Citrus Sinensis ID: 022480
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| 449446279 | 287 | PREDICTED: unknown protein DS12 from 2D- | 0.959 | 0.989 | 0.717 | 1e-115 | |
| 449494163 | 283 | PREDICTED: unknown protein DS12 from 2D- | 0.945 | 0.989 | 0.710 | 1e-113 | |
| 224110178 | 217 | predicted protein [Populus trichocarpa] | 0.733 | 1.0 | 0.917 | 1e-110 | |
| 224097618 | 218 | predicted protein [Populus trichocarpa] | 0.736 | 1.0 | 0.899 | 1e-110 | |
| 388495334 | 282 | unknown [Lotus japonicus] | 0.939 | 0.985 | 0.717 | 1e-110 | |
| 356575488 | 282 | PREDICTED: unknown protein DS12 from 2D- | 0.847 | 0.890 | 0.789 | 1e-108 | |
| 15238305 | 301 | ACT domain-containing protein [Arabidops | 0.983 | 0.966 | 0.693 | 1e-108 | |
| 21592963 | 301 | unknown [Arabidopsis thaliana] | 0.847 | 0.833 | 0.763 | 1e-108 | |
| 356536361 | 283 | PREDICTED: unknown protein DS12 from 2D- | 0.847 | 0.886 | 0.785 | 1e-107 | |
| 255560331 | 214 | amino acid binding protein, putative [Ri | 0.719 | 0.995 | 0.897 | 1e-107 |
| >gi|449446279|ref|XP_004140899.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 419 bits (1078), Expect = e-115, Method: Compositional matrix adjust.
Identities = 213/297 (71%), Positives = 246/297 (82%), Gaps = 13/297 (4%)
Query: 1 MAFTATPLFSSTASSSSTALHRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLS-RKN 59
M +++ +S+ +S S RS+F + +F A H R + G L+
Sbjct: 3 MPTSSSTFIASSYTSPSPFPCRSRFFEPEFVAHVPH----------RCFGGGARLAFLLK 52
Query: 60 RNILFASVNGTNAVSPTPLKSDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDT 119
NIL AS NG NAVSP L DQD+ +PMP VLIDQDS+S+ATIV++SFGDRLGALIDT
Sbjct: 53 WNILSASTNGLNAVSPASLMFDQDS--VPMPIVLIDQDSDSNATIVEVSFGDRLGALIDT 110
Query: 120 MNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHP 179
M ALKDLGLDVAKGTV+TEGSVKQTKF++TRLD+GRKVEDPDLLE IRLTIINNLLKYHP
Sbjct: 111 MRALKDLGLDVAKGTVSTEGSVKQTKFYLTRLDSGRKVEDPDLLESIRLTIINNLLKYHP 170
Query: 180 ESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIA 239
ESS+QLAMGEAFGI+ PEKKLDVDIATH+HVK DGPKRSLLY+ETADRPGLL+E++K++A
Sbjct: 171 ESSQQLAMGEAFGIQPPEKKLDVDIATHVHVKADGPKRSLLYLETADRPGLLLEVIKMLA 230
Query: 240 DVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY 296
D+N+DVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQV+VNCLRYYLRRPETDIDSY
Sbjct: 231 DINIDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVVVNCLRYYLRRPETDIDSY 287
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449494163|ref|XP_004159466.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224110178|ref|XP_002315438.1| predicted protein [Populus trichocarpa] gi|222864478|gb|EEF01609.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224097618|ref|XP_002311013.1| predicted protein [Populus trichocarpa] gi|222850833|gb|EEE88380.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388495334|gb|AFK35733.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356575488|ref|XP_003555872.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15238305|ref|NP_196094.1| ACT domain-containing protein [Arabidopsis thaliana] gi|7413536|emb|CAB86016.1| putative protein [Arabidopsis thaliana] gi|9758449|dbj|BAB08978.1| unnamed protein product [Arabidopsis thaliana] gi|18252933|gb|AAL62393.1| putative protein [Arabidopsis thaliana] gi|21389645|gb|AAM48021.1| putative protein [Arabidopsis thaliana] gi|332003394|gb|AED90777.1| ACT domain-containing protein [Arabidopsis thaliana] gi|347949480|gb|AEP31953.1| ACT domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21592963|gb|AAM64912.1| unknown [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356536361|ref|XP_003536707.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255560331|ref|XP_002521182.1| amino acid binding protein, putative [Ricinus communis] gi|223539629|gb|EEF41213.1| amino acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| TAIR|locus:2175458 | 301 | ACR12 "ACT domain repeats 12" | 0.847 | 0.833 | 0.763 | 1e-98 | |
| TAIR|locus:2015616 | 290 | ACR11 "ACT domain repeats 11" | 0.733 | 0.748 | 0.649 | 8.6e-72 | |
| TAIR|locus:2044289 | 456 | ACR5 "ACT domain repeat 5" [Ar | 0.270 | 0.175 | 0.296 | 5.8e-09 | |
| TAIR|locus:2033223 | 455 | ACR4 "ACT domain repeat 4" [Ar | 0.270 | 0.175 | 0.308 | 5.4e-08 | |
| TAIR|locus:2132609 | 449 | ACR7 "ACT domain repeat 7" [Ar | 0.273 | 0.180 | 0.268 | 2.3e-07 | |
| TAIR|locus:2078678 | 433 | ACR6 "ACT domain repeat 6" [Ar | 0.280 | 0.191 | 0.285 | 7.6e-07 | |
| TAIR|locus:2034630 | 441 | ACR8 "AT1G12420" [Arabidopsis | 0.270 | 0.181 | 0.333 | 2.1e-06 | |
| TAIR|locus:2152094 | 477 | ACR1 "ACT domain repeat 1" [Ar | 0.280 | 0.174 | 0.273 | 4.3e-06 | |
| TAIR|locus:2025317 | 453 | ACR3 "ACT domain repeat 3" [Ar | 0.375 | 0.245 | 0.243 | 1.2e-05 | |
| TIGR_CMR|SPO_0397 | 908 | SPO_0397 "protein-P-II uridyly | 0.554 | 0.180 | 0.285 | 0.00013 |
| TAIR|locus:2175458 ACR12 "ACT domain repeats 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 980 (350.0 bits), Expect = 1.0e-98, P = 1.0e-98
Identities = 194/254 (76%), Positives = 224/254 (88%)
Query: 46 RRFYEQGIC--LSRKNRNILFASVNGTN-AVSPTPLKSDQDADYIPMPHVLIDQDSNSDA 102
RR + G+ L++ +N ++AS+N + A +P+ KS+ D D +PMP V+IDQD++ +A
Sbjct: 48 RRKFVGGVMSLLTKSIKNRVYASINSIDSAATPSYPKSEDDDDVVPMPMVMIDQDADPEA 107
Query: 103 TIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDL 162
TIVQLSFG+RLGALIDTM ALKDLGLDV KGTV+TEGS+KQTKF IT+ DTGRKVEDPDL
Sbjct: 108 TIVQLSFGNRLGALIDTMRALKDLGLDVIKGTVSTEGSIKQTKFSITKRDTGRKVEDPDL 167
Query: 163 LERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYI 222
LE+IRLTIINNLLKYHPE SEQLAMGE FGIKAPEKK+DVDIATHIHVKEDGPKRSLL I
Sbjct: 168 LEQIRLTIINNLLKYHPECSEQLAMGETFGIKAPEKKIDVDIATHIHVKEDGPKRSLLVI 227
Query: 223 ETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCL 282
ETADRPGL+VE++K++ADVN+DVESAEIDTEGLVAKDKFHVSY G ALN SLSQVLVNCL
Sbjct: 228 ETADRPGLVVEMIKVMADVNIDVESAEIDTEGLVAKDKFHVSYQGQALNRSLSQVLVNCL 287
Query: 283 RYYLRRPETDIDSY 296
RY+LRRPETDIDSY
Sbjct: 288 RYFLRRPETDIDSY 301
|
|
| TAIR|locus:2015616 ACR11 "ACT domain repeats 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044289 ACR5 "ACT domain repeat 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132609 ACR7 "ACT domain repeat 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034630 ACR8 "AT1G12420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152094 ACR1 "ACT domain repeat 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025317 ACR3 "ACT domain repeat 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0397 SPO_0397 "protein-P-II uridylyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| TIGR01693 | 850 | TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans | 9e-08 | |
| cd04899 | 70 | cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain | 2e-07 | |
| cd04873 | 70 | cd04873, ACT_UUR-ACR-like, ACT domains of the bact | 9e-07 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 1e-06 | |
| COG2844 | 867 | COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran | 1e-05 | |
| PRK05092 | 931 | PRK05092, PRK05092, PII uridylyl-transferase; Prov | 2e-04 | |
| PRK03059 | 856 | PRK03059, PRK03059, PII uridylyl-transferase; Prov | 3e-04 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 3e-04 | |
| cd04926 | 72 | cd04926, ACT_ACR_4, C-terminal ACT domain, of a no | 3e-04 | |
| cd04876 | 71 | cd04876, ACT_RelA-SpoT, ACT domain found C-termina | 8e-04 | |
| PRK03381 | 774 | PRK03381, PRK03381, PII uridylyl-transferase; Prov | 0.002 | |
| pfam13291 | 77 | pfam13291, ACT_4, ACT domain | 0.002 | |
| PRK00275 | 895 | PRK00275, glnD, PII uridylyl-transferase; Provisio | 0.003 | |
| pfam01842 | 66 | pfam01842, ACT, ACT domain | 0.003 | |
| cd02116 | 60 | cd02116, ACT, ACT domains are commonly involved in | 0.004 |
| >gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
Score = 52.8 bits (127), Expect = 9e-08
Identities = 46/200 (23%), Positives = 74/200 (37%), Gaps = 11/200 (5%)
Query: 83 DADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNT-EGSV 141
A P LID S T V + D+ G AL L L V VNT + V
Sbjct: 649 RALSSGGPLALIDGTRPSGGTEVFIYAPDQPGLFAKVAGALAMLSLSVHDAQVNTTKDGV 708
Query: 142 KQTKFFITRLDTGRKVEDPDLLERIRLT--IINNLLKYHPESSEQLAMGEAFGIKAPEKK 199
F + L + E ++ ++ L K + ++
Sbjct: 709 ALDTFVVQDLFGSPPAAERVFQELLQGLVDVLAGLAKDPD--TISARRARRRRLQHFAVP 766
Query: 200 LDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKD 259
V I K +++ + DRPGLL + + + ++ + ++SA+I T G A+D
Sbjct: 767 PRVTILNTA-----SRKATIMEVRALDRPGLLARVGRTLEELGLSIQSAKITTFGEKAED 821
Query: 260 KFHVS-YGGAALNSSLSQVL 278
F+V+ G L Q L
Sbjct: 822 VFYVTDLFGLKLTDEEEQRL 841
|
This model describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for the nitrogen regulatory protein PII. Not all homologs of PII share the property of uridylyltransferase modification on the characteristic Tyr residue (see Prosite pattern PS00496 and document PDOC00439), but the modification site is preserved in the PII homolog of all species with a member of this family [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, Protein interactions]. Length = 850 |
| >gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235101 PRK03059, PRK03059, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >gnl|CDD|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222030 pfam13291, ACT_4, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|190133 pfam01842, ACT, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 100.0 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 100.0 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.97 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.97 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.96 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.96 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.96 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.96 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.95 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.87 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.84 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.83 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 99.69 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 99.68 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 99.67 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 99.65 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.63 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 99.62 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 99.62 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.61 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 99.61 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 99.6 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.59 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 99.58 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 99.57 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 99.55 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 99.54 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 99.54 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 99.5 | |
| COG2844 | 867 | GlnD UTP:GlnB (protein PII) uridylyltransferase [P | 99.48 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 99.45 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 99.44 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 99.4 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 99.36 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.33 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.32 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 99.29 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 99.26 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 99.05 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 98.98 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 98.97 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.73 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.63 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 98.52 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.5 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.5 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.43 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 98.4 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 98.19 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 98.17 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 98.15 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 98.08 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 98.08 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 98.04 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 98.04 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 98.03 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 97.99 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.99 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.97 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.96 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.71 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 97.65 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 97.59 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.56 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 97.52 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.5 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.49 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.48 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.47 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.44 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 97.44 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 97.43 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.36 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.35 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 97.33 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 97.32 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.29 | |
| cd04894 | 69 | ACT_ACR-like_1 ACT domain-containing protein which | 97.28 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 97.25 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 97.23 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 97.22 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 97.21 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 97.21 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 97.19 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.17 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 97.14 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 97.13 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 97.12 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 97.11 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 97.09 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 97.03 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 97.0 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 97.0 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 96.99 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.97 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 96.94 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 96.92 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 96.92 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.91 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 96.89 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 96.86 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 96.84 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 96.78 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 96.78 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 96.77 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 96.77 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.74 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 96.74 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 96.74 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.72 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 96.71 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 96.7 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 96.69 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.69 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 96.64 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 96.62 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 96.6 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 96.58 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 96.51 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 96.5 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 96.48 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 96.48 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 96.4 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 96.34 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 96.3 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 96.3 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 96.24 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 96.23 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 96.2 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 96.15 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 96.1 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 96.0 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 95.98 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 95.9 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 95.74 | |
| PRK00227 | 693 | glnD PII uridylyl-transferase; Provisional | 95.64 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 95.6 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 95.6 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 95.52 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.46 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 95.46 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 95.37 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 95.25 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 95.23 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 95.18 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 95.14 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 95.02 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 94.97 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 94.88 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 94.65 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 94.43 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 94.31 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 94.22 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 94.2 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 94.17 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 94.16 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 94.15 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 94.05 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 93.86 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 93.72 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 93.63 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 93.36 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 93.08 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 92.93 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 92.77 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 92.71 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 92.68 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 92.49 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 92.4 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 92.32 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 92.18 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 92.15 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 92.12 | |
| PLN02551 | 521 | aspartokinase | 92.05 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 92.01 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 91.96 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 91.84 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 91.69 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 91.47 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 91.32 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 91.28 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 91.17 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 91.16 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 90.68 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 90.58 | |
| PRK09181 | 475 | aspartate kinase; Validated | 90.55 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 90.49 | |
| cd04935 | 75 | ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK | 90.3 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 90.09 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 89.63 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 89.6 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 89.57 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 89.51 | |
| PRK11898 | 283 | prephenate dehydratase; Provisional | 89.22 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 89.1 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 88.95 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 88.67 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 88.62 | |
| PLN02317 | 382 | arogenate dehydratase | 88.51 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 88.46 | |
| cd04932 | 75 | ACT_AKiii-LysC-EC_1 ACT domains located C-terminal | 88.41 | |
| TIGR01270 | 464 | Trp_5_monoox tryptophan 5-monooxygenase, tetrameri | 88.09 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 87.93 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 87.76 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 87.75 | |
| TIGR01268 | 436 | Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra | 87.35 | |
| cd04898 | 77 | ACT_ACR-like_4 ACT domain-containing protein which | 86.6 | |
| COG2150 | 167 | Predicted regulator of amino acid metabolism, cont | 85.77 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 85.57 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 84.98 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 84.83 | |
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 84.78 | |
| cd04934 | 73 | ACT_AK-Hom3_1 CT domains located C-terminal to the | 84.24 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 83.96 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 83.76 | |
| cd04919 | 66 | ACT_AK-Hom3_2 ACT domains located C-terminal to th | 83.43 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 83.37 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 82.85 | |
| cd04937 | 64 | ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela | 82.43 | |
| cd04868 | 60 | ACT_AK-like ACT domains C-terminal to the catalyti | 82.4 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 82.38 | |
| COG3978 | 86 | Acetolactate synthase (isozyme II), small (regulat | 81.75 | |
| cd04890 | 62 | ACT_AK-like_1 ACT domains found C-terminal to the | 81.51 | |
| PRK09224 | 504 | threonine dehydratase; Reviewed | 81.49 | |
| cd04933 | 78 | ACT_AK1-AT_1 ACT domains located C-terminal to the | 80.64 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 80.54 | |
| cd04924 | 66 | ACT_AK-Arch_2 ACT domains of a monofunctional aspa | 80.31 |
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-32 Score=288.46 Aligned_cols=191 Identities=24% Similarity=0.290 Sum_probs=167.4
Q ss_pred CCcEEEEeecCCCCeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEeCCeE-EEEEEEeecCCCCCCCChHHHHHH
Q 022480 88 PMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVK-QTKFFITRLDTGRKVEDPDLLERI 166 (296)
Q Consensus 88 ~~p~V~i~~~~~~~~t~V~V~~~DrpGLLa~i~~vL~~~glnI~~A~I~T~~~~~-~d~F~V~~~~~g~~l~~~~~l~~L 166 (296)
++|.|.++++.+.++++|+|+++||||||++||++|+.+|+||++|+|+|++++. +|+|+|++. +|.++. ++++++|
T Consensus 687 ~~p~V~i~~~~~~~~t~V~V~a~DrpGLfa~Ia~~La~~~L~I~~A~I~T~~dg~alD~F~V~d~-~g~~~~-~~~~~~I 764 (884)
T PRK05007 687 DKPLVLLSKQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTSRDGMAMDTFIVLEP-DGSPLS-QDRHQVI 764 (884)
T ss_pred CCCeEEEEecCCCCeEEEEEEecCCcCHHHHHHHHHHHCCCEEEEEEEEEcCCCeEEEEEEEECC-CCCCCC-HHHHHHH
Confidence 5789999999999999999999999999999999999999999999999999865 699999996 888874 5799999
Q ss_pred HHHHHHhhcccCCCchhHhhhccccCccCCCccccccccceeeeccCCC-CcEEEEEEeCCCcchHHHHHHHHHhCCceE
Q 022480 167 RLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGP-KRSLLYIETADRPGLLVEIMKIIADVNVDV 245 (296)
Q Consensus 167 ~~~L~~~L~~~~~~~~~~La~~~~~~~~~~~r~~~~~~~~~V~v~~~~~-~~TvleV~t~DRPGLL~dIt~~La~~gv~I 245 (296)
++.|.++|.+.... .. . .+ +.+++...+.++++|.++|+.+ .+|+|+|.|.|||||||+|+++|.++|++|
T Consensus 765 ~~~L~~aL~~~~~~-~~-~----~~--~~~~~~~~~~~~~~V~~d~~~s~~~TvlEV~a~DRpGLL~~I~~~l~~~~l~I 836 (884)
T PRK05007 765 RKALEQALTQSSPQ-PP-K----PR--RLPAKLRHFNVPTEVSFLPTHTDRRSYMELIALDQPGLLARVGKIFADLGISL 836 (884)
T ss_pred HHHHHHHHcCCCCC-cc-c----cc--ccccccCCCCCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHHHCCcEE
Confidence 99999999763211 11 1 11 1234556678899999999875 499999999999999999999999999999
Q ss_pred EEEEEEecCCeeeeEEEEEe-CCCCCChHHHHHHHHHHHHHcCC
Q 022480 246 ESAEIDTEGLVAKDKFHVSY-GGAALNSSLSQVLVNCLRYYLRR 288 (296)
Q Consensus 246 ~~AkI~T~G~ra~D~F~V~~-~g~~L~~~~~~~L~~~L~~~l~~ 288 (296)
++|||+|.|++|+|+|||++ +|+||+++.+++|+++|+++|..
T Consensus 837 ~~AkI~T~gera~DvFyV~~~~g~~l~~~~~~~l~~~L~~~l~~ 880 (884)
T PRK05007 837 HGARITTIGERVEDLFILATADRRALNEELQQELRQRLTEALNP 880 (884)
T ss_pred EEEEEeccCceEEEEEEEEcCCCCcCCHHHHHHHHHHHHHHHhh
Confidence 99999999999999999998 89999977889999999999865
|
|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00227 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09181 aspartate kinase; Validated | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >PRK11898 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02317 arogenate dehydratase | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form | Back alignment and domain information |
|---|
| >cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI | Back alignment and domain information |
|---|
| >cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown] | Back alignment and domain information |
|---|
| >cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PRK09224 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd04933 ACT_AK1-AT_1 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 1e-05 |
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 | Back alignment and structure |
|---|
Score = 41.9 bits (99), Expect = 1e-05
Identities = 5/45 (11%), Positives = 20/45 (44%)
Query: 220 LYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVS 264
+ I D+ G+ +I +I+ + ++ + ++ + + +
Sbjct: 8 IRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIF 52
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 99.8 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 99.76 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.97 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.54 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.26 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 98.19 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.18 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 98.09 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 98.03 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 97.76 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 97.72 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.45 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 97.38 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.31 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.3 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 97.28 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.27 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 97.26 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.18 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 97.17 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 97.15 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 97.12 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 97.11 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 97.1 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 97.06 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 97.04 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 96.93 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 96.79 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 96.6 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 96.48 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 96.47 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 96.23 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 96.06 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 96.0 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 95.88 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 95.69 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 94.83 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 94.71 | |
| 3c1m_A | 473 | Probable aspartokinase; allosteric inhibition, thr | 94.21 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 93.84 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 93.53 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 93.17 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 93.09 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 93.01 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 92.93 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 92.92 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 92.31 | |
| 3tvi_A | 446 | Aspartokinase; structural genomics, ACT domains, r | 91.36 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 89.21 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 88.94 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 87.4 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 87.2 | |
| 2cdq_A | 510 | Aspartokinase; aspartate kinase, amino acid metabo | 86.81 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 84.23 | |
| 1phz_A | 429 | Protein (phenylalanine hydroxylase); aromatic amin | 83.63 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 81.23 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 81.14 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 80.35 |
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
Probab=99.80 E-value=9.6e-19 Score=153.32 Aligned_cols=156 Identities=15% Similarity=0.181 Sum_probs=113.5
Q ss_pred CeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEeCCeEEEEEEEeecCCCCCCCChHHHHHHHHHHHHhhcccCCC
Q 022480 101 DATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPE 180 (296)
Q Consensus 101 ~~t~V~V~~~DrpGLLa~i~~vL~~~glnI~~A~I~T~~~~~~d~F~V~~~~~g~~l~~~~~l~~L~~~L~~~L~~~~~~ 180 (296)
..++|+|+|+|||||++.|+++|+++|+||++|++++..+++.-.|.+... +. ..+.+++.|++.|..++.+. +
T Consensus 4 ~~~~ltv~~~DrpGiva~vs~~La~~g~NI~da~q~~~~~~f~m~~~v~~~--~~--~~~~~~~~l~~~L~~~~~~~--~ 77 (195)
T 2nyi_A 4 QSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAMIVLVSLN--AK--DGKLIQSALESALPGFQIST--R 77 (195)
T ss_dssp EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEES--SS--SSHHHHHHHHHHSTTCEEEE--E
T ss_pred eEEEEEEEeCCCCcHHHHHHHHHHHCCCCEEEEEeEEECCeEEEEEEEEec--Cc--cchhHHHHHHHHHHHHHHhc--C
Confidence 457999999999999999999999999999999999999988657777653 21 22346677777766533221 0
Q ss_pred chhHhhhccccCccCCCccccccccceeeeccCCCCcEEEEEEeCCCcchHHHHHHHHHhCCceEEEEEEEecC--Ceee
Q 022480 181 SSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEG--LVAK 258 (296)
Q Consensus 181 ~~~~La~~~~~~~~~~~r~~~~~~~~~V~v~~~~~~~TvleV~t~DRPGLL~dIt~~La~~gv~I~~AkI~T~G--~ra~ 258 (296)
+ ....+ . .+ . ......++|+|.|+|||||+++|+++|+++|+||..++..|.+ +++.
T Consensus 78 ----~----~~~~~---~------~~--~--~~~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~ 136 (195)
T 2nyi_A 78 ----R----ASSVA---E------RH--V--SPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGF 136 (195)
T ss_dssp ----E----CCCC---------------C--CTTEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTC
T ss_pred ----C----eEEEE---e------CC--c--CCCCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCC
Confidence 0 00001 0 01 1 2223479999999999999999999999999999999999998 7889
Q ss_pred eEEEEEe-CCCCCChHHHHHHHHHHHHH
Q 022480 259 DKFHVSY-GGAALNSSLSQVLVNCLRYY 285 (296)
Q Consensus 259 D~F~V~~-~g~~L~~~~~~~L~~~L~~~ 285 (296)
+.|+++- -+.+ .... ++|+++|...
T Consensus 137 ~~F~m~~~~~~~-~~~~-~~l~~~l~~~ 162 (195)
T 2nyi_A 137 TLFRMGSRVAFP-FPLY-QEVVTALSRV 162 (195)
T ss_dssp EEEEEEEEEEEE-GGGH-HHHHHHHHHH
T ss_pred CeEEEEEEEEcC-CCcc-HHHHHHHHHH
Confidence 9999985 2222 1124 5666666543
|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 296 | ||||
| d1y7pa2 | 77 | d.58.18.12 (A:2-78) Hypothetical protein AF1403, N | 0.002 |
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: AF1403 N-terminal domain-like domain: Hypothetical protein AF1403, N-terminal domain species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Score = 34.3 bits (79), Expect = 0.002
Identities = 8/33 (24%), Positives = 17/33 (51%)
Query: 220 LYIETADRPGLLVEIMKIIADVNVDVESAEIDT 252
L I ++ G+L ++ IIA+ ++ A+
Sbjct: 4 LRIIAENKIGVLRDLTTIIAEEGGNITFAQTFL 36
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.8 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.57 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.49 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.44 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 98.23 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 97.98 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.86 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.8 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.7 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.67 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.57 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.42 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.35 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.26 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 97.25 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 97.25 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 97.24 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 97.24 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 97.15 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 97.12 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 97.08 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 96.93 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 96.74 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 96.6 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 91.62 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 91.4 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 89.2 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 86.56 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 85.31 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 84.45 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 83.58 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 82.64 |
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: Glycine cleavage system transcriptional repressor domain: putative transcriptional repressor VC2159 species: Vibrio cholerae [TaxId: 666]
Probab=98.80 E-value=2.3e-08 Score=74.35 Aligned_cols=65 Identities=14% Similarity=0.200 Sum_probs=55.0
Q ss_pred CCeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEeCCeEEEEEEEeecCCCCCCCChHHHHHHHHHHHH
Q 022480 100 SDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIIN 172 (296)
Q Consensus 100 ~~~t~V~V~~~DrpGLLa~i~~vL~~~glnI~~A~I~T~~~~~~d~F~V~~~~~g~~l~~~~~l~~L~~~L~~ 172 (296)
..+++|++.|+||||++++++++|+++||||.+++..+.++.+.-.+.|.-+ ++.+++|+..|..
T Consensus 3 ~~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~~~--------~~~~~~l~~~L~~ 67 (86)
T d1u8sa1 3 TQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGS--------PSNITRVETTLPL 67 (86)
T ss_dssp CEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEEC--------HHHHHHHHHHHHH
T ss_pred ccEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEEcC--------cccHHHHHHHHHH
Confidence 3578999999999999999999999999999999999999988765666531 3567788888776
|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|