Citrus Sinensis ID: 022899

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MVDEAAAATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEINDNDEITDEDEWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANHHLYGPPMISEISTSRVIFHGHEPIHQAVFTSMCGNFIGANQPFVASAAQRAAQYGAGGLRNFVSVGHRAILQPRRRSNGLLGWLPAEHVPSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCHPIRAPHN
cccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccccccHHHHHHcccccccccccEEEccccccccccccccccccccccccccccccEEEccccccHHHHHHHHccccccccEEEEEcccccccccccEEcccccccccccccccccccccccccccc
cccccccccccEEEHcccccccccEEEEEEcccHHHHHHHHHHHHcccccccccccEcccccEEEEcccccccccccccccccccccccccccccccEEccccccccccccccHHHccccccccccccccccccccccEEEEcccccccccccccccccEccccccccHHHHHHHHHHccccccccEEEccHHHccccccccccccccccccccccccEEEEEccccccHHHcHHHHHHccccEEEEEEEccccHHHHHHHHHccHHHcccccEcccccccccccccccc
MVDEAAAATLCSICWEEASETCGRSIVRlqcshlfhldcigsafnvtgimqcpncrevengVWMRfeindndeitdedewpddnlpdmipqqcvghndwgpgfqrvtefpllghrdcpiftanhhlygppmiseistsrvifhghepihQAVFTSMcgnfiganqPFVASAAQRAAQYGAGGLRNFVSVghrailqprrrsngllgwlpaehvpspplqvvhhvpaststihnyhaaavhgdsflsfsiqnnqepeaanlvhchyeeeiapfqifpddigpchpiraphn
MVDEAAAATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEINDNDEITDEDEWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANHHLYGPPMISEISTSRVIFHGHEPIHQAVFTSMCGNFIGANQPFVASAAQRAAQYGAGGLRNFVSVGHRAILQPRRRSNGLLGWLPAEHVPSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCHPIRAPHN
MVDEAAAATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFeindndeitdedeWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANHHLYGPPMISEISTSRVIFHGHEPIHQAVFTSMCGNFIGANQPFVasaaqraaqygaggLRNFVSVGHRAILQPRRRSNGLLGWLPAEHVPSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCHPIRAPHN
******AATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEINDNDEITDEDEWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANHHLYGPPMISEISTSRVIFHGHEPIHQAVFTSMCGNFIGANQPFVASAAQRAAQYGAGGLRNFVSVGHRAILQPRRRSNGLLGWLPAEHVPSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCH*******
******A*TLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEIN*********EWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANH***************************************************************SVGHR*********************PSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCHP******
********TLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEINDNDEITDEDEWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANHHLYGPPMISEISTSRVIFHGHEPIHQAVFTSMCGNFIGANQPFVASAAQRAAQYGAGGLRNFVSVGHRAILQPRRRSNGLLGWLPAEHVPSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCHPIRAPHN
********TLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEINDNDEITDEDEWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANHHLYGPPMISEISTSRVIFHGHEPIHQAVFTSMCGNFIGANQPFVASAAQRAAQYGAGGLRNFVSVGHRAILQPRRRSNGLLGWLPAEHVPSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCHPIR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDEAAAATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEINDNDEITDEDEWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHRDCPIFTANHHLYGPPMISEISTSRVIFHGHEPIHQAVFTSMCGNFIGANQPFVASAAQRAAQYGAGGLRNFVSVGHRAILQPRRRSNGLLGWLPAEHVPSPPLQVVHHVPASTSTIHNYHAAAVHGDSFLSFSIQNNQEPEAANLVHCHYEEEIAPFQIFPDDIGPCHPIRAPHN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
255551773328 hypothetical protein RCOM_0681280 [Ricin 0.431 0.381 0.441 1e-21
226531314 433 LOC100280330 [Zea mays] gi|219888521|gb| 0.375 0.251 0.437 3e-16
242057325 457 hypothetical protein SORBIDRAFT_03g01389 0.289 0.183 0.517 7e-16
242089577 437 hypothetical protein SORBIDRAFT_09g00419 0.375 0.249 0.428 8e-16
6996144 442 VIP2 protein [Avena fatua] 0.368 0.242 0.423 1e-15
357134593 432 PREDICTED: uncharacterized protein LOC10 0.379 0.254 0.433 1e-15
225450795 423 PREDICTED: uncharacterized protein LOC10 0.568 0.390 0.320 1e-15
224123624 431 predicted protein [Populus trichocarpa] 0.648 0.436 0.321 2e-15
296089690 411 unnamed protein product [Vitis vinifera] 0.568 0.401 0.320 2e-15
212276170 446 uncharacterized protein LOC100191616 [Ze 0.289 0.188 0.505 4e-15
>gi|255551773|ref|XP_002516932.1| hypothetical protein RCOM_0681280 [Ricinus communis] gi|223544020|gb|EEF45546.1| hypothetical protein RCOM_0681280 [Ricinus communis] Back     alignment and taxonomy information
 Score =  109 bits (273), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 81/145 (55%), Gaps = 20/145 (13%)

Query: 10  LCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFEIN 69
           LCS+CWEE S TC R++V LQCSHLFHLDCIGSAFN +  M+CPNCR+ ENG W  F+ +
Sbjct: 11  LCSVCWEEVSGTCDRTVVALQCSHLFHLDCIGSAFNASDSMRCPNCRQAENGRWFSFKDD 70

Query: 70  ----DNDEITD-EDEWPDDNLPDMIPQQCVGHNDWGPGFQRVTEFPLLGHR----DCPIF 120
               D DE+TD ED  P   +          H+   P  +   E  LL  +    +   F
Sbjct: 71  NPESDTDEVTDNEDSHPSSEMEPF-------HDHLSPTARLFPELYLLNEQVMNEELVRF 123

Query: 121 TANHH----LYGPPMISEISTSRVI 141
           + N H    L GP    EI+ SRV+
Sbjct: 124 SGNPHFNPYLVGPLSPGEIAASRVL 148

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|226531314|ref|NP_001146728.1| LOC100280330 [Zea mays] gi|219888521|gb|ACL54635.1| unknown [Zea mays] gi|413944618|gb|AFW77267.1| putative RING zinc finger domain superfamily protein [Zea mays] Back     alignment and taxonomy information
>gi|242057325|ref|XP_002457808.1| hypothetical protein SORBIDRAFT_03g013890 [Sorghum bicolor] gi|241929783|gb|EES02928.1| hypothetical protein SORBIDRAFT_03g013890 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|242089577|ref|XP_002440621.1| hypothetical protein SORBIDRAFT_09g004190 [Sorghum bicolor] gi|241945906|gb|EES19051.1| hypothetical protein SORBIDRAFT_09g004190 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|6996144|emb|CAB75506.1| VIP2 protein [Avena fatua] Back     alignment and taxonomy information
>gi|357134593|ref|XP_003568901.1| PREDICTED: uncharacterized protein LOC100841837 isoform 1 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|225450795|ref|XP_002279542.1| PREDICTED: uncharacterized protein LOC100251003 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224123624|ref|XP_002330167.1| predicted protein [Populus trichocarpa] gi|222871623|gb|EEF08754.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296089690|emb|CBI39509.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|212276170|ref|NP_001130517.1| uncharacterized protein LOC100191616 [Zea mays] gi|194689358|gb|ACF78763.1| unknown [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
TAIR|locus:2043438358 RFI2 "RED AND FAR-RED INSENSIT 0.258 0.209 0.463 2.8e-18
TAIR|locus:1005716577 425 AT3G05545 "AT3G05545" [Arabido 0.186 0.127 0.611 9.9e-15
TAIR|locus:2140857226 AT4G13490 [Arabidopsis thalian 0.186 0.238 0.490 2.1e-13
TAIR|locus:2049083362 AT2G15260 [Arabidopsis thalian 0.186 0.149 0.553 2.9e-10
TAIR|locus:2102445 675 AT3G54780 "AT3G54780" [Arabido 0.151 0.065 0.489 0.00061
TAIR|locus:2043438 RFI2 "RED AND FAR-RED INSENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 197 (74.4 bits), Expect = 2.8e-18, Sum P(2) = 2.8e-18
 Identities = 38/82 (46%), Positives = 48/82 (58%)

Query:    11 CSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVENGVWMRFXXXX 70
             CSIC E   +   RS  +LQC H FHLDCIGSAFN+ G MQCPNCR VE G W+      
Sbjct:    38 CSICLESVLDDGTRSKAKLQCGHQFHLDCIGSAFNMKGAMQCPNCRNVEKGQWL------ 91

Query:    71 XXXXXXXXXWPDDNLPDMIPQQ 92
                      +P+ ++ D IP++
Sbjct:    92 -YANGSTRPFPEFSMEDWIPEE 112
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
TAIR|locus:1005716577 AT3G05545 "AT3G05545" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140857 AT4G13490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049083 AT2G15260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102445 AT3G54780 "AT3G54780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 5e-05
smart0018440 smart00184, RING, Ring finger 4e-04
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 45.5 bits (108), Expect = 5e-07
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%)

Query: 11 CSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCR 56
          C IC +E     G  +V L C H+FH +C+      +    CP CR
Sbjct: 3  CPICLDE--FEPGEEVVVLPCGHVFHKECLDKWLRSSN--TCPLCR 44

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 290
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.13
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.87
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.84
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.71
PHA02929238 N1R/p28-like protein; Provisional 98.58
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.56
PHA02926242 zinc finger-like protein; Provisional 98.51
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.5
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.49
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.46
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.44
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.42
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.42
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.4
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.38
PF1463444 zf-RING_5: zinc-RING finger domain 98.31
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.27
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.26
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.25
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.05
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.05
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.01
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 97.96
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.94
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.91
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.86
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.86
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.85
COG52191525 Uncharacterized conserved protein, contains RING Z 97.72
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.7
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.66
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.62
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.58
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.42
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.41
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.4
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.35
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.34
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.27
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.2
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.17
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.16
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.04
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.93
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.86
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.81
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.7
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
PHA02825162 LAP/PHD finger-like protein; Provisional 96.06
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.93
KOG1941518 consensus Acetylcholine receptor-associated protei 95.93
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.87
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 95.7
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.69
PHA03096284 p28-like protein; Provisional 95.35
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.7
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.53
KOG2660331 consensus Locus-specific chromosome binding protei 94.08
PHA02862156 5L protein; Provisional 94.06
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.89
KOG0297391 consensus TNF receptor-associated factor [Signal t 93.6
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.18
KOG4445368 consensus Uncharacterized conserved protein, conta 92.97
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 92.91
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 92.76
COG5222427 Uncharacterized conserved protein, contains RING Z 91.43
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 91.08
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 90.73
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 90.72
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 90.54
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 90.44
COG5152259 Uncharacterized conserved protein, contains RING a 90.09
COG5236 493 Uncharacterized conserved protein, contains RING Z 89.87
PF10272358 Tmpp129: Putative transmembrane protein precursor; 89.68
KOG1001674 consensus Helicase-like transcription factor HLTF/ 89.42
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 89.11
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 87.73
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 85.6
KOG3039303 consensus Uncharacterized conserved protein [Funct 85.43
KOG4739233 consensus Uncharacterized protein involved in syna 85.11
PF04641260 Rtf2: Rtf2 RING-finger 84.89
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 84.75
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 84.33
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 84.11
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 84.0
KOG1609323 consensus Protein involved in mRNA turnover and st 82.79
KOG3002299 consensus Zn finger protein [General function pred 82.19
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 81.47
KOG1940276 consensus Zn-finger protein [General function pred 81.29
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 81.25
PLN02189 1040 cellulose synthase 80.82
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information 
Probab=99.13  E-value=3.1e-11  Score=83.05  Aligned_cols=44  Identities=41%  Similarity=0.955  Sum_probs=36.4

Q ss_pred             ccccccccccccccCCceEEeCCCCcccHHHHHHHHhcCCCCCCCCCc
Q 022899            9 TLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCR   56 (290)
Q Consensus         9 ~eCsICLE~~sds~~~~~~~L~CgH~FH~~CI~swl~~k~s~~CPlCR   56 (290)
                      ++|+||++.+.+  +..+..++|+|.||.+||..|++.+  .+||+||
T Consensus         1 d~C~IC~~~~~~--~~~~~~l~C~H~fh~~Ci~~~~~~~--~~CP~CR   44 (44)
T PF13639_consen    1 DECPICLEEFED--GEKVVKLPCGHVFHRSCIKEWLKRN--NSCPVCR   44 (44)
T ss_dssp             -CETTTTCBHHT--TSCEEEETTSEEEEHHHHHHHHHHS--SB-TTTH
T ss_pred             CCCcCCChhhcC--CCeEEEccCCCeeCHHHHHHHHHhC--CcCCccC
Confidence            479999999964  5577888999999999999999754  4699997

...
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 4e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 4e-07
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 8e-07
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 3e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 5e-05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 6e-05
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 7e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 8e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 8e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 3e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 6e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 6e-04
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
 Score = 45.9 bits (109), Expect = 4e-07
 Identities = 16/52 (30%), Positives = 19/52 (36%), Gaps = 6/52 (11%)

Query: 5  AAAATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCR 56
          A  A  C IC E+ S       + L C H F   CI           CP C+
Sbjct: 2  ATVAERCPICLEDPSNYS----MALPCLHAFCYVCITRWIRQNP--TCPLCK 47
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.1
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.1
2ect_A78 Ring finger protein 126; metal binding protein, st 99.06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.04
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.04
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.03
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.02
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.02
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.0
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.99
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.97
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.96
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.96
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.96
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.95
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.94
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.92
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.91
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.9
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.89
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.89
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.88
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.88
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.87
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.85
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.84
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.82
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.81
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.81
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.81
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.79
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.77
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.76
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.7
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.7
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.69
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.67
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.67
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.66
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.65
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.64
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.62
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.58
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.55
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.51
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.5
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.45
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.44
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.43
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.41
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.39
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.39
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.37
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.36
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.36
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.36
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.35
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.16
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.16
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.15
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.12
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.09
2ea5_A68 Cell growth regulator with ring finger domain prot 98.08
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.95
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.4
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.28
3nw0_A238 Non-structural maintenance of chromosomes element 96.93
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 94.84
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 90.6
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 89.56
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 87.35
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 86.83
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 83.29
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 82.8
2k16_A75 Transcription initiation factor TFIID subunit 3; p 81.96
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.10  E-value=9.1e-11  Score=85.94  Aligned_cols=50  Identities=26%  Similarity=0.572  Sum_probs=39.8

Q ss_pred             cCCccccccccccccccCCceEEeCCCCcccHHHHHHHHhcCCCCCCCCCceec
Q 022899            6 AAATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREVE   59 (290)
Q Consensus         6 ~~~~eCsICLE~~sds~~~~~~~L~CgH~FH~~CI~swl~~k~s~~CPlCR~i~   59 (290)
                      .....|+||++.+.+  ...+..++|+|.||..||..|++.+.  +||+||+..
T Consensus        13 ~~~~~C~IC~~~~~~--~~~~~~~~C~H~f~~~Ci~~~~~~~~--~CP~Cr~~~   62 (74)
T 2ep4_A           13 NLHELCAVCLEDFKP--RDELGICPCKHAFHRKCLIKWLEVRK--VCPLCNMPV   62 (74)
T ss_dssp             CCSCBCSSSCCBCCS--SSCEEEETTTEEEEHHHHHHHHHHCS--BCTTTCCBC
T ss_pred             CCCCCCcCCCcccCC--CCcEEEcCCCCEecHHHHHHHHHcCC--cCCCcCccc
Confidence            346789999999864  33456679999999999999997443  699999653
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 290
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 6e-07
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 3e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-05
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-04
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-04
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 0.002
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.004
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 43.7 bits (102), Expect = 6e-07
 Identities = 10/46 (21%), Positives = 15/46 (32%)

Query: 11 CSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCR 56
          C IC EE      R+          H  C+ +   ++    C  C 
Sbjct: 9  CWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICG 54
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.15
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.14
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.12
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.05
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.02
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.99
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.91
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.79
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.78
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.77
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.62
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.6
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.6
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.57
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.47
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.12
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.08
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 87.21
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

Probab=99.15  E-value=1.3e-11  Score=89.66  Aligned_cols=46  Identities=33%  Similarity=0.651  Sum_probs=38.1

Q ss_pred             CCccccccccccccccCCceEEeCCCCcccHHHHHHHHhcCCCCCCCCCcee
Q 022899            7 AATLCSICWEEASETCGRSIVRLQCSHLFHLDCIGSAFNVTGIMQCPNCREV   58 (290)
Q Consensus         7 ~~~eCsICLE~~sds~~~~~~~L~CgH~FH~~CI~swl~~k~s~~CPlCR~i   58 (290)
                      ..++|+||++.+.+    .++.++|+|.||.+||.+|++.+  ..||+||+.
T Consensus         4 ~~d~C~IC~~~~~~----~~~~~~C~H~Fc~~Ci~~w~~~~--~~CP~CR~~   49 (68)
T d1chca_           4 VAERCPICLEDPSN----YSMALPCLHAFCYVCITRWIRQN--PTCPLCKVP   49 (68)
T ss_dssp             CCCCCSSCCSCCCS----CEEETTTTEEESTTHHHHHHHHS--CSTTTTCCC
T ss_pred             CCCCCccCCcCccC----CcEEeCCCCcCcHHHHHHHHHhC--CcCCCCCcc
Confidence            45779999999864    45667999999999999999754  459999964
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure