Citrus Sinensis ID: 022439
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 297 | ||||||
| 224081308 | 295 | predicted protein [Populus trichocarpa] | 0.989 | 0.996 | 0.828 | 1e-137 | |
| 255544127 | 295 | DNA binding protein, putative [Ricinus c | 0.989 | 0.996 | 0.838 | 1e-137 | |
| 356521185 | 296 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.993 | 0.822 | 1e-137 | |
| 449464296 | 295 | PREDICTED: transcription factor DIVARICA | 0.989 | 0.996 | 0.835 | 1e-135 | |
| 302398973 | 294 | MYBR domain class transcription factor [ | 0.976 | 0.986 | 0.808 | 1e-134 | |
| 356575299 | 296 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.993 | 0.802 | 1e-132 | |
| 356526842 | 296 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.993 | 0.809 | 1e-131 | |
| 358248190 | 296 | uncharacterized protein LOC100819797 [Gl | 0.989 | 0.993 | 0.806 | 1e-131 | |
| 302398969 | 291 | MYBR domain class transcription factor [ | 0.973 | 0.993 | 0.799 | 1e-130 | |
| 327412653 | 291 | putative MYB transcription factor [Rosa | 0.966 | 0.986 | 0.774 | 1e-124 |
| >gi|224081308|ref|XP_002306366.1| predicted protein [Populus trichocarpa] gi|222855815|gb|EEE93362.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 494 bits (1271), Expect = e-137, Method: Compositional matrix adjust.
Identities = 247/298 (82%), Positives = 270/298 (90%), Gaps = 4/298 (1%)
Query: 1 MTVDEVGSSSVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDD 60
M+VDE GS S+WTKEQDKAFENAL +YPED SD WEKI ADV GK++EEIK HYELLV+D
Sbjct: 1 MSVDEGGSGSLWTKEQDKAFENALATYPEDTSDWWEKITADVAGKTVEEIKHHYELLVED 60
Query: 61 VNRIESGCVPLPSYNSSSDGSMSHAGDEGTSNGKKGGHYGHFNSESN-GNKSSRSDQERR 119
+++IE+GCVPLP+Y+SSS+GS SHA DEGT GKKGGH GH NS+SN GNK+SRSDQERR
Sbjct: 61 ISQIEAGCVPLPNYSSSSEGSTSHAIDEGT--GKKGGHLGHHNSDSNNGNKASRSDQERR 118
Query: 120 KGIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKDRR 179
KGIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKDRR
Sbjct: 119 KGIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKDRR 178
Query: 180 RSSIHDITSVNNGDISAPQGPITGQTNGSGGGGSSGKSSKQPPQHSAGPPGVGMYGAPTM 239
RSSIHDITSV NGD++APQGPITGQTNGS GSSGK++KQPP GPPGVG+YG PT+
Sbjct: 179 RSSIHDITSVGNGDVAAPQGPITGQTNGS-AAGSSGKAAKQPPAQPVGPPGVGIYGPPTI 237
Query: 240 GQPIGGPLVSAVGTPVNLPAPAHMAYGVRAPVPGTVVPGAPMNVSPMPYPMPHASAHR 297
GQPIGGPLVSAVGTPVNLPAPAHMAYGVRAPVPGTVVPGAPMN+ PM YPMPH + HR
Sbjct: 238 GQPIGGPLVSAVGTPVNLPAPAHMAYGVRAPVPGTVVPGAPMNMVPMTYPMPHTTTHR 295
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255544127|ref|XP_002513126.1| DNA binding protein, putative [Ricinus communis] gi|223548137|gb|EEF49629.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356521185|ref|XP_003529238.1| PREDICTED: uncharacterized protein LOC100779792 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449464296|ref|XP_004149865.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus] gi|449531095|ref|XP_004172523.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|302398973|gb|ADL36781.1| MYBR domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|356575299|ref|XP_003555779.1| PREDICTED: uncharacterized protein LOC100797809 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356526842|ref|XP_003532025.1| PREDICTED: uncharacterized protein LOC100820272 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358248190|ref|NP_001240091.1| uncharacterized protein LOC100819797 [Glycine max] gi|255641236|gb|ACU20895.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|302398969|gb|ADL36779.1| MYBR domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|327412653|emb|CCA29115.1| putative MYB transcription factor [Rosa hybrid cultivar] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 297 | ||||||
| TAIR|locus:2159607 | 298 | AT5G08520 [Arabidopsis thalian | 0.962 | 0.959 | 0.627 | 2.4e-92 | |
| TAIR|locus:2028461 | 314 | AT1G49010 [Arabidopsis thalian | 0.838 | 0.792 | 0.512 | 1.4e-62 | |
| TAIR|locus:2171711 | 337 | AT5G23650 [Arabidopsis thalian | 0.659 | 0.581 | 0.512 | 1.6e-53 | |
| UNIPROTKB|Q8S9H7 | 307 | DIVARICATA "Transcription fact | 0.643 | 0.622 | 0.517 | 1.3e-50 | |
| TAIR|locus:2154508 | 288 | AT5G58900 [Arabidopsis thalian | 0.609 | 0.628 | 0.543 | 1.7e-50 | |
| TAIR|locus:2042872 | 298 | AT2G38090 [Arabidopsis thalian | 0.609 | 0.607 | 0.518 | 4.7e-48 | |
| TAIR|locus:2166459 | 277 | AT5G05790 [Arabidopsis thalian | 0.602 | 0.646 | 0.502 | 3.1e-44 | |
| TAIR|locus:2150149 | 267 | AT5G01200 [Arabidopsis thalian | 0.754 | 0.838 | 0.416 | 2.5e-42 | |
| TAIR|locus:2074723 | 263 | AT3G11280 [Arabidopsis thalian | 0.562 | 0.634 | 0.524 | 3.2e-42 | |
| TAIR|locus:2075775 | 287 | AT3G10580 [Arabidopsis thalian | 0.289 | 0.299 | 0.545 | 2.4e-35 |
| TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 920 (328.9 bits), Expect = 2.4e-92, P = 2.4e-92
Identities = 194/309 (62%), Positives = 215/309 (69%)
Query: 1 MTVDEVGSSSVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDD 60
MTV+EV SVW++E D AFE AL + +++ +RWEKIAADVPGKS+E+IK+HYELLV+D
Sbjct: 1 MTVEEVSDGSVWSREDDIAFERALANNTDESEERWEKIAADVPGKSVEQIKEHYELLVED 60
Query: 61 VNRIESGCVPLPSYNSSSDGSMSHAGDEGTSNGKKGGHYGHFNSESNGNKSSRSDQERRK 120
V RIESGCVPLP+Y S +GS HAGDEG S+ KKGG+ H ESN S+SDQERRK
Sbjct: 61 VTRIESGCVPLPAYGSP-EGSNGHAGDEGASS-KKGGN-SHAG-ESNQAGKSKSDQERRK 116
Query: 121 GIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKDRRR 180
GIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKDRRR
Sbjct: 117 GIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFIRLNSMNKDRRR 176
Query: 181 SSIHDITSVNNGDISAPQGPITGQTNXX---------XXXXXXXXXXXQPPQH-SAGPPG 230
SSIHDITSV N D+S PQGPITGQ N Q S PPG
Sbjct: 177 SSIHDITSVGNADVSTPQGPITGQNNSNNNNNNNNNNSSPAVAGGGNKSAKQAVSQAPPG 236
Query: 231 VGMYGAPTMGQPIGGPLVSAVGTPVNLPAPAHMAYXXXXXXXXXXXX-XXXMNVSPMPYP 289
MYG P +GQP AVGTPVNLPAP HMAY MN+ MPY
Sbjct: 237 PPMYGTPAIGQP-------AVGTPVNLPAPPHMAYGVHAAPVPGSVVPGAAMNIGQMPYT 289
Query: 290 MPHA-SAHR 297
MP +AHR
Sbjct: 290 MPRTPTAHR 298
|
|
| TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171711 AT5G23650 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150149 AT5G01200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075775 AT3G10580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 297 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 2e-16 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 1e-10 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 2e-10 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 5e-10 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-09 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 6e-09 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 1e-07 | |
| cd11661 | 46 | cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Doma | 2e-05 | |
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 1e-04 | |
| COG5114 | 432 | COG5114, COG5114, Histone acetyltransferase comple | 0.004 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 71.7 bits (176), Expect = 2e-16
Identities = 23/57 (40%), Positives = 29/57 (50%), Gaps = 4/57 (7%)
Query: 119 RKGIAWTEDEHRLFLLGLDKYGKGDW---RSISRNFVVTR-TPTQVASHAQKYFIRL 171
+ + WTED H FL + K G DW + I VV T QVASH QKY ++
Sbjct: 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212559 cd11661, SANT_MTA3_like, Myb-Like Dna-Binding Domain of MTA3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
| >gnl|CDD|227445 COG5114, COG5114, Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.88 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.85 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.81 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.55 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.51 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.5 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.48 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 99.34 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.3 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.29 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.15 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.15 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.06 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 99.05 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.05 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.95 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.91 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 98.87 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.82 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 98.74 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.74 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.66 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 98.57 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 98.01 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 97.99 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 97.95 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.95 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.94 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.91 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.85 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.6 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 97.33 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 97.2 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 97.17 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 97.14 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 97.11 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 97.08 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 97.05 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.88 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 96.83 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 96.68 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 96.49 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.35 | |
| KOG1878 | 1672 | consensus Nuclear receptor coregulator SMRT/SMRTER | 96.07 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 95.54 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 94.81 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 94.74 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 94.62 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 94.58 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 94.47 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 94.24 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 94.21 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 94.17 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 93.73 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 93.52 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 93.51 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 93.05 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 92.86 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 92.05 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 91.92 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 90.4 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 90.21 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 89.67 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 88.77 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 88.25 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 88.18 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 88.03 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 88.01 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 87.74 | |
| PF11035 | 344 | SnAPC_2_like: Small nuclear RNA activating complex | 86.98 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 84.55 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 83.78 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 82.4 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 82.18 |
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Probab=99.88 E-value=4.7e-22 Score=181.34 Aligned_cols=103 Identities=17% Similarity=0.209 Sum_probs=89.9
Q ss_pred CCCCCCCHHHHHHHHHHHHHCCCCCChhHHHHhhhC-CCCCHHHHHHHHHHhhhhhhhcccCCCCCCCCCCCCCCCCCCC
Q 022439 7 GSSSVWTKEQDKAFENALVSYPEDASDRWEKIAADV-PGKSLEEIKQHYELLVDDVNRIESGCVPLPSYNSSSDGSMSHA 85 (297)
Q Consensus 7 ~~~~~WT~EEdk~Le~Ala~~p~~~~~rWekIA~~V-pGRT~~Qcr~rY~~l~~dv~~IesG~v~lp~y~~~~~~~~~~~ 85 (297)
..++.||+|||++|.++|++|+.. +|..||+.+ ++||.+||++||..++..
T Consensus 23 lKRg~WT~EEDe~L~~lV~kyG~~---nW~~IAk~~g~gRT~KQCReRW~N~L~P------------------------- 74 (249)
T PLN03212 23 MKRGPWTVEEDEILVSFIKKEGEG---RWRSLPKRAGLLRCGKSCRLRWMNYLRP------------------------- 74 (249)
T ss_pred CcCCCCCHHHHHHHHHHHHHhCcc---cHHHHHHhhhcCCCcchHHHHHHHhhch-------------------------
Confidence 456789999999999999999975 499999998 599999999999977753
Q ss_pred CCCCCCCCCCCCCCCccCCCCCCCCCCcchhhhccCCCCCHHHHHHHHHHHHHhCCCchhhhhhhhcCCCCHHHHHHHHH
Q 022439 86 GDEGTSNGKKGGHYGHFNSESNGNKSSRSDQERRKGIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQ 165 (297)
Q Consensus 86 ~~~~~~~~~~gg~~~~~~~~~~~~~~~~~~~~~kk~~~WT~eEd~~ll~~l~k~G~g~W~~Iar~~v~tRT~~Q~~sh~q 165 (297)
..+.++||+|||++|++++.+||. +|..||+ +|++||+.||+|||.
T Consensus 75 --------------------------------~I~kgpWT~EED~lLlel~~~~Gn-KWs~IAk-~LpGRTDnqIKNRWn 120 (249)
T PLN03212 75 --------------------------------SVKRGGITSDEEDLILRLHRLLGN-RWSLIAG-RIPGRTDNEIKNYWN 120 (249)
T ss_pred --------------------------------hcccCCCChHHHHHHHHHHHhccc-cHHHHHh-hcCCCCHHHHHHHHH
Confidence 012238999999999999999998 9999996 999999999999998
Q ss_pred HHHHHH
Q 022439 166 KYFIRL 171 (297)
Q Consensus 166 ky~~r~ 171 (297)
.++++.
T Consensus 121 s~LrK~ 126 (249)
T PLN03212 121 THLRKK 126 (249)
T ss_pred HHHhHH
Confidence 777654
|
|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG1878 consensus Nuclear receptor coregulator SMRT/SMRTER, contains Myb-like domains [Transcription] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 297 | ||||
| 2cjj_A | 93 | Crystal Structure Of The Myb Domain Of The Rad Tran | 2e-15 | ||
| 2m2e_A | 73 | Solution Nmr Structure Of The Sant Domain Of Human | 5e-06 | ||
| 2cqr_A | 73 | Solution Structure Of Rsgi Ruh-043, A Myb Dna-Bindi | 1e-05 | ||
| 4eef_G | 74 | Crystal Structure Of The Designed Inhibitor Protein | 2e-05 |
| >pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 | Back alignment and structure |
|
| >pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 | Back alignment and structure |
| >pdb|2CQR|A Chain A, Solution Structure Of Rsgi Ruh-043, A Myb Dna-Binding Domain In Human Cdna Length = 73 | Back alignment and structure |
| >pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 297 | |||
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 2e-36 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 8e-27 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 2e-05 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 7e-26 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 6e-23 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 5e-19 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 2e-06 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 3e-16 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 4e-16 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 4e-08 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 3e-15 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 1e-04 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 1e-10 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 4e-10 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 2e-07 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 5e-10 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 7e-09 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 1e-08 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 3e-07 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 2e-08 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 5e-08 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 6e-07 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 6e-07 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 8e-07 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 4e-06 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 6e-06 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 8e-06 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 1e-05 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 2e-05 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 3e-05 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 8e-05 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 4e-04 |
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
Score = 124 bits (313), Expect = 2e-36
Identities = 34/79 (43%), Positives = 51/79 (64%)
Query: 7 GSSSVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDDVNRIES 66
GS W+ +++KAFE AL Y +D DRW +A V G++ EE+K+HYE+LV+D+ IES
Sbjct: 6 GSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIES 65
Query: 67 GCVPLPSYNSSSDGSMSHA 85
G VP P+Y ++ +
Sbjct: 66 GKVPFPNYRTTGGNMKTDE 84
|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Length = 304 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Length = 70 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.94 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.93 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.93 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.92 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.92 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.89 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.88 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.81 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.8 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.72 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.65 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.64 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.63 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.58 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 99.56 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.55 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.55 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.55 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 99.55 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.54 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.53 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.52 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.52 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.49 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.49 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.47 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.46 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.43 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.41 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.41 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.4 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.38 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.37 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.37 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.06 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.35 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.34 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.34 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.34 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.33 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.33 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.32 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.32 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.29 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.29 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.28 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.27 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.26 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.26 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.25 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.21 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.21 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.19 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.18 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.18 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.15 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.14 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.13 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.13 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.1 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.08 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 99.06 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 99.05 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.03 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.02 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.99 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.46 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.86 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 98.83 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.83 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.81 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.77 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.66 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.66 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.63 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 98.62 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.61 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.58 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.49 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.05 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.99 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.98 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.97 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.89 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 97.8 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.79 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.92 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.72 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.55 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.31 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 97.18 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.83 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.76 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.7 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 95.98 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 95.45 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 91.67 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 80.81 | |
| 2hzd_A | 82 | Transcriptional enhancer factor TEF-1; DNA-binding | 80.62 |
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
Probab=99.94 E-value=2.6e-26 Score=184.94 Aligned_cols=104 Identities=15% Similarity=0.359 Sum_probs=91.4
Q ss_pred CCCCHHHHHHHHHHHHHCCCCCChhHHHHhhhCCCCCHHHHHHHHHHhhhhhhhcccCCCCCCCCCCCCCCCCCCCCCCC
Q 022439 10 SVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDDVNRIESGCVPLPSYNSSSDGSMSHAGDEG 89 (297)
Q Consensus 10 ~~WT~EEdk~Le~Ala~~p~~~~~rWekIA~~VpGRT~~Qcr~rY~~l~~dv~~IesG~v~lp~y~~~~~~~~~~~~~~~ 89 (297)
+.||.|||++|.++|..|+.. +|.+||.+|+|||..||++||..+++. +
T Consensus 2 ~~Wt~eED~~L~~~v~~~g~~---~W~~Ia~~~~~Rt~~qcr~Rw~~~L~p------------~---------------- 50 (107)
T 2k9n_A 2 VKFTEEEDLKLQQLVMRYGAK---DWIRISQLMITRNPRQCRERWNNYINP------------A---------------- 50 (107)
T ss_dssp CSSCHHHHHHHHHHHHHHCSS---CHHHHHHHTTTSCHHHHHHHHHHHSSS------------C----------------
T ss_pred CCCCHHHHHHHHHHHHHHCCC---CHHHHhhhcCCCCHHHHHHHHHHHHcc------------c----------------
Confidence 679999999999999999974 499999999999999999999976642 0
Q ss_pred CCCCCCCCCCCccCCCCCCCCCCcchhhhccCCCCCHHHHHHHHHHHHHhCCCchhhhhhhhcCCCCHHHHHHHHHHHHH
Q 022439 90 TSNGKKGGHYGHFNSESNGNKSSRSDQERRKGIAWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKYFI 169 (297)
Q Consensus 90 ~~~~~~gg~~~~~~~~~~~~~~~~~~~~~kk~~~WT~eEd~~ll~~l~k~G~g~W~~Iar~~v~tRT~~Q~~sh~qky~~ 169 (297)
.+.++||+|||.+|+.++.+||. +|..||+ +|++||+.||++||+.+.+
T Consensus 51 -----------------------------i~~~~WT~eEd~~L~~~~~~~G~-~W~~Ia~-~l~gRt~~~~k~rw~~l~r 99 (107)
T 2k9n_A 51 -----------------------------LRTDPWSPEEDMLLDQKYAEYGP-KWNKISK-FLKNRSDNNIRNRWMMIAR 99 (107)
T ss_dssp -----------------------------CTTCCCCHHHHHHHHHHHHHTCS-CHHHHHH-HHSSSCHHHHHHHHHHHHH
T ss_pred -----------------------------ccccccCHHHHHHHHHHHHHhCc-CHHHHHH-HCCCCCHHHHHHHHHHHHh
Confidence 01238999999999999999999 9999996 9999999999999999888
Q ss_pred HHhccC
Q 022439 170 RLNSMN 175 (297)
Q Consensus 170 r~~~~~ 175 (297)
+..+..
T Consensus 100 ~~~~~~ 105 (107)
T 2k9n_A 100 HRAKHQ 105 (107)
T ss_dssp HHHSST
T ss_pred hHHHhh
Confidence 876443
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 297 | ||||
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 1e-18 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 9e-06 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 7e-18 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 1e-05 | |
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 1e-17 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 3e-16 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 7e-06 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 7e-11 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 8e-07 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 9e-11 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 2e-06 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 3e-09 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 1e-05 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 4e-09 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 2e-04 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 6e-09 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 2e-06 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 1e-05 | |
| d1ofcx1 | 52 | a.4.1.3 (X:799-850) SANT domain of the nucleosome | 3e-05 | |
| d1ofcx1 | 52 | a.4.1.3 (X:799-850) SANT domain of the nucleosome | 0.001 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 7e-04 |
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Radialis species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Score = 76.1 bits (187), Expect = 1e-18
Identities = 30/61 (49%), Positives = 43/61 (70%)
Query: 10 SVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDDVNRIESGCV 69
W+ +++KAFE AL Y +D DRW +A V G++ EE+K+HYE+LV+D+ IESG V
Sbjct: 2 RPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKV 61
Query: 70 P 70
P
Sbjct: 62 P 62
|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.79 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.62 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.62 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.56 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.56 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.53 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.53 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.53 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.45 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.43 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.42 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.38 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.38 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.38 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.36 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.36 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.33 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.33 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.26 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.26 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.23 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.22 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 99.21 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.19 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.16 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.13 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.1 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.1 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 99.02 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.01 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.8 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.72 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.69 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 98.42 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 98.11 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.39 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 97.18 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 97.14 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 97.09 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 95.74 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 95.61 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 94.94 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 94.09 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 88.53 |
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Radialis species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.79 E-value=6.7e-20 Score=132.92 Aligned_cols=63 Identities=48% Similarity=0.920 Sum_probs=60.3
Q ss_pred CCCCCHHHHHHHHHHHHHCCCCCChhHHHHhhhCCCCCHHHHHHHHHHhhhhhhhcccCCCCC
Q 022439 9 SSVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDDVNRIESGCVPL 71 (297)
Q Consensus 9 ~~~WT~EEdk~Le~Ala~~p~~~~~rWekIA~~VpGRT~~Qcr~rY~~l~~dv~~IesG~v~l 71 (297)
++.||.|||++|++||++|+.+.+++|.+||.+|+|||..||++||+.|++||+.||+|.+++
T Consensus 1 G~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf 63 (63)
T d2cjja1 1 GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF 63 (63)
T ss_dssp CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred CcCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence 468999999999999999999988999999999999999999999999999999999998875
|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|