Citrus Sinensis ID: 022777

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--

MAAAAAPDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA

ccccccccHHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHc

ccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc

maaaaapdhlfnlrNNFYLGAYQAainnsdltnlppddaverdcLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYlsspdnkesTISSLKEwlsdpaigsnaTLRLIAGIIFMHEEDYNEALkhtnaggtmELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDfsekypmtglilnGKAVCCMHMGNFDEAEGLLLDAlnkdakdpetLANLVVCSLHQGKSTSRYLNQLklthpdhmlvkrassgdESFERALQSVA

maaaaapdhlFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKrassgdesFERALQSVA

MAAAAAPDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGllldalnkdakdPETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA

********HLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLS***********LKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANLVVCSLHQGKSTSRYLNQLKL**************************

*****AP**LFNLRNNFYLGAYQAAINN***********VERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA

MAAAAAPDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSS*********SLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRA***************

******PDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		292	2.2.26 [Sep-21-2011]
Q9SA78		292	Coatomer subunit epsilon-	yes	no	1.0	1.0	0.839	1e-149
O64748		293	Coatomer subunit epsilon-	no	no	0.996	0.993	0.835	1e-146
Q9MAX6		287	Coatomer subunit epsilon-	yes	no	0.979	0.996	0.795	1e-131
P0C541		297	Coatomer subunit epsilon-	no	no	1.0	0.983	0.693	1e-117
A2XY73		297	Coatomer subunit epsilon-	N/A	no	1.0	0.983	0.693	1e-116
Q5ZIK9		308	Coatomer subunit epsilon	yes	no	0.955	0.905	0.434	8e-64
Q60445		308	Coatomer subunit epsilon	yes	no	0.965	0.915	0.439	1e-62
O89079		308	Coatomer subunit epsilon	yes	no	0.955	0.905	0.438	5e-62
Q5RFR8		308	Coatomer subunit epsilon	yes	no	0.955	0.905	0.431	6e-62
O14579		308	Coatomer subunit epsilon	yes	no	0.955	0.905	0.431	7e-62

>sp\|Q9SA78\|COPE1_ARATH Coatomer subunit epsilon-1 OS=Arabidopsis thaliana GN=At1g30630 PE=2 SV=1	Back alignment and function desciption

 Score =  526 bits (1355), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 245/292 (83%), Positives = 277/292 (94%)

Query: 1   MAAAAAPDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVI 60
           MA+ A PDHLFNLRN+FYLGAYQAAINNS++ NL  +D VERDCLV+R+YIALGSYQLVI
Sbjct: 1   MASMAGPDHLFNLRNHFYLGAYQAAINNSEIPNLSQEDIVERDCLVHRAYIALGSYQLVI 60

Query: 61  SEIDESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHE 120
           SEIDE+AATPLQAVKLLA+YLSSP+NKESTISSL+EWL+DP +G+NA +RLIAG IFMHE
Sbjct: 61  SEIDEAAATPLQAVKLLAMYLSSPENKESTISSLREWLADPTVGNNAIIRLIAGTIFMHE 120

Query: 121 EDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLN 180
           EDYNEALKHT++GGTM+LHALNVQIF+KMHRSD+AE+QLR MQQIDEDHTLTQLA+AWLN
Sbjct: 121 EDYNEALKHTHSGGTMDLHALNVQIFIKMHRSDFAEKQLRVMQQIDEDHTLTQLASAWLN 180

Query: 181 LAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDP 240
           LAVGGSKIQEAYLIFQDFSEKYPMT LILNGKAVCCMHMGNF+EAE LLL+ALNKDAKDP
Sbjct: 181 LAVGGSKIQEAYLIFQDFSEKYPMTSLILNGKAVCCMHMGNFEEAETLLLEALNKDAKDP 240

Query: 241 ETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA 292
           ETLANLVVCSLH GKS+SRYLNQLKL+HP+H+LVKRA+S +++FERALQS A
Sbjct: 241 ETLANLVVCSLHVGKSSSRYLNQLKLSHPEHVLVKRAASAEDNFERALQSFA 292

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.
Arabidopsis thaliana (taxid: 3702)

>sp\|O64748\|COPE2_ARATH Coatomer subunit epsilon-2 OS=Arabidopsis thaliana GN=At2g34840 PE=2 SV=1	Back alignment and function description

>sp\|Q9MAX6\|COPE1_ORYSJ Coatomer subunit epsilon-1 OS=Oryza sativa subsp. japonica GN=COPE1 PE=2 SV=1	Back alignment and function description

>sp\|P0C541\|COPE2_ORYSJ Coatomer subunit epsilon-2 OS=Oryza sativa subsp. japonica GN=Os04g0644700 PE=3 SV=1	Back alignment and function description

>sp\|A2XY73\|COPE2_ORYSI Coatomer subunit epsilon-2 OS=Oryza sativa subsp. indica GN=H0413E07.10 PE=3 SV=2	Back alignment and function description

>sp\|Q5ZIK9\|COPE_CHICK Coatomer subunit epsilon OS=Gallus gallus GN=COPE PE=2 SV=1	Back alignment and function description

>sp\|Q60445\|COPE_CRIGR Coatomer subunit epsilon OS=Cricetulus griseus GN=COPE PE=2 SV=2	Back alignment and function description

>sp\|O89079\|COPE_MOUSE Coatomer subunit epsilon OS=Mus musculus GN=Cope PE=2 SV=3	Back alignment and function description

>sp\|Q5RFR8\|COPE_PONAB Coatomer subunit epsilon OS=Pongo abelii GN=COPE PE=2 SV=1	Back alignment and function description

>sp\|O14579\|COPE_HUMAN Coatomer subunit epsilon OS=Homo sapiens GN=COPE PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		292
224115588		290	predicted protein [Populus trichocarpa]	0.989	0.996	0.896	1e-151
449433523		289	PREDICTED: coatomer subunit epsilon-1-li	0.986	0.996	0.875	1e-149
15221463		292	coatomer subunit epsilon-1 [Arabidopsis	1.0	1.0	0.839	1e-147
297851514		292	coatomer protein epsilon subunit family	1.0	1.0	0.835	1e-146
21593069		289	coatomer-like protein, epsilon subunit [	0.986	0.996	0.843	1e-146
15226840		293	coatomer subunit epsilon-2 [Arabidopsis	0.996	0.993	0.835	1e-144
225444159		289	PREDICTED: coatomer subunit epsilon-1 is	0.986	0.996	0.840	1e-143
255578057		289	coatomer epsilon subunit, putative [Rici	0.986	0.996	0.843	1e-142
56311392		289	coatomer epsilon subunit [Medicago trunc	0.986	0.996	0.777	1e-134
351727735		290	epsilon1-COP [Glycine max] gi\|7670062\|db	0.986	0.993	0.781	1e-134

>gi\|224115588\|ref\|XP_002317073.1\| predicted protein [Populus trichocarpa] gi\|222860138\|gb\|EEE97685.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 259/289 (89%), Positives = 274/289 (94%)

Query: 4   AAAPDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEI 63
           A APDHLFNLRNNFYLGAYQAAIN SDL NL PDDAVERD LVYRSYIAL SYQLVI EI
Sbjct: 2   AGAPDHLFNLRNNFYLGAYQAAINTSDLPNLSPDDAVERDSLVYRSYIALASYQLVIHEI 61

Query: 64  DESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDY 123
           D++AATPLQAVKLLALYLSSP+NKESTISSLKEWL+D AI +NA LRLIAGIIFMHEEDY
Sbjct: 62  DDAAATPLQAVKLLALYLSSPENKESTISSLKEWLADSAIANNAILRLIAGIIFMHEEDY 121

Query: 124 NEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAV 183
           NEALKHTNAGGTMELHALNVQIFLKMHRSDYAE+QLR MQQIDEDHTLTQLA AWLNLAV
Sbjct: 122 NEALKHTNAGGTMELHALNVQIFLKMHRSDYAEKQLRIMQQIDEDHTLTQLATAWLNLAV 181

Query: 184 GGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETL 243
           GGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAE LLL+ALNKDAKDPETL
Sbjct: 182 GGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAETLLLEALNKDAKDPETL 241

Query: 244 ANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA 292
           ANLVVCSLH GKS+SRYL+QLKL+HPDH+LVKRASS +++FERA+QSVA
Sbjct: 242 ANLVVCSLHIGKSSSRYLSQLKLSHPDHVLVKRASSAEDNFERAVQSVA 290

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449433523\|ref\|XP_004134547.1\| PREDICTED: coatomer subunit epsilon-1-like [Cucumis sativus] gi\|449490635\|ref\|XP_004158662.1\| PREDICTED: coatomer subunit epsilon-1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|15221463|ref|NP_174351.1| coatomer subunit epsilon-1 [Arabidopsis thaliana] gi|75336896|sp|Q9SA78.1|COPE1_ARATH RecName: Full=Coatomer subunit epsilon-1; AltName: Full=Epsilon-coat protein 1; Short=Epsilon-COP 1 gi|4587519|gb|AAD25750.1|AC007060_8 Strong similarity to F19I3.7 gi|3033380 putative coatomer epsilon subunit from Arabidopsis thaliana BAC gb|AC004238. ESTs gb|Z17908, gb|AA728673, gb|N96555, gb|H76335, gb|AA712463, gb|W43247, gb|T45611, gb|T21160, gb|T14119 and AI100483 come from this gene [Arabidopsis thaliana] gi|13194794|gb|AAK15559.1|AF348588_1 putative coatomer protein, epsilon subunit [Arabidopsis thaliana] gi|13878125|gb|AAK44140.1|AF370325_1 putative coatomer protein, epsilon subunit [Arabidopsis thaliana] gi|17104797|gb|AAL34287.1| putative coatomer protein, epsilon subunit [Arabidopsis thaliana] gi|332193133|gb|AEE31254.1| coatomer subunit epsilon-1 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297851514\|ref\|XP_002893638.1\| coatomer protein epsilon subunit family protein [Arabidopsis lyrata subsp. lyrata] gi\|297339480\|gb\|EFH69897.1\| coatomer protein epsilon subunit family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|21593069\|gb\|AAM65018.1\| coatomer-like protein, epsilon subunit [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|15226840|ref|NP_181030.1| coatomer subunit epsilon-2 [Arabidopsis thaliana] gi|6647445|sp|O64748.1|COPE2_ARATH RecName: Full=Coatomer subunit epsilon-2; AltName: Full=Epsilon-coat protein 2; Short=Epsilon-COP 2 gi|3033380|gb|AAC12824.1| putative coatomer epsilon subunit [Arabidopsis thaliana] gi|19715634|gb|AAL91638.1| At2g34840/F19I3.7 [Arabidopsis thaliana] gi|22655446|gb|AAM98315.1| At2g34840/F19I3.7 [Arabidopsis thaliana] gi|330253934|gb|AEC09028.1| coatomer subunit epsilon-2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|225444159\|ref\|XP_002270662.1\| PREDICTED: coatomer subunit epsilon-1 isoform 1 [Vitis vinifera] gi\|297740898\|emb\|CBI31080.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255578057\|ref\|XP_002529899.1\| coatomer epsilon subunit, putative [Ricinus communis] gi\|223530626\|gb\|EEF32502.1\| coatomer epsilon subunit, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|56311392\|emb\|CAI29264.1\| coatomer epsilon subunit [Medicago truncatula]	Back alignment and taxonomy information

>gi\|351727735\|ref\|NP_001236915.1\| epsilon1-COP [Glycine max] gi\|7670062\|dbj\|BAA94964.1\| epsilon1-COP [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		292
TAIR\|locus:2204644		292	AT1G30630 [Arabidopsis thalian	1.0	1.0	0.801	9.9e-126
TAIR\|locus:2044792		293	AT2G34840 [Arabidopsis thalian	0.996	0.993	0.797	5.7e-123
UNIPROTKB\|Q5ZIK9		308	COPE "Coatomer subunit epsilon	0.965	0.915	0.418	2e-56
UNIPROTKB\|G3V8Q1		308	Cope "Coatomer protein complex	0.965	0.915	0.421	4.8e-55
MGI\|MGI:1891702		308	Cope "coatomer protein complex	0.965	0.915	0.421	7.8e-55
UNIPROTKB\|E2RAT6		308	COPE "Uncharacterized protein"	0.976	0.925	0.411	1.3e-54
UNIPROTKB\|O14579		308	COPE "Coatomer subunit epsilon	0.976	0.925	0.404	1.3e-54
UNIPROTKB\|F1S7E0		308	LOC100525632 "Uncharacterized	0.976	0.925	0.404	2.6e-54
UNIPROTKB\|Q28104		308	COPE "Coatomer subunit epsilon	0.976	0.925	0.404	3e-53
ZFIN\|ZDB-GENE-041114-59		300	cope "coatomer protein complex	0.976	0.95	0.401	8e-53

TAIR\|locus:2204644 AT1G30630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1235 (439.8 bits), Expect = 9.9e-126, P = 9.9e-126
 Identities = 234/292 (80%), Positives = 265/292 (90%)

Query:     1 MAAAAAPDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVI 60
             MA+ A PDHLFNLRN+FYLGAYQAAINNS++ NL  +D VERDCLV+R+YIALGSYQLVI
Sbjct:     1 MASMAGPDHLFNLRNHFYLGAYQAAINNSEIPNLSQEDIVERDCLVHRAYIALGSYQLVI 60

Query:    61 SEIDESAATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHE 120
             SEIDE+AATPLQAVKLLA+YLSSP+NKESTISSL+EWL+DP +G+NA +RLIAG IFMHE
Sbjct:    61 SEIDEAAATPLQAVKLLAMYLSSPENKESTISSLREWLADPTVGNNAIIRLIAGTIFMHE 120

Query:   121 EDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLN 180
             EDYNEALKHT++GGTM+LHALNVQIF+KMHRSD+AE+QLR MQQIDEDHTLTQLA+AWLN
Sbjct:   121 EDYNEALKHTHSGGTMDLHALNVQIFIKMHRSDFAEKQLRVMQQIDEDHTLTQLASAWLN 180

Query:   181 LAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGXXXXXXXXXXXXP 240
             LAVGGSKIQEAYLIFQDFSEKYPMT LILNGKAVCCMHMGNF+EAE             P
Sbjct:   181 LAVGGSKIQEAYLIFQDFSEKYPMTSLILNGKAVCCMHMGNFEEAETLLLEALNKDAKDP 240

Query:   241 ETLANLVVCSLHQGKSTSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA 292
             ETLANLVVCSLH GKS+SRYLNQLKL+HP+H+LVKRA+S +++FERALQS A
Sbjct:   241 ETLANLVVCSLHVGKSSSRYLNQLKLSHPEHVLVKRAASAEDNFERALQSFA 292

GO:0005198 "structural molecule activity" evidence=IEA

GO:0006890 "retrograde vesicle-mediated transport, Golgi to ER" evidence=IEA;ISS

GO:0008565 "protein transporter activity" evidence=ISS

GO:0030126 "COPI vesicle coat" evidence=IEA

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

TAIR\|locus:2044792 AT2G34840 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZIK9 COPE "Coatomer subunit epsilon" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V8Q1 Cope "Coatomer protein complex, subunit epsilon (Predicted), isoform CRA_c" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1891702 Cope "coatomer protein complex, subunit epsilon" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RAT6 COPE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|O14579 COPE "Coatomer subunit epsilon" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S7E0 LOC100525632 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q28104 COPE "Coatomer subunit epsilon" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041114-59 cope "coatomer protein complex, subunit epsilon" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9MAX6	COPE1_ORYSJ	No assigned EC number	0.7951	0.9794	0.9965	yes	no
Q28104	COPE_BOVIN	No assigned EC number	0.4275	0.9554	0.9058	yes	no
O14579	COPE_HUMAN	No assigned EC number	0.4310	0.9554	0.9058	yes	no
A2XY73	COPE2_ORYSI	No assigned EC number	0.6936	1.0	0.9831	N/A	no
O64748	COPE2_ARATH	No assigned EC number	0.8350	0.9965	0.9931	no	no
O89079	COPE_MOUSE	No assigned EC number	0.4381	0.9554	0.9058	yes	no
Q55FU2	COPE_DICDI	No assigned EC number	0.3620	0.9520	0.9266	yes	no
Q9SA78	COPE1_ARATH	No assigned EC number	0.8390	1.0	1.0	yes	no
Q5RFR8	COPE_PONAB	No assigned EC number	0.4310	0.9554	0.9058	yes	no
Q5ZIK9	COPE_CHICK	No assigned EC number	0.4346	0.9554	0.9058	yes	no
Q60445	COPE_CRIGR	No assigned EC number	0.4390	0.9657	0.9155	yes	no
O62246	COPE_CAEEL	No assigned EC number	0.3205	0.9417	0.9417	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_XI1337	SubName- Full=Putative uncharacterized protein; (290 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.I.9637.1	hypothetical protein (907 aa)	•	•	•	•	0.569
	eugene3.00150490	hypothetical protein (1219 aa)		•	•	•	0.560
	eugene3.00120688	hypothetical protein (1221 aa)		•	•	•	0.558

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		292
pfam04733		288	pfam04733, Coatomer_E, Coatomer epsilon subunit	1e-156
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	2e-04

>gnl\|CDD\|218234 pfam04733, Coatomer_E, Coatomer epsilon subunit	Back alignment and domain information

 Score =  436 bits (1122), Expect = e-156
 Identities = 188/288 (65%), Positives = 230/288 (79%), Gaps = 3/288 (1%)

Query: 8   DHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESA 67
           D LFN+RN FYLG YQ AIN SD+T+L  +  VERD  +YRSY+ALGSYQ+VISEI ESA
Sbjct: 1   DELFNVRNYFYLGNYQKAINESDVTSLSEEALVERDVYMYRSYLALGSYQIVISEIKESA 60

Query: 68  ATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEAL 127
           ATPLQAV+LLA YL+SP  KES ++SLKEW++D  IGSN+TLRL+A IIF+HE D+++AL
Sbjct: 61  ATPLQAVRLLAEYLNSPSRKESILASLKEWVADSHIGSNSTLRLLAAIIFIHEGDFDDAL 120

Query: 128 KHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSK 187
           KH + G  +E  ALNVQI LKMHR D AE+QL+ MQQIDED TLTQLANAW+ LAVGG K
Sbjct: 121 KHLHKGENLEAMALNVQILLKMHRIDLAEQQLKKMQQIDEDATLTQLANAWVKLAVGGEK 180

Query: 188 IQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANLV 247
           IQ+AY IFQ+FSEKY  T L+LNG+AVCCM +G ++EAE LL +AL+KDAKDPETL NLV
Sbjct: 181 IQDAYYIFQEFSEKYDSTPLLLNGQAVCCMCLGRYEEAESLLKEALDKDAKDPETLINLV 240

Query: 248 VCSLHQGK---STSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA 292
           VC+LH GK    ++R L+QLKL+HP H LVK  +  +  F+RA+Q  A
Sbjct: 241 VCALHLGKPAEVSNRNLSQLKLSHPTHPLVKDLNEKEAEFDRAVQQFA 288

This family represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex. Length = 288

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here

Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		292
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	100.0
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	100.0
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	99.96
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	99.95
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.95
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.95
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.95
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.94
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.94
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.93
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.93
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.93
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.92
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.91
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.9
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.9
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.89
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.89
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.88
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.87
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.87
KOG0547		606	consensus Translocase of outer mitochondrial membr	99.85
PRK12370		553	invasion protein regulator; Provisional	99.84
KOG1126		638	consensus DNA-binding cell division cycle control	99.84
KOG1126		638	consensus DNA-binding cell division cycle control	99.84
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.84
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.83
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	99.82
PRK11189		296	lipoprotein NlpI; Provisional	99.82
PRK12370		553	invasion protein regulator; Provisional	99.81
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	99.81
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.81
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	99.81
KOG0547		606	consensus Translocase of outer mitochondrial membr	99.8
PRK11189		296	lipoprotein NlpI; Provisional	99.8
KOG1129		478	consensus TPR repeat-containing protein [General f	99.78
KOG1129		478	consensus TPR repeat-containing protein [General f	99.76
KOG1125		579	consensus TPR repeat-containing protein [General f	99.75
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.75
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.75
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.75
PRK14574		822	hmsH outer membrane protein; Provisional	99.74
PRK14574		822	hmsH outer membrane protein; Provisional	99.74
KOG2076		895	consensus RNA polymerase III transcription factor	99.74
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.72
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	99.71
KOG2003		840	consensus TPR repeat-containing protein [General f	99.71
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	99.7
KOG0495		913	consensus HAT repeat protein [RNA processing and m	99.7
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	99.7
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.69
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	99.69
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	99.68
PLN02789		320	farnesyltranstransferase	99.68
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	99.68
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.68
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.68
KOG1125		579	consensus TPR repeat-containing protein [General f	99.67
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.67
KOG4162		799	consensus Predicted calmodulin-binding protein [Si	99.65
PLN03218		1060	maturation of RBCL 1; Provisional	99.65
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	99.65
KOG2003		840	consensus TPR repeat-containing protein [General f	99.64
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.64
PRK15359		144	type III secretion system chaperone protein SscB;	99.63
PLN03218		1060	maturation of RBCL 1; Provisional	99.63
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	99.63
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	99.62
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.61
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	99.6
KOG4162		799	consensus Predicted calmodulin-binding protein [Si	99.59
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.59
PLN03077		857	Protein ECB2; Provisional	99.59
KOG2076		895	consensus RNA polymerase III transcription factor	99.58
PLN02789		320	farnesyltranstransferase	99.58
PLN03077		857	Protein ECB2; Provisional	99.57
PRK15359		144	type III secretion system chaperone protein SscB;	99.57
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	99.56
TIGR02552		135	LcrH_SycD type III secretion low calcium response	99.56
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.56
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	99.55
PRK10370		198	formate-dependent nitrite reductase complex subuni	99.55
KOG0495		913	consensus HAT repeat protein [RNA processing and m	99.55
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	99.55
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	99.54
PRK10370		198	formate-dependent nitrite reductase complex subuni	99.52
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	99.5
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	99.49
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	99.46
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	99.45
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	99.44
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	99.44
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	99.43
PRK14720		906	transcript cleavage factor/unknown domain fusion p	99.43
KOG3060		289	consensus Uncharacterized conserved protein [Funct	99.39
TIGR02552		135	LcrH_SycD type III secretion low calcium response	99.36
KOG3060		289	consensus Uncharacterized conserved protein [Funct	99.34
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	99.33
KOG0553		304	consensus TPR repeat-containing protein [General f	99.33
KOG1128		777	consensus Uncharacterized conserved protein, conta	99.32
KOG3785		557	consensus Uncharacterized conserved protein [Funct	99.31
PRK14720		906	transcript cleavage factor/unknown domain fusion p	99.3
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	99.28
KOG2376		652	consensus Signal recognition particle, subunit Srp	99.26
COG4783		484	Putative Zn-dependent protease, contains TPR repea	99.26
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	99.25
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	99.21
KOG3785		557	consensus Uncharacterized conserved protein [Funct	99.21
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	99.21
KOG2376		652	consensus Signal recognition particle, subunit Srp	99.2
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	99.2
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	99.19
KOG0553		304	consensus TPR repeat-containing protein [General f	99.19
COG4783		484	Putative Zn-dependent protease, contains TPR repea	99.18
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	99.18
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	99.17
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	99.17
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	99.17
KOG1127		1238	consensus TPR repeat-containing protein [RNA proce	99.11
PRK04841		903	transcriptional regulator MalT; Provisional	99.11
KOG1127		1238	consensus TPR repeat-containing protein [RNA proce	99.1
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	99.09
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	99.08
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	99.08
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	99.07
KOG1128		777	consensus Uncharacterized conserved protein, conta	99.06
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	99.05
COG4105		254	ComL DNA uptake lipoprotein [General function pred	99.04
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	99.04
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	99.03
PRK10803		263	tol-pal system protein YbgF; Provisional	99.02
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	98.99
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.99
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	98.98
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	98.98
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.98
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.97
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	98.95
PRK15331		165	chaperone protein SicA; Provisional	98.95
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.94
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.94
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.9
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.9
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.89
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.89
KOG1915		677	consensus Cell cycle control protein (crooked neck	98.87
KOG4340		459	consensus Uncharacterized conserved protein [Funct	98.87
KOG4340		459	consensus Uncharacterized conserved protein [Funct	98.86
PRK11906		458	transcriptional regulator; Provisional	98.85
PRK10803		263	tol-pal system protein YbgF; Provisional	98.85
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	98.85
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	98.84
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	98.83
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	98.82
PF13371		73	TPR_9: Tetratricopeptide repeat	98.81
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	98.8
COG0457		291	NrfG FOG: TPR repeat [General function prediction	98.76
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.76
KOG2053		932	consensus Mitochondrial inheritance and actin cyto	98.75
PRK15331		165	chaperone protein SicA; Provisional	98.75
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	98.74
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	98.7
PF13371		73	TPR_9: Tetratricopeptide repeat	98.68
KOG2796		366	consensus Uncharacterized conserved protein [Funct	98.67
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.66
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	98.65
COG3898		531	Uncharacterized membrane-bound protein [Function u	98.65
PF12688		120	TPR_5: Tetratrico peptide repeat	98.63
PF13512		142	TPR_18: Tetratricopeptide repeat	98.62
PRK04841		903	transcriptional regulator MalT; Provisional	98.6
PRK11906		458	transcriptional regulator; Provisional	98.6
KOG1915		677	consensus Cell cycle control protein (crooked neck	98.6
COG4700		251	Uncharacterized protein conserved in bacteria cont	98.59
PF12688		120	TPR_5: Tetratrico peptide repeat	98.59
PF13512		142	TPR_18: Tetratricopeptide repeat	98.58
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	98.55
COG4700		251	Uncharacterized protein conserved in bacteria cont	98.55
PF13428		44	TPR_14: Tetratricopeptide repeat	98.54
KOG2047		835	consensus mRNA splicing factor [RNA processing and	98.53
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	98.5
KOG2047		835	consensus mRNA splicing factor [RNA processing and	98.48
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	98.46
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	98.45
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	98.43
COG4105		254	ComL DNA uptake lipoprotein [General function pred	98.41
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	98.41
KOG2053		932	consensus Mitochondrial inheritance and actin cyto	98.41
COG0457		291	NrfG FOG: TPR repeat [General function prediction	98.4
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	98.37
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	98.36
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	98.34
KOG4234		271	consensus TPR repeat-containing protein [General f	98.33
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	98.33
KOG2796		366	consensus Uncharacterized conserved protein [Funct	98.26
KOG4648		536	consensus Uncharacterized conserved protein, conta	98.22
PF13431		34	TPR_17: Tetratricopeptide repeat	98.19
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	98.16
COG3118		304	Thioredoxin domain-containing protein [Posttransla	98.14
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.12
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	98.11
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	98.11
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	98.1
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	98.07
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	98.06
KOG4648		536	consensus Uncharacterized conserved protein, conta	98.06
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	98.04
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.02
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	97.97
KOG4555		175	consensus TPR repeat-containing protein [Function	97.95
KOG4234		271	consensus TPR repeat-containing protein [General f	97.94
KOG1586		288	consensus Protein required for fusion of vesicles	97.91
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	97.85
KOG4555		175	consensus TPR repeat-containing protein [Function	97.85
KOG2610		491	consensus Uncharacterized conserved protein [Funct	97.85
COG3118		304	Thioredoxin domain-containing protein [Posttransla	97.84
KOG2610		491	consensus Uncharacterized conserved protein [Funct	97.82
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	97.79
PF09613		160	HrpB1_HrpK: Bacterial type III secretion protein (	97.76
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	97.74
PF13428		44	TPR_14: Tetratricopeptide repeat	97.73
PF13431		34	TPR_17: Tetratricopeptide repeat	97.63
KOG0376		476	consensus Serine-threonine phosphatase 2A, catalyt	97.59
KOG1941		518	consensus Acetylcholine receptor-associated protei	97.59
COG3898		531	Uncharacterized membrane-bound protein [Function u	97.55
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	97.55
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	97.53
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	97.5
KOG1586		288	consensus Protein required for fusion of vesicles	97.46
PF03704		146	BTAD: Bacterial transcriptional activator domain;	97.44
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	97.43
KOG0545		329	consensus Aryl-hydrocarbon receptor-interacting pr	97.42
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	97.37
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	97.34
KOG0376		476	consensus Serine-threonine phosphatase 2A, catalyt	97.34
PF09613		160	HrpB1_HrpK: Bacterial type III secretion protein (	97.33
KOG1585		308	consensus Protein required for fusion of vesicles	97.33
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	97.32
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	97.32
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	97.31
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	97.3
PF14561		90	TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S	97.28
TIGR02561		153	HrpB1_HrpK type III secretion protein HrpB1/HrpK.	97.25
KOG3616		1636	consensus Selective LIM binding factor [Transcript	97.24
COG4649		221	Uncharacterized protein conserved in bacteria [Fun	97.2
KOG0545		329	consensus Aryl-hydrocarbon receptor-interacting pr	97.2
KOG3616		1636	consensus Selective LIM binding factor [Transcript	97.19
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	97.17
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	97.11
KOG1941		518	consensus Acetylcholine receptor-associated protei	97.07
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	97.03
KOG2396		568	consensus HAT (Half-A-TPR) repeat-containing prote	96.97
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	96.91
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	96.85
KOG2396		568	consensus HAT (Half-A-TPR) repeat-containing prote	96.84
KOG0551		390	consensus Hsp90 co-chaperone CNS1 (contains TPR re	96.83
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	96.82
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	96.75
PF14853		53	Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe	96.74
PRK10941		269	hypothetical protein; Provisional	96.71
KOG1258		577	consensus mRNA processing protein [RNA processing	96.71
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	96.69
KOG3364		149	consensus Membrane protein involved in organellar	96.67
KOG1550		552	consensus Extracellular protein SEL-1 and related	96.67
TIGR02561		153	HrpB1_HrpK type III secretion protein HrpB1/HrpK.	96.64
KOG1550		552	consensus Extracellular protein SEL-1 and related	96.64
PRK10941		269	hypothetical protein; Provisional	96.6
KOG3824		472	consensus Huntingtin interacting protein HYPE [Gen	96.58
KOG2471		696	consensus TPR repeat-containing protein [General f	96.58
KOG2300		629	consensus Uncharacterized conserved protein [Funct	96.55
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	96.54
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	96.52
KOG1585		308	consensus Protein required for fusion of vesicles	96.5
KOG1308		377	consensus Hsp70-interacting protein Hip/Transient	96.49
KOG1914		656	consensus mRNA cleavage and polyadenylation factor	96.46
KOG2471		696	consensus TPR repeat-containing protein [General f	96.45
PF04910		360	Tcf25: Transcriptional repressor TCF25; InterPro:	96.43
COG4649		221	Uncharacterized protein conserved in bacteria [Fun	96.37
PF03704		146	BTAD: Bacterial transcriptional activator domain;	96.36
PF08424		321	NRDE-2: NRDE-2, necessary for RNA interference; In	96.31
KOG3824		472	consensus Huntingtin interacting protein HYPE [Gen	96.3
COG5107		660	RNA14 Pre-mRNA 3'-end processing (cleavage and pol	96.3
KOG0530		318	consensus Protein farnesyltransferase, alpha subun	96.18
KOG2041		1189	consensus WD40 repeat protein [General function pr	96.11
PF08424		321	NRDE-2: NRDE-2, necessary for RNA interference; In	96.09
PF14853		53	Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe	96.08
PF14561		90	TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S	96.01
KOG1258		577	consensus mRNA processing protein [RNA processing	96.0
KOG0551		390	consensus Hsp90 co-chaperone CNS1 (contains TPR re	96.0
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	95.98
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	95.93
KOG1914		656	consensus mRNA cleavage and polyadenylation factor	95.91
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	95.89
PF04190		260	DUF410: Protein of unknown function (DUF410) ; Int	95.88
KOG4507		886	consensus Uncharacterized conserved protein, conta	95.79
KOG1308		377	consensus Hsp70-interacting protein Hip/Transient	95.76
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	95.67
COG3914		620	Spy Predicted O-linked N-acetylglucosamine transfe	95.63
KOG3364		149	consensus Membrane protein involved in organellar	95.62
COG4976		287	Predicted methyltransferase (contains TPR repeat)	95.59
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	95.5
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	95.46
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	95.44
KOG2041		1189	consensus WD40 repeat protein [General function pr	95.35
KOG1464		440	consensus COP9 signalosome, subunit CSN2 [Posttran	95.22
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	95.17
PF04781		111	DUF627: Protein of unknown function (DUF627); Inte	95.15
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	95.14
KOG4507		886	consensus Uncharacterized conserved protein, conta	95.07
KOG2300		629	consensus Uncharacterized conserved protein [Funct	95.03
PF04348		536	LppC: LppC putative lipoprotein; InterPro: IPR0074	94.95
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	94.93
COG5191		435	Uncharacterized conserved protein, contains HAT (H	94.89
PF07079		549	DUF1347: Protein of unknown function (DUF1347); In	94.87
PF04910		360	Tcf25: Transcriptional repressor TCF25; InterPro:	94.79
COG5191		435	Uncharacterized conserved protein, contains HAT (H	94.64
COG4976		287	Predicted methyltransferase (contains TPR repeat)	94.61
PF07720		36	TPR_3: Tetratricopeptide repeat; InterPro: IPR0117	94.56
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	94.4
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	94.4
PF07721		26	TPR_4: Tetratricopeptide repeat; InterPro: IPR0117	94.3
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	94.22
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	94.11
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	93.92
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	93.88
COG3107		604	LppC Putative lipoprotein [General function predic	93.79
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	93.55
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	93.51
PF07721		26	TPR_4: Tetratricopeptide repeat; InterPro: IPR0117	93.48
PF07079		549	DUF1347: Protein of unknown function (DUF1347); In	93.26
COG5107		660	RNA14 Pre-mRNA 3'-end processing (cleavage and pol	93.22
PRK15180		831	Vi polysaccharide biosynthesis protein TviD; Provi	93.19
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	93.11
PF13041		50	PPR_2: PPR repeat family	93.07
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	92.96
COG3914		620	Spy Predicted O-linked N-acetylglucosamine transfe	92.74
KOG1310		758	consensus WD40 repeat protein [General function pr	92.68
KOG0530		318	consensus Protein farnesyltransferase, alpha subun	92.34
KOG0890		2382	consensus Protein kinase of the PI-3 kinase family	92.19
smart00386		33	HAT HAT (Half-A-TPR) repeats. Present in several R	92.12
COG2912		269	Uncharacterized conserved protein [Function unknow	92.1
COG2912		269	Uncharacterized conserved protein [Function unknow	91.95
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	91.87
COG3629		280	DnrI DNA-binding transcriptional activator of the	91.76
KOG1839		1236	consensus Uncharacterized protein CLU1/cluA/TIF31	91.65
PF10373		278	EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP	91.6
KOG0890		2382	consensus Protein kinase of the PI-3 kinase family	91.5
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	91.12
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	91.02
PF04190		260	DUF410: Protein of unknown function (DUF410) ; Int	90.64
COG5159		421	RPN6 26S proteasome regulatory complex component [	90.59
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	90.44
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	90.16
KOG4814		872	consensus Uncharacterized conserved protein [Funct	89.88
smart00386		33	HAT HAT (Half-A-TPR) repeats. Present in several R	89.55
PRK12798		421	chemotaxis protein; Reviewed	89.25
TIGR02508		115	type_III_yscG type III secretion protein, YscG fam	89.08
PF12854		34	PPR_1: PPR repeat	88.83
TIGR03504		44	FimV_Cterm FimV C-terminal domain. This protein is	88.78
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	88.73
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	88.3
PF12854		34	PPR_1: PPR repeat	88.24
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	87.98
TIGR03504		44	FimV_Cterm FimV C-terminal domain. This protein is	87.96
PRK15180		831	Vi polysaccharide biosynthesis protein TviD; Provi	87.45
PF07720		36	TPR_3: Tetratricopeptide repeat; InterPro: IPR0117	87.3
cd00280		200	TRFH Telomeric Repeat binding Factor or TTAGGG Rep	86.86
KOG2581		493	consensus 26S proteasome regulatory complex, subun	86.68
COG3947		361	Response regulator containing CheY-like receiver a	86.68
PRK09687		280	putative lyase; Provisional	86.62
KOG4814		872	consensus Uncharacterized conserved protein [Funct	86.38
COG3629		280	DnrI DNA-binding transcriptional activator of the	86.31
KOG1310		758	consensus WD40 repeat protein [General function pr	86.28
KOG2422		665	consensus Uncharacterized conserved protein [Funct	86.28
COG4259		121	Uncharacterized protein conserved in bacteria [Fun	86.23
PF13226		277	DUF4034: Domain of unknown function (DUF4034)	86.23
PF10579		80	Rapsyn_N: Rapsyn N-terminal myristoylation and lin	85.92
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	85.67
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	84.92
PF10255		404	Paf67: RNA polymerase I-associated factor PAF67; I	84.34
PF04348		536	LppC: LppC putative lipoprotein; InterPro: IPR0074	84.1
PF04781		111	DUF627: Protein of unknown function (DUF627); Inte	83.31
PF08311		126	Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro	83.21
PF11846		193	DUF3366: Domain of unknown function (DUF3366); Int	82.15
PF09205		161	DUF1955: Domain of unknown function (DUF1955); Int	82.13
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	80.46
PRK11619		644	lytic murein transglycosylase; Provisional	80.21
KOG3783		546	consensus Uncharacterized conserved protein [Funct	80.01

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

Probab=100.00  E-value=1.1e-39  Score=279.43  Aligned_cols=286  Identities=54%  Similarity=0.874  Sum_probs=254.1

Q ss_pred             CCchhhhhhhhhhccHHHHHhhccCCCCCCchHHHHHHHHHHHHHhhCChhHHHHhhhhcCCchHHHHHHHHHhhcCCCC
Q 022777            7 PDHLFNLRNNFYLGAYQAAINNSDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSSPDN   86 (292)
Q Consensus         7 ~~~~~~~~~~~~~g~~~~Ai~~~~~~~~~p~~~~~a~~~la~~~~~~g~~~~Al~~~~~a~~~~~~a~~~la~~~~~~~~   86 (292)
                      ++++|.|+.+|+.|+|.+||...++...+|+...+..++++|+|+.+|+++.++..+....+|...++..++.++...++
T Consensus         2 ~deLf~vrn~fy~G~Y~~~i~e~~~~~~~~~~~~e~~~~~~Rs~iAlg~~~~vl~ei~~~~~~~l~av~~la~y~~~~~~   81 (290)
T PF04733_consen    2 SDELFTVRNQFYLGNYQQCINEASLKSFSPENKLERDFYQYRSYIALGQYDSVLSEIKKSSSPELQAVRLLAEYLSSPSD   81 (290)
T ss_dssp             --TTHHHHHHHCTT-HHHHCHHHHCHTSTCHHHHHHHHHHHHHHHHTT-HHHHHHHS-TTSSCCCHHHHHHHHHHCTSTT
T ss_pred             chHHHHHHHHHHhhhHHHHHHHhhccCCCchhHHHHHHHHHHHHHHcCChhHHHHHhccCCChhHHHHHHHHHHHhCccc
Confidence            57899999999999999999763455567777889999999999999999999999877677888899999999887778


Q ss_pred             hhHHHHHHHHHhcCCCCCccHHHHHHHHHHHHhcCCHHHHHHHhhcCCchhHHHHHHHHHHhCCChHHHHHHHHHHHhhC
Q 022777           87 KESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQID  166 (292)
Q Consensus        87 ~~~A~~~~~~~l~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~l~~~~~~~  166 (292)
                      .+.++..+++.+..+..+.++.+.+..|.++...|++++|++.+.+..+.|+..+..++++++++++.|.+.++.+.+.+
T Consensus        82 ~e~~l~~l~~~~~~~~~~~~~~~~~~~A~i~~~~~~~~~AL~~l~~~~~lE~~al~Vqi~L~~~R~dlA~k~l~~~~~~~  161 (290)
T PF04733_consen   82 KESALEELKELLADQAGESNEIVQLLAATILFHEGDYEEALKLLHKGGSLELLALAVQILLKMNRPDLAEKELKNMQQID  161 (290)
T ss_dssp             HHCHHHHHHHCCCTS---CHHHHHHHHHHHHCCCCHHHHHHCCCTTTTCHHHHHHHHHHHHHTT-HHHHHHHHHHHHCCS
T ss_pred             hHHHHHHHHHHHHhccccccHHHHHHHHHHHHHcCCHHHHHHHHHccCcccHHHHHHHHHHHcCCHHHHHHHHHHHHhcC
Confidence            88999999888876434457788899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcHHHHHHHHHHHHHhccccHHHHHHHHHHhHhhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCCHHHHHHH
Q 022777          167 EDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANL  246 (292)
Q Consensus       167 p~~~~~~l~~a~~~l~~~~~~~~~A~~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l  246 (292)
                      +|++..+++.+|+++..|.+++.+|+.+|+++.+.+|.++..++++|+|.+.+|+|++|++.+++++..+|++++++.|+
T Consensus       162 eD~~l~qLa~awv~l~~g~e~~~~A~y~f~El~~~~~~t~~~lng~A~~~l~~~~~~eAe~~L~~al~~~~~~~d~LaNl  241 (290)
T PF04733_consen  162 EDSILTQLAEAWVNLATGGEKYQDAFYIFEELSDKFGSTPKLLNGLAVCHLQLGHYEEAEELLEEALEKDPNDPDTLANL  241 (290)
T ss_dssp             CCHHHHHHHHHHHHHHHTTTCCCHHHHHHHHHHCCS--SHHHHHHHHHHHHHCT-HHHHHHHHHHHCCC-CCHHHHHHHH
T ss_pred             CcHHHHHHHHHHHHHHhCchhHHHHHHHHHHHHhccCCCHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhccCCHHHHHHH
Confidence            99999999999999999988999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCc---HHHHHHHHHhhCCCChhHHhHHhhHHHHHHHHhhcC
Q 022777          247 VVCSLHQGKS---TSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA  292 (292)
Q Consensus       247 ~~~~~~~g~~---a~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~~~~~~  292 (292)
                      +++....|++   +.++++++...+|+||++.++..+.+.||+++++|+
T Consensus       242 iv~~~~~gk~~~~~~~~l~qL~~~~p~h~~~~~~~~~~~~FD~~~~ky~  290 (290)
T PF04733_consen  242 IVCSLHLGKPTEAAERYLSQLKQSNPNHPLVKDLAEKEAEFDRAVAKYA  290 (290)
T ss_dssp             HHHHHHTT-TCHHHHHHHHHCHHHTTTSHHHHHHHHHHHHHHHHHHCCS
T ss_pred             HHHHHHhCCChhHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHhcC
Confidence            9999999988   789999999999999999999999999999999996

This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits. This entry represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex []. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006890 retrograde vesicle-mediated transport, Golgi to ER, 0030126 COPI vesicle coat; PDB: 3MV2_B 3MV3_F 3MKR_A.

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification]	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3898 Uncharacterized membrane-bound protein [Function unknown]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>KOG2047 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>KOG2047 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2610 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2610 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>COG3898 Uncharacterized membrane-bound protein [Function unknown]	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only]	Back alignment and domain information

>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B	Back alignment and domain information

>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only]	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A	Back alignment and domain information

>PRK10941 hypothetical protein; Provisional	Back alignment and domain information

>KOG1258 consensus mRNA processing protein [RNA processing and modification]	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK	Back alignment and domain information

>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK10941 hypothetical protein; Provisional	Back alignment and domain information

>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only]	Back alignment and domain information

>KOG2471 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification]	Back alignment and domain information

>KOG2471 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ]	Back alignment and domain information

>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function	Back alignment and domain information

>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only]	Back alignment and domain information

>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification]	Back alignment and domain information

>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function	Back alignment and domain information

>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A	Back alignment and domain information

>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B	Back alignment and domain information

>KOG1258 consensus mRNA processing protein [RNA processing and modification]	Back alignment and domain information

>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification]	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function	Back alignment and domain information

>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown]	Back alignment and domain information

>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown]	Back alignment and domain information

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only]	Back alignment and domain information

>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length	Back alignment and domain information

>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ]	Back alignment and domain information

>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only]	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones []	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>COG3107 LppC Putative lipoprotein [General function prediction only]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models	Back alignment and domain information

>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length	Back alignment and domain information

>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification]	Back alignment and domain information

>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PF13041 PPR_2: PPR repeat family	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>smart00386 HAT HAT (Half-A-TPR) repeats	Back alignment and domain information

>COG2912 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG2912 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms]	Back alignment and domain information

>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only]	Back alignment and domain information

>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ]	Back alignment and domain information

>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>KOG4814 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00386 HAT HAT (Half-A-TPR) repeats	Back alignment and domain information

>PRK12798 chemotaxis protein; Reviewed	Back alignment and domain information

>TIGR02508 type_III_yscG type III secretion protein, YscG family	Back alignment and domain information

>PF12854 PPR_1: PPR repeat	Back alignment and domain information

>TIGR03504 FimV_Cterm FimV C-terminal domain	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12854 PPR_1: PPR repeat	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>TIGR03504 FimV_Cterm FimV C-terminal domain	Back alignment and domain information

>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional	Back alignment and domain information

>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones []	Back alignment and domain information

>cd00280 TRFH Telomeric Repeat binding Factor or TTAGGG Repeat binding Factor, central (dimerization) domain Homology; TRFH	Back alignment and domain information

>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms]	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>KOG4814 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2422 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG4259 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF13226 DUF4034: Domain of unknown function (DUF4034)	Back alignment and domain information

>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 []	Back alignment and domain information

>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown	Back alignment and domain information

>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function	Back alignment and domain information

>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division	Back alignment and domain information

>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised	Back alignment and domain information

>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>PRK11619 lytic murein transglycosylase; Provisional	Back alignment and domain information

>KOG3783 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		292
3mkr_A		291	Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomp		2e-57
3mv3_B		310	Crystal Structure Of A-Cop In Complex With E-Cop Le		5e-04

>pdb|3MKR|A Chain A, Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomplex Of The Copi Vesicular Coat Length = 291

Back alignment and structure

Iteration: 1

Score = 219 bits (558), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 116/283 (40%), Positives = 173/283 (61%), Gaps = 4/283 (1%) Query: 8 DHLFNLRNNFYLGAYQAAINNSD-LTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDES 66 D LF+++N FY+G+YQ IN + + P+ VERD +YR+Y+A Y +V+ EI S Sbjct: 1 DELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPS 60 Query: 67 AATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEA 126 +A LQAV++ A YL+S +++ ++ L +S +N T L+A I+ ++++ + A Sbjct: 61 SAPELQAVRMFAEYLASHSRRDAIVAELDREMSRSVDVTNTTFLLMAASIYFYDQNPDAA 120 Query: 127 LKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGS 186 L+ + G ++E A+ VQI LK+ R D A ++L+ MQ DED TLTQLA AW++LA GG Sbjct: 121 LRTLHQGDSLECMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGGE 180 Query: 187 KIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGXXXXXXXXXXXXPETLANL 246 K+Q+AY IFQ+ ++K T L+LNG+A C M G ++ AEG PETL NL Sbjct: 181 KLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINL 240 Query: 247 VVCSLHQGKS---TSRYLNQLKLTHPDHMLVKRASSGDESFER 286 VV S H GK T+RYL+QLK H H +K + + F+R Sbjct: 241 VVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYRAKENDFDR 283

PyMOL of 3mkr

>pdb|3MV3|B Chain B, Crystal Structure Of A-Cop In Complex With E-Cop Length = 310

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		292
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	7e-77
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	2e-75
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	5e-05
1qzv_F		154	Plant photosystem I: subunit PSAF; photosynthesis,	6e-05
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	2e-04
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	3e-04
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	8e-04
3tax_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	9e-04

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291	Back alignment and structure

 Score =  235 bits (599), Expect = 7e-77
 Identities = 122/289 (42%), Positives = 183/289 (63%), Gaps = 4/289 (1%)

Query: 8   DHLFNLRNNFYLGAYQAAINN-SDLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDES 66
           D LF+++N FY+G+YQ  IN    +    P+  VERD  +YR+Y+A   Y +V+ EI  S
Sbjct: 1   DELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPS 60

Query: 67  AATPLQAVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEA 126
           +A  LQAV++ A YL+S   +++ ++ L   +S     +N T  L+A  I+ ++++ + A
Sbjct: 61  SAPELQAVRMFAEYLASHSRRDAIVAELDREMSRSVDVTNTTFLLMAASIYFYDQNPDAA 120

Query: 127 LKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGS 186
           L+  + G ++E  A+ VQI LK+ R D A ++L+ MQ  DED TLTQLA AW++LA GG 
Sbjct: 121 LRTLHQGDSLECMAMTVQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVSLAAGGE 180

Query: 187 KIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANL 246
           K+Q+AY IFQ+ ++K   T L+LNG+A C M  G ++ AEG+L +AL+KD+  PETL NL
Sbjct: 181 KLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINL 240

Query: 247 VVCSLHQGKS---TSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA 292
           VV S H GK    T+RYL+QLK  H  H  +K   + +  F+R +   A
Sbjct: 241 VVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYRAKENDFDRLVLQYA 289

PyMOL of 3mkr

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Length = 310	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151	Back alignment and structure

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388	Back alignment and structure

>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		292
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	100.0
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	100.0
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.98
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.98
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.97
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.97
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.97
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.96
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.96
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.96
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.96
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.95
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.95
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.95
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.95
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.95
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.95
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.95
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.95
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.94
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.94
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.94
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.94
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.94
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.94
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.94
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.93
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.93
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.92
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.92
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.92
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.92
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.92
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.92
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.91
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.91
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.91
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.9
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.9
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.9
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.9
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.9
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.88
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.88
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.88
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.88
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.88
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.88
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	99.87
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.87
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.86
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.86
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.86
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.86
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.86
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.84
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.84
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.84
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.84
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.83
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	99.83
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	99.83
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.83
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.82
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.82
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	99.82
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	99.82
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	99.81
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	99.8
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.8
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.8
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	99.79
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	99.79
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.78
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.78
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	99.77
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.77
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	99.77
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	99.76
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.76
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.75
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.74
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.74
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	99.74
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	99.74
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	99.74
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.73
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	99.72
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.72
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	99.72
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.72
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.71
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	99.71
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.71
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.71
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.71
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	99.7
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.69
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.68
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	99.68
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	99.67
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	99.66
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	99.66
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	99.65
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	99.64
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	99.64
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.64
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.64
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.63
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	99.63
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	99.63
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	99.62
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.62
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	99.62
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	99.61
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	99.6
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	99.6
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.6
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	99.59
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	99.59
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	99.58
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.57
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	99.57
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	99.57
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	99.57
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	99.56
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	99.56
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	99.56
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	99.56
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	99.55
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	99.54
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	99.54
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	99.54
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	99.53
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.52
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	99.51
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	99.51
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	99.51
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.51
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	99.5
3k9i_A		117	BH0479 protein; putative protein binding protein,	99.5
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	99.5
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	99.5
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.49
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.49
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	99.48
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	99.48
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	99.47
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.47
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	99.47
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	99.47
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	99.45
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	99.45
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	99.45
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	99.44
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	99.44
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	99.44
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	99.44
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	99.43
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	99.43
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	99.42
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	99.41
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	99.41
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	99.41
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.41
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.4
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	99.4
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	99.4
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	99.4
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	99.4
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	99.39
3k9i_A		117	BH0479 protein; putative protein binding protein,	99.39
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	99.39
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.38
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	99.37
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	99.35
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	99.35
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	99.33
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	99.33
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	99.33
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	99.32
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.32
2kat_A		115	Uncharacterized protein; NESG, structure, structur	99.3
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	99.28
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	99.28
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	99.22
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	99.22
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	99.19
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	99.19
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	99.16
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	99.16
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	99.16
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	99.14
2kat_A		115	Uncharacterized protein; NESG, structure, structur	99.12
2l6j_A		111	TPR repeat-containing protein associated with HSP;	99.11
1pc2_A		152	Mitochondria fission protein; unknown function; NM	99.07
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	99.05
2l6j_A		111	TPR repeat-containing protein associated with HSP;	98.97
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	98.95
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	98.92
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	98.92
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	98.92
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	98.88
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.8
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	98.79
1klx_A		138	Cysteine rich protein B; structural genomics, heli	98.79
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.78
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.77
1klx_A		138	Cysteine rich protein B; structural genomics, heli	98.74
1pc2_A		152	Mitochondria fission protein; unknown function; NM	98.71
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.68
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	98.65
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	98.64
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	98.61
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.59
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	98.57
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	98.56
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	98.56
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	98.41
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.39
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	98.36
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	98.26
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	98.19
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	98.08
4h7y_A		161	Dual specificity protein kinase TTK; mitotic check	98.01
1y8m_A		144	FIS1; mitochondria, unknown function; NMR {Sacchar	97.96
3o48_A		134	Mitochondria fission 1 protein; tetratricopeptide	97.89
3o48_A		134	Mitochondria fission 1 protein; tetratricopeptide	97.67
1y8m_A		144	FIS1; mitochondria, unknown function; NMR {Sacchar	97.67
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	97.14
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	97.08
4h7y_A		161	Dual specificity protein kinase TTK; mitotic check	97.05
3kae_A		242	CDC27, possible protein of nuclear scaffold; tetra	96.94
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	96.93
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	96.79
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	96.73
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	96.14
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	96.08
4gns_B		754	Protein CSD3, chitin biosynthesis protein CHS6; FN	95.97
2wpv_A		312	GET4, UPF0363 protein YOR164C; golgi-ER traffickin	95.8
1zbp_A		273	Hypothetical protein VPA1032; alpha-beta protein,	95.2
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	95.19
1zbp_A		273	Hypothetical protein VPA1032; alpha-beta protein,	94.99
4gns_B		754	Protein CSD3, chitin biosynthesis protein CHS6; FN	94.82
3spa_A		1134	Mtrpol, DNA-directed RNA polymerase, mitochondrial	94.78
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	94.61
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	94.6
3spa_A		1134	Mtrpol, DNA-directed RNA polymerase, mitochondrial	94.53
1qsa_A		618	Protein (soluble lytic transglycosylase SLT70); al	93.96
4fhn_B		1139	Nucleoporin NUP120; protein complex,structural pro	93.54
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	93.54
4fhn_B		1139	Nucleoporin NUP120; protein complex,structural pro	93.5
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	93.29
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	92.62
3lpz_A		336	GET4 (YOR164C homolog); protein targeting, tail-an	92.52
1ya0_A		497	SMG-7 transcript variant 2; alpha-helical repeat,	92.43
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	92.21
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	92.01
1ya0_A		497	SMG-7 transcript variant 2; alpha-helical repeat,	90.56
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	90.27
3lvg_A		624	Clathrin heavy chain 1; SELF assembly, coated PIT,	89.51
2uwj_G		115	Type III export protein PSCG; virulence, chaperone	89.28
2p58_C		116	Putative type III secretion protein YSCG; type III	88.95
3kae_A		242	CDC27, possible protein of nuclear scaffold; tetra	87.88
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	87.58
2ynq_A		161	ESSB; membrane protein, secretion, type V, secreti	87.48
3bu8_A		235	Telomeric repeat-binding factor 2; TRF2 TRFH domai	84.73
1qsa_A		618	Protein (soluble lytic transglycosylase SLT70); al	84.62
1wy6_A		172	Hypothetical protein ST1625; helical repeat protei	84.03
3esl_A		202	Checkpoint serine/threonine-protein kinase BUB1; m	83.15
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	82.37
3t5v_B		455	Nuclear mRNA export protein THP1; PCI, mRNA nuclea	81.95
2wvi_A		164	Mitotic checkpoint serine/threonine-protein kinase	81.36

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

Probab=100.00  E-value=1.2e-44  Score=312.52  Aligned_cols=285  Identities=43%  Similarity=0.712  Sum_probs=270.0

Q ss_pred             CchhhhhhhhhhccHHHHHhhc-cCCCCCCchHHHHHHHHHHHHHhhCChhHHHHhhhhcCCchHHHHHHHHHhhcCCCC
Q 022777            8 DHLFNLRNNFYLGAYQAAINNS-DLTNLPPDDAVERDCLVYRSYIALGSYQLVISEIDESAATPLQAVKLLALYLSSPDN   86 (292)
Q Consensus         8 ~~~~~~~~~~~~g~~~~Ai~~~-~~~~~~p~~~~~a~~~la~~~~~~g~~~~Al~~~~~a~~~~~~a~~~la~~~~~~~~   86 (292)
                      +++|.|+..|+.|+|+.||... ++...+|++..+++++++++|+.+|+++.|+..++...+|...++..++.++...++
T Consensus         1 d~l~~~~~~~~~g~y~~ai~~~~~~~~~~p~~~~e~~~~l~r~yi~~g~~~~al~~~~~~~~~~~~a~~~la~~~~~~~~   80 (291)
T 3mkr_A            1 DELFDVKNAFYIGSYQQCINEAQRVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPSSAPELQAVRMFAEYLASHSR   80 (291)
T ss_dssp             CTTHHHHHHHHTTCHHHHHHHHHHSCCCSHHHHHHHHHHHHHHHHHTTCHHHHHHHSCTTSCHHHHHHHHHHHHHHCSTT
T ss_pred             CcchHHHHHHHHHHHHHHHHHHHhcccCCchhhHHHHHHHHHHHHHCCCHHHHHHHhcccCChhHHHHHHHHHHHcCCCc
Confidence            5799999999999999999995 488899997778999999999999999999999987778888899999999999999


Q ss_pred             hhHHHHHHHHHhcCCCCCccHHHHHHHHHHHHhcCCHHHHHHHhhcCCchhHHHHHHHHHHhCCChHHHHHHHHHHHhhC
Q 022777           87 KESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQIFLKMHRSDYAERQLRAMQQID  166 (292)
Q Consensus        87 ~~~A~~~~~~~l~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~a~~~~~~~~~~~A~~~l~~~~~~~  166 (292)
                      .++|+..+++++..+.+|+++.+++.+|.++...|++++|+.+|++|.+++++..++.++..+|++++|++.++++++.+
T Consensus        81 ~~~A~~~l~~ll~~~~~P~~~~~~~~la~~~~~~g~~~~Al~~l~~~~~~~~~~~l~~~~~~~g~~~~A~~~l~~~~~~~  160 (291)
T 3mkr_A           81 RDAIVAELDREMSRSVDVTNTTFLLMAASIYFYDQNPDAALRTLHQGDSLECMAMTVQILLKLDRLDLARKELKKMQDQD  160 (291)
T ss_dssp             HHHHHHHHHHHHHSCCCCSCHHHHHHHHHHHHHTTCHHHHHHHHTTCCSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHhcccCCCCHHHHHHHHHHHHHCCCHHHHHHHHhCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHhhC
Confidence            99999999999876335999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcHHHHHHHHHHHHHhccccHHHHHHHHHHhHhhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCCHHHHHHH
Q 022777          167 EDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEGLLLDALNKDAKDPETLANL  246 (292)
Q Consensus       167 p~~~~~~l~~a~~~l~~~~~~~~~A~~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l  246 (292)
                      |++....++.+|+.+..+.|++++|+.+|+++++.+|+++.+++++|.++++.|++++|+..|++++.++|+++++++++
T Consensus       161 p~~~~~~l~~a~~~l~~~~~~~~eA~~~~~~~l~~~p~~~~~~~~la~~~~~~g~~~eA~~~l~~al~~~p~~~~~l~~l  240 (291)
T 3mkr_A          161 EDATLTQLATAWVSLAAGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETLINL  240 (291)
T ss_dssp             TTCHHHHHHHHHHHHHHCTTHHHHHHHHHHHHHHHSCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred             cCcHHHHHHHHHHHHHhCchHHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHH
Confidence            99988888889988888778999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCc---HHHHHHHHHhhCCCChhHHhHHhhHHHHHHHHhhcC
Q 022777          247 VVCSLHQGKS---TSRYLNQLKLTHPDHMLVKRASSGDESFERALQSVA  292 (292)
Q Consensus       247 ~~~~~~~g~~---a~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~~~~~~  292 (292)
                      |.++...|++   +.++++++.+++|+||.+.++..+.+.||+++++|+
T Consensus       241 ~~~~~~~g~~~eaa~~~~~~~~~~~P~~~~~~d~~~~~~~fd~~~~~~~  289 (291)
T 3mkr_A          241 VVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYRAKENDFDRLVLQYA  289 (291)
T ss_dssp             HHHHHHTTCCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHHHHHcC
Confidence            9999999998   578999999999999999999999999999999985

PyMOL of 3mkr

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A	Back alignment and structure

>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A	Back alignment and structure

>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A	Back alignment and structure

>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A	Back alignment and structure

>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi}	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae}	Back alignment and structure

>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A	Back alignment and structure

>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1	Back alignment and structure

>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae}	Back alignment and structure

>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens}	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens}	Back alignment and structure

>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A*	Back alignment and structure

>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-}	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-}	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum}	Back alignment and structure

>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A	Back alignment and structure

>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa}	Back alignment and structure

>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis}	Back alignment and structure

>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi}	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

>2ynq_A ESSB; membrane protein, secretion, type V, secretion system; 2.40A {Geobacillus thermodenitrificans}	Back alignment and structure

>3bu8_A Telomeric repeat-binding factor 2; TRF2 TRFH domain TRF2 dimerization domain TIN2 peptide, alternative splicing, cell cycle, chromosomal protein; 2.15A {Homo sapiens} SCOP: a.146.1.1 PDB: 3bua_A* 1h6p_A	Back alignment and structure

>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A*	Back alignment and structure

>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1	Back alignment and structure

>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		292
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	2e-07
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	1e-05
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	2e-04
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	0.001

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure


class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.7 bits (117), Expect = 2e-07
 Identities = 28/158 (17%), Positives = 47/158 (29%), Gaps = 11/158 (6%)

Query: 105 SNATLRLIAGIIFMHEEDYNEALKHTNAGGTMELHALNVQ-----IFLKMHRSDYAERQL 159
           +     +  G +      ++ A+       ++  +   V      ++ +    D A    
Sbjct: 201 NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTY 260

Query: 160 RAMQQIDEDH--TLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCM 217
           R   ++          LANA          + EA   +       P     LN  A    
Sbjct: 261 RRAIELQPHFPDAYCNLANALKEK----GSVAEAEDCYNTALRLCPTHADSLNNLANIKR 316

Query: 218 HMGNFDEAEGLLLDALNKDAKDPETLANLVVCSLHQGK 255
             GN +EA  L   AL    +     +NL      QGK
Sbjct: 317 EQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGK 354

PyMOL of d1w3ba_

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		292
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.97
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.95
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.94
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.93
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	99.89
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	99.85
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	99.84
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	99.81
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	99.8
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	99.76
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.75
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.66
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.66
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.62
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	99.61
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	99.59
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	99.58
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	99.56
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	99.55
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	99.54
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	99.54
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	99.52
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	99.51
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	99.5
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	99.5
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	99.49
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	99.49
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.47
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.46
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.43
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	99.43
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	99.41
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	99.41
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	99.41
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	99.4
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.39
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	99.38
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	99.37
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	99.35
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	99.32
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.29
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	99.23
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	99.22
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.2
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	99.17
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	99.0
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.98
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	98.91
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	98.86
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.77
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	98.76
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	98.61
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	98.44
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	98.35
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	98.11
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	97.94
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	96.29
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	95.21
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	94.33
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	94.28

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=2.9e-29  Score=218.57  Aligned_cols=199  Identities=15%  Similarity=0.026  Sum_probs=164.3

Q ss_pred             HHHHHHHhhcCCCChhHHHHHHHHHhcCCCCCccHHHHHHHHHHHHhcCCHHHHHHHhhc-----CCchhHHHHHHHHHH
Q 022777           73 AVKLLALYLSSPDNKESTISSLKEWLSDPAIGSNATLRLIAGIIFMHEEDYNEALKHTNA-----GGTMELHALNVQIFL  147 (292)
Q Consensus        73 a~~~la~~~~~~~~~~~A~~~~~~~l~~~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~-----~~~~~~~~~~a~~~~  147 (292)
                      ++..++.++...|++++|+..+++++..  +|+++.++..+|.++...|++++|+..+++     +.....+..+|.++.
T Consensus       171 ~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~  248 (388)
T d1w3ba_         171 AWSNLGCVFNAQGEIWLAIHHFEKAVTL--DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYY  248 (388)
T ss_dssp             HHHHHHHHHHTTTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred             HHHhhcccccccCcHHHHHHHHHHHHHh--CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHH
Confidence            3444455555566667777777777776  788888888888888888888888888876     567777888889999


Q ss_pred             hCCChHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHhccccHHHHHHHHHHhHhhCCCCHHHHHHHHHHHHhcCCHHHHHH
Q 022777          148 KMHRSDYAERQLRAMQQIDEDHTLTQLANAWLNLAVGGSKIQEAYLIFQDFSEKYPMTGLILNGKAVCCMHMGNFDEAEG  227 (292)
Q Consensus       148 ~~~~~~~A~~~l~~~~~~~p~~~~~~l~~a~~~l~~~~~~~~~A~~~~~~~~~~~p~~~~~~~~la~~~~~~g~~~~A~~  227 (292)
                      ..|++++|+..++++++.+|++.......+.++..  .|++++|+..+++++...|.++..+..+|.++...|++++|+.
T Consensus       249 ~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~--~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~  326 (388)
T d1w3ba_         249 EQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKE--KGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVR  326 (388)
T ss_dssp             HTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHH--HSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHH
T ss_pred             HCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH--cCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHH
Confidence            99999999999999999999887666555555444  4569999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhCCCCHHHHHHHHHHHHhcCCc--HHHHHHHHHhhCCCChhHH
Q 022777          228 LLLDALNKDAKDPETLANLVVCSLHQGKS--TSRYLNQLKLTHPDHMLVK  275 (292)
Q Consensus       228 ~~~~al~~~p~~~~~~~~l~~~~~~~g~~--a~~~~~~~~~~~P~~~~~~  275 (292)
                      .|+++++++|+++.+++++|.++...|++  |.+.++++++++|+++.+.
T Consensus       327 ~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~  376 (388)
T d1w3ba_         327 LYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAY  376 (388)
T ss_dssp             HHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHH
T ss_pred             HHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHH
Confidence            99999999999999999999999999988  8999999999999988654

PyMOL of d1w3ba_

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure