
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 82.92
PRK1141574 hypothetical protein; Provisional 82.48
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 82.38
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 82.19
KOG3650120 consensus Predicted coiled-coil protein [General f 82.06
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 81.93
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 81.88
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 81.82
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 81.73
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 81.71
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 81.66
PF15458254 NTR2: Nineteen complex-related protein 2 81.62
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 81.38
PF14257262 DUF4349: Domain of unknown function (DUF4349) 81.38
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 81.17
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 81.11
PRK03918880 chromosome segregation protein; Provisional 81.05
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 81.02
PF0610390 DUF948: Bacterial protein of unknown function (DUF 80.98
PRK14011144 prefoldin subunit alpha; Provisional 80.89
PF07200150 Mod_r: Modifier of rudimentary (Mod(r)) protein; I 80.88
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 80.85
COG2433652 Uncharacterized conserved protein [Function unknow 80.82
COG4942420 Membrane-bound metallopeptidase [Cell division and 80.79
KOG3650120 consensus Predicted coiled-coil protein [General f 80.76
KOG4196135 consensus bZIP transcription factor MafK [Transcri 80.74
PLN02678 448 seryl-tRNA synthetase 80.49
KOG3119269 consensus Basic region leucine zipper transcriptio 80.49
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 80.47
PRK05431 425 seryl-tRNA synthetase; Provisional 80.26
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 80.21
PF06632342 XRCC4: DNA double-strand break repair and V(D)J re 80.19
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 80.14
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 80.03
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
Probab=99.33  E-value=2.4e-12  Score=91.45  Aligned_cols=55  Identities=35%  Similarity=0.479  Sum_probs=48.9

Q ss_pred             hhhccchHHHHHHHHHHHHHHHHhhhccCCC--CCCCChhhhHHHHHHHHHHHHHHH
Q 022288           17 TRKMQKADREKLRRDRLNEHFTELGNALDPD--RPKNDKATILADTVQLLKDLTSQV   71 (299)
Q Consensus        17 ~Rk~~KAerERrRRdKLNErF~eLrslLvP~--~~K~DKASIL~DAI~ylKdLr~qV   71 (299)
                      .++..|..+||+||++||+.|.+|+.+|++.  ..|.||++||..||+||+.|+.++
T Consensus         3 ~~r~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~   59 (60)
T cd00083           3 SRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELL   59 (60)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            4667788999999999999999999986555  279999999999999999999876



A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and

>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK05771 V-type ATP synthase subunit I; Validated Back     alignment and domain information
>COG3937 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG5570 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF05565 Sipho_Gp157: Siphovirus Gp157; InterPro: IPR008840 This family contains both viral and bacterial proteins which are related to the Gp157 protein of the Streptococcus thermophilus SFi bacteriophage Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG2919 Septum formation initiator [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>PHA03011 hypothetical protein; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PRK02195 V-type ATP synthase subunit D; Provisional Back     alignment and domain information
>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PHA02047 phage lambda Rz1-like protein Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF06103 DUF948: Bacterial protein of unknown function (DUF948); InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PRK11415 hypothetical protein; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF15458 NTR2: Nineteen complex-related protein 2 Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF14257 DUF4349: Domain of unknown function (DUF4349) Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF06103 DUF948: Bacterial protein of unknown function (DUF948); InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins Back     alignment and domain information
>PRK14011 prefoldin subunit alpha; Provisional Back     alignment and domain information
>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3650 consensus Predicted coiled-coil protein [General function prediction only] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 2e-09
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 8e-09
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 2e-08
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 3e-06
1hlo_A80 Protein (transcription factor MAX); transcriptiona 8e-06
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 2e-05
4f3l_A361 Mclock, circadian locomoter output cycles protein 5e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
 Score = 52.8 bits (127), Expect = 2e-09
 Identities = 16/67 (23%), Positives = 30/67 (44%)

Query: 26 EKLRRDRLNEHFTELGNALDPDRPKNDKATILADTVQLLKDLTSQVEKLKTEHAALTEES 85
          EK  R  +N+   EL + +     K +K+ +L   +  ++ L    +KLK E+ +L    
Sbjct: 14 EKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAV 73

Query: 86 RELTQEK 92
           +    K
Sbjct: 74 HKSKSLK 80


>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.69
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.64
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.63
4ati_A118 MITF, microphthalmia-associated transcription fact 99.57
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.56
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.5
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.49
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.39
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.34
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.33
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.25
4f3l_A361 Mclock, circadian locomoter output cycles protein 98.97
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 98.89
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.82
4ath_A83 MITF, microphthalmia-associated transcription fact 98.81
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.81
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.36
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.65
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 97.54
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 96.07
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.69
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.17
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.06
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 94.32
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 94.01
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 93.99
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 93.88
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 93.63
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 93.47
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 93.42
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 92.76
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 92.74
3cve_A72 Homer protein homolog 1; coiled coil, alternative 92.49
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 92.45
3he5_B52 Synzip2; heterodimeric coiled-coil, de novo protei 92.41
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 92.17
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 92.01
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.3
4h22_A103 Leucine-rich repeat flightless-interacting protei; 91.09
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 90.93
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 90.88
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 90.8
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 90.79
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 90.38
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 90.13
3htk_A60 Structural maintenance of chromosomes protein 5; S 90.04
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 90.02
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 89.87
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 89.74
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 89.67
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 89.44
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 89.36
1s94_A180 S-syntaxin; three helix bundle, structural plastic 89.23
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 89.15
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 89.1
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 88.98
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 88.21
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 88.21
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 88.17
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 88.0
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 87.56
1ik9_A213 DNA repair protein XRCC4; DNA END joining, double- 87.48
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 87.3
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 87.29
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 87.12
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 86.97
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 86.93
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 86.4
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 86.21
1deb_A54 APC protein, adenomatous polyposis coli protein; c 86.15
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 86.11
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 86.08
1jcd_A52 Major outer membrane lipoprotein; protein folding, 85.61
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 85.46
1lwu_C323 Fibrinogen gamma chain; heterotrimer, protein-pept 85.37
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 85.23
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 84.96
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 84.79
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 84.75
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 84.69
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 84.51
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 84.38
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 84.3
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 84.26
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 84.22
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 84.07
2wt7_B90 Transcription factor MAFB; transcription, transcri 84.04
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 83.84
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 83.67
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 83.62
3htk_A60 Structural maintenance of chromosomes protein 5; S 83.54
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 83.22
1m1j_C409 Fibrinogen gamma chain; coiled coils, disulfide ri 82.69
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 82.44
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 82.27
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 82.24
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 82.21
3u06_A 412 Protein claret segregational; motor domain, stalk 81.87
3qne_A 485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 81.58
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 81.44
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 81.17
2dq0_A 455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 81.15
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 80.99
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 80.66
1zhc_A76 Hypothetical protein HP1242; A-helical protein, un 80.64
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 80.46
3v86_A27 De novo design helix; computational design of A pr 80.38
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.69  E-value=5.7e-17  Score=125.28  Aligned_cols=73  Identities=21%  Similarity=0.318  Sum_probs=64.5

Q ss_pred             hhhhccchHHHHHHHHHHHHHHHHhhhccCCCC-CCCChhhhHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHH
Q 022288           16 ATRKMQKADREKLRRDRLNEHFTELGNALDPDR-PKNDKATILADTVQLLKDLTSQVEKLKTEHAALTEESRELT   89 (299)
Q Consensus        16 a~Rk~~KAerERrRRdKLNErF~eLrslLvP~~-~K~DKASIL~DAI~ylKdLr~qVq~Lk~en~~L~eE~~eLk   89 (299)
                      ..|+..|..+||+||++||++|.+|+++| |+. .|+|||+||.+||+||+.|+.+++.|+.++..|..+++...
T Consensus         4 ~~rr~~H~~~ErrRR~~in~~f~~L~~lv-P~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~~~~~~   77 (82)
T 1am9_A            4 GEKRTAHNAIEKRYRSSINDKIIELKDLV-VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSK   77 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-TCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHhhhhHHHHHHHHHHHHHHHHHHhc-cCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            45778888999999999999999999985 655 79999999999999999999999999998888887766543



>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3he5_B Synzip2; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>1s94_A S-syntaxin; three helix bundle, structural plasticity, endocytosis-exocy complex; 3.34A {Loligo pealei} SCOP: a.47.2.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A Back     alignment and structure
>1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1zhc_A Hypothetical protein HP1242; A-helical protein, unknown function; NMR {Helicobacter pylori} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v86_A De novo design helix; computational design of A protein crystal, helical coil, DE designed helix, de novo protein; 2.91A {Synthetic} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 299
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 1e-14
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 3e-13
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 1e-12
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 4e-12
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 5e-11
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 9e-08
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 4e-07
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 2e-05
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Max protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 66.0 bits (161), Expect = 1e-14
 Identities = 14/80 (17%), Positives = 34/80 (42%), Gaps = 1/80 (1%)

Query: 18 RKMQKADREKLRRDRLNEHFTELGNALDPDR-PKNDKATILADTVQLLKDLTSQVEKLKT 76
          ++      E+ RRD + + F  L +++   +  K  +A IL    + ++ +  +    + 
Sbjct: 2  KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQ 61

Query: 77 EHAALTEESRELTQEKNDLR 96
          +   L  ++  L Q+   L 
Sbjct: 62 DIDDLKRQNALLEQQVRALG 81


>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.63
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.38
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.37
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.21
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 91.4
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Max protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65  E-value=1.5e-16  Score=120.11  Aligned_cols=78  Identities=18%  Similarity=0.330  Sum_probs=63.9

Q ss_pred             hhccchHHHHHHHHHHHHHHHHhhhccCCCC-CCCChhhhHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHH
Q 022288           18 RKMQKADREKLRRDRLNEHFTELGNALDPDR-PKNDKATILADTVQLLKDLTSQVEKLKTEHAALTEESRELTQEKNDL   95 (299)
Q Consensus        18 Rk~~KAerERrRRdKLNErF~eLrslLvP~~-~K~DKASIL~DAI~ylKdLr~qVq~Lk~en~~L~eE~~eLk~EkNEL   95 (299)
                      |+..|..+||+||++||+.|.+|+++|++.. .|++|++||..||.||+.|+.+++.|..++..|..+...|..+.+.|
T Consensus         2 rR~~Hn~~Er~RR~~in~~f~~L~~llP~~~~~k~sK~~iL~~A~~yI~~L~~~~~~l~~~~~~l~~~~~~L~~~l~~L   80 (83)
T d1nkpb_           2 KRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRAL   80 (83)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTSGGGTTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5677889999999999999999999864332 59999999999999999999999988877766666665555555443



>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure