Citrus Sinensis ID: 022902

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MQSIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESVSYLLF
cccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccc
ccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHcHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHEEcc
MQSIENLVTQIQglssnasdITALKDYLKAAEDLLRSESTRLLSFldqldpskhslgylyflepcmycsitkerANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLleapirgvgpMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVleddiyeinlprdffLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIhhgqfsstlpkytssAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESVSYLLF
MQSIENLVTQiqglssnasdITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETyvqtnrekfesvsyllf
MQSIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESVSYLLF
********************ITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYT*****RNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESV*****
**SIENLVTQIQ************KDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMY*********TLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESVSYLL*
MQSIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKF********
*QSIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESVSYLLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESVSYLLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query290 2.2.26 [Sep-21-2011]
Q8W575 429 COP9 signalosome complex no no 0.975 0.659 0.604 3e-96
Q6P2U9 423 COP9 signalosome complex yes no 0.955 0.654 0.363 4e-41
Q5RFS2 423 COP9 signalosome complex yes no 0.955 0.654 0.360 3e-40
Q4R898 423 COP9 signalosome complex N/A no 0.955 0.654 0.360 3e-40
Q9UNS2 423 COP9 signalosome complex yes no 0.955 0.654 0.360 3e-40
Q68FW9 423 COP9 signalosome complex yes no 0.955 0.654 0.360 3e-40
O88543 423 COP9 signalosome complex yes no 0.955 0.654 0.360 4e-40
Q28IV6 423 COP9 signalosome complex yes no 0.955 0.654 0.360 4e-40
A6H7B5 423 COP9 signalosome complex yes no 0.955 0.654 0.356 5e-40
Q5ZJF1 423 COP9 signalosome complex yes no 0.955 0.654 0.360 5e-40
>sp|Q8W575|CSN3_ARATH COP9 signalosome complex subunit 3 OS=Arabidopsis thaliana GN=CSN3 PE=1 SV=2 Back     alignment and function desciption
 Score =  351 bits (901), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 171/283 (60%), Positives = 213/283 (75%)

Query: 1   MQSIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLY 60
           + S+E ++T IQGLS +  D++AL D L+ A+D LR+E     S LDQLD SKHSLGYLY
Sbjct: 5   VNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLY 64

Query: 61  FLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIR 120
           FLE      ++KE+A   +PIIARFI SC A QIR    KF+++CK  KD V+ L  P+R
Sbjct: 65  FLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLR 124

Query: 121 GVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYC 180
           GVGP+L A++K+Q S++ LT LHP+ LQLCL AK YK+G S+L DDI EI+ PRDFFLY 
Sbjct: 125 GVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYS 184

Query: 181 YYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKY 240
           YYGGMI IG KRF+KALELL+NVVTAPM  +NAIA+EAYKKYILVSLIH+GQF++TLPK 
Sbjct: 185 YYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKC 244

Query: 241 TSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFE 283
            S+AAQR+ KN++ PY+EL N YN GKI ELE  V     +FE
Sbjct: 245 ASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFE 287
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6P2U9|CSN3_DANRE COP9 signalosome complex subunit 3 OS=Danio rerio GN=cops3 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFS2|CSN3_PONAB COP9 signalosome complex subunit 3 OS=Pongo abelii GN=COPS3 PE=2 SV=1 Back     alignment and function description
>sp|Q4R898|CSN3_MACFA COP9 signalosome complex subunit 3 OS=Macaca fascicularis GN=COPS3 PE=2 SV=1 Back     alignment and function description
>sp|Q9UNS2|CSN3_HUMAN COP9 signalosome complex subunit 3 OS=Homo sapiens GN=COPS3 PE=1 SV=3 Back     alignment and function description
>sp|Q68FW9|CSN3_RAT COP9 signalosome complex subunit 3 OS=Rattus norvegicus GN=Cops3 PE=2 SV=1 Back     alignment and function description
>sp|O88543|CSN3_MOUSE COP9 signalosome complex subunit 3 OS=Mus musculus GN=Cops3 PE=1 SV=3 Back     alignment and function description
>sp|Q28IV6|CSN3_XENTR COP9 signalosome complex subunit 3 OS=Xenopus tropicalis GN=cops3 PE=2 SV=1 Back     alignment and function description
>sp|A6H7B5|CSN3_BOVIN COP9 signalosome complex subunit 3 OS=Bos taurus GN=COPS3 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJF1|CSN3_CHICK COP9 signalosome complex subunit 3 OS=Gallus gallus GN=COPS3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
255536979 427 26S proteasome regulatory subunit S3, pu 0.972 0.660 0.773 1e-127
225452159 424 PREDICTED: COP9 signalosome complex subu 0.979 0.669 0.718 1e-118
224060219 423 predicted protein [Populus trichocarpa] 0.975 0.669 0.711 1e-117
224141257 424 predicted protein [Populus trichocarpa] 0.979 0.669 0.704 1e-116
356511828 423 PREDICTED: COP9 signalosome complex subu 0.979 0.671 0.700 1e-116
356511830 423 PREDICTED: COP9 signalosome complex subu 0.979 0.671 0.697 1e-115
356571399 423 PREDICTED: COP9 signalosome complex subu 0.979 0.671 0.700 1e-115
356571401 425 PREDICTED: COP9 signalosome complex subu 0.972 0.663 0.702 1e-114
449441398 423 PREDICTED: COP9 signalosome complex subu 0.975 0.669 0.669 1e-108
449495275 423 PREDICTED: LOW QUALITY PROTEIN: COP9 sig 0.975 0.669 0.665 1e-107
>gi|255536979|ref|XP_002509556.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] gi|223549455|gb|EEF50943.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 252/283 (89%), Gaps = 1/283 (0%)

Query: 3   SIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSES-TRLLSFLDQLDPSKHSLGYLYF 61
           SIE+LVTQIQGLSS+A+DI+AL +YLK A+D L S+S TRLL FLDQLDPS HSLGYLYF
Sbjct: 5   SIESLVTQIQGLSSSATDISALHNYLKQADDSLHSDSPTRLLPFLDQLDPSVHSLGYLYF 64

Query: 62  LEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRG 121
           LE C    I+KE+A TLV I+ARF+TSC+A+QIR  P+KFI+VCKR+KDQV+LLE P+RG
Sbjct: 65  LEACTSGPISKEQARTLVLILARFVTSCAADQIRLAPDKFISVCKRFKDQVMLLEEPMRG 124

Query: 122 VGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYCY 181
           V P+L A+RK+QSS+ HLTTLHPEFLQLCLL+KCYK GLS+LEDDI+E++ PRD FLY Y
Sbjct: 125 VAPLLAAVRKLQSSSVHLTTLHPEFLQLCLLSKCYKTGLSILEDDIFEVDQPRDLFLYSY 184

Query: 182 YGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKYT 241
           YGGM+ IGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYIL SLIH GQFS++LPKY 
Sbjct: 185 YGGMVCIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILASLIHQGQFSTSLPKYA 244

Query: 242 SSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFES 284
           SSAAQRNLKNF QPY+EL N+Y+TGKI ELETYVQTNREKFES
Sbjct: 245 SSAAQRNLKNFCQPYIELANSYSTGKIAELETYVQTNREKFES 287

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225452159|ref|XP_002263731.1| PREDICTED: COP9 signalosome complex subunit 3 [Vitis vinifera] gi|296090247|emb|CBI40066.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224060219|ref|XP_002300091.1| predicted protein [Populus trichocarpa] gi|222847349|gb|EEE84896.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224141257|ref|XP_002323991.1| predicted protein [Populus trichocarpa] gi|222866993|gb|EEF04124.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511828|ref|XP_003524624.1| PREDICTED: COP9 signalosome complex subunit 3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356511830|ref|XP_003524625.1| PREDICTED: COP9 signalosome complex subunit 3-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356571399|ref|XP_003553864.1| PREDICTED: COP9 signalosome complex subunit 3-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356571401|ref|XP_003553865.1| PREDICTED: COP9 signalosome complex subunit 3-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449441398|ref|XP_004138469.1| PREDICTED: COP9 signalosome complex subunit 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449495275|ref|XP_004159785.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
TAIR|locus:2145638 429 COP13 "AT5G14250" [Arabidopsis 0.975 0.659 0.604 2.6e-86
ZFIN|ZDB-GENE-030131-7660 423 cops3 "COP9 constitutive photo 0.955 0.654 0.363 9.6e-41
UNIPROTKB|Q9UNS2 423 COPS3 "COP9 signalosome comple 0.955 0.654 0.360 1.6e-40
UNIPROTKB|F1SB16 423 COPS3 "Uncharacterized protein 0.955 0.654 0.356 2e-40
MGI|MGI:1349409 423 Cops3 "COP9 (constitutive phot 0.955 0.654 0.360 2e-40
RGD|1303002 423 Cops3 "COP9 signalosome subuni 0.955 0.654 0.360 2e-40
UNIPROTKB|Q5ZJF1 423 COPS3 "COP9 signalosome comple 0.955 0.654 0.360 2.6e-40
UNIPROTKB|A6H7B5 423 COPS3 "COP9 signalosome comple 0.955 0.654 0.356 3.3e-40
UNIPROTKB|E2RD70 423 COPS3 "Uncharacterized protein 0.955 0.654 0.356 6.8e-40
DICTYBASE|DDB_G0291848 418 csn3 "proteasome component reg 0.893 0.619 0.357 1.1e-37
TAIR|locus:2145638 COP13 "AT5G14250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 863 (308.9 bits), Expect = 2.6e-86, P = 2.6e-86
 Identities = 171/283 (60%), Positives = 213/283 (75%)

Query:     1 MQSIENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLY 60
             + S+E ++T IQGLS +  D++AL D L+ A+D LR+E     S LDQLD SKHSLGYLY
Sbjct:     5 VNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLY 64

Query:    61 FLEPCMYCSITKERANTLVPIIARFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIR 120
             FLE      ++KE+A   +PIIARFI SC A QIR    KF+++CK  KD V+ L  P+R
Sbjct:    65 FLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLR 124

Query:   121 GVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEINLPRDFFLYC 180
             GVGP+L A++K+Q S++ LT LHP+ LQLCL AK YK+G S+L DDI EI+ PRDFFLY 
Sbjct:   125 GVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYS 184

Query:   181 YYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTLPKY 240
             YYGGMI IG KRF+KALELL+NVVTAPM  +NAIA+EAYKKYILVSLIH+GQF++TLPK 
Sbjct:   185 YYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKC 244

Query:   241 TSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFE 283
              S+AAQR+ KN++ PY+EL N YN GKI ELE  V     +FE
Sbjct:   245 ASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFE 287
GO:0008180 "signalosome" evidence=TAS;IPI
GO:0009640 "photomorphogenesis" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010388 "cullin deneddylation" evidence=RCA;IMP
GO:0010971 "positive regulation of G2/M transition of mitotic cell cycle" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0009845 "seed germination" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009933 "meristem structural organization" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0019915 "lipid storage" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0050826 "response to freezing" evidence=RCA
GO:0051604 "protein maturation" evidence=RCA
ZFIN|ZDB-GENE-030131-7660 cops3 "COP9 constitutive photomorphogenic homolog subunit 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNS2 COPS3 "COP9 signalosome complex subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SB16 COPS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1349409 Cops3 "COP9 (constitutive photomorphogenic) homolog, subunit 3 (Arabidopsis thaliana)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303002 Cops3 "COP9 signalosome subunit 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJF1 COPS3 "COP9 signalosome complex subunit 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7B5 COPS3 "COP9 signalosome complex subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD70 COPS3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291848 csn3 "proteasome component region PCI (PINT) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 290
KOG2582 422 consensus COP9 signalosome, subunit CSN3 [Posttran 100.0
KOG2581 493 consensus 26S proteasome regulatory complex, subun 99.92
COG5600413 Transcription-associated recombination protein [DN 97.72
KOG2688394 consensus Transcription-associated recombination p 97.08
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.34
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.22
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.98
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.89
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.72
PF1337173 TPR_9: Tetratricopeptide repeat 95.68
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.6
PRK15359144 type III secretion system chaperone protein SscB; 95.48
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.18
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.08
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.04
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 94.88
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.83
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 94.76
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.71
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.29
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 93.67
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.58
PRK10803263 tol-pal system protein YbgF; Provisional 93.12
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 92.87
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 92.77
PRK10747398 putative protoheme IX biogenesis protein; Provisio 92.39
PRK10370198 formate-dependent nitrite reductase complex subuni 92.12
cd05804355 StaR_like StaR_like; a well-conserved protein foun 91.79
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.71
PRK12370553 invasion protein regulator; Provisional 91.38
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.31
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 90.78
PRK11788389 tetratricopeptide repeat protein; Provisional 90.73
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 90.65
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.47
PRK11788389 tetratricopeptide repeat protein; Provisional 90.37
PF12688120 TPR_5: Tetratrico peptide repeat 90.29
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 89.91
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 89.71
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 89.68
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 89.64
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 89.6
PRK11189296 lipoprotein NlpI; Provisional 89.52
TIGR02552135 LcrH_SycD type III secretion low calcium response 89.32
PRK15359144 type III secretion system chaperone protein SscB; 89.13
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 89.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 88.89
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 88.86
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 88.81
KOG2908 380 consensus 26S proteasome regulatory complex, subun 88.37
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 87.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 87.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 87.2
PRK02603172 photosystem I assembly protein Ycf3; Provisional 86.95
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 86.0
CHL00033168 ycf3 photosystem I assembly protein Ycf3 85.97
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 85.94
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 85.79
PF1342844 TPR_14: Tetratricopeptide repeat 85.74
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 85.7
CHL00033168 ycf3 photosystem I assembly protein Ycf3 85.37
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 85.32
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 85.01
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 84.82
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.67
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 83.81
PF09986214 DUF2225: Uncharacterized protein conserved in bact 82.93
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 82.84
PRK02603172 photosystem I assembly protein Ycf3; Provisional 82.45
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 82.18
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 81.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 81.48
PLN03077 857 Protein ECB2; Provisional 81.12
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 81.0
PRK15331165 chaperone protein SicA; Provisional 80.77
PRK11189296 lipoprotein NlpI; Provisional 80.54
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 80.3
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 80.09
PLN03077 857 Protein ECB2; Provisional 80.04
>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-64  Score=465.40  Aligned_cols=284  Identities=38%  Similarity=0.611  Sum_probs=276.0

Q ss_pred             HHHHHHHHHhhcCChhcHHHHHHHHHHhHHHHHhhhhhhhhhhhhcCcchhHHHHHHHHHHhhhcccchhhhhhHHHHHH
Q 022902            4 IENLVTQIQGLSSNASDITALKDYLKAAEDLLRSESTRLLSFLDQLDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIA   83 (290)
Q Consensus         4 l~~~~~~i~~~~~s~~~~~~L~~~l~~~~~~l~~~~~~~~~~L~~ldp~~~sl~~L~vL~a~~~~~~~~~~~~~l~~~v~   83 (290)
                      +++.+++++++++++ ++++|++.+.++.+.|++++++++++|.+|||.+||+||+|++.+++..+.++.+++++++++.
T Consensus         5 l~a~i~~~~~~~~~~-~~~eL~~~i~~~~ell~k~~~~~~~~L~~ld~~~hSlgml~~l~~~f~~~~~~~~~~~li~~~~   83 (422)
T KOG2582|consen    5 LEAAINELCSLSHSS-NVGELAELIVKSKELLAKNSSDLDAVLLHLDPQVHSLGMLAVLKVKFHTPSANPDPETLIELLN   83 (422)
T ss_pred             HHHHHHHHHhhhcCC-cHHHHHHHHHhhHHHHHhCcchHHHHHHhcCccccchhhhhhhhccccCcccCCCHHHHHHHHH
Confidence            688999999999999 9999999999999999999999999999999999999999999999988775558899999999


Q ss_pred             HHHhcCChhhhhhhhHhHHHHHHHHHHhHhhhccccccHHHHHHHHHhhCCCCCCchhhHHHHHHHHHHccCchhhhhcc
Q 022902           84 RFITSCSAEQIRYVPEKFINVCKRYKDQVLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVL  163 (290)
Q Consensus        84 ~fl~~f~~~Qlr~a~~~~~~l~~~~~~~~~~~~~p~~~i~~L~~Ai~r~~~~~~~LTs~H~~ll~lcL~ak~y~~Al~vl  163 (290)
                      +|+.++|.+|+|+++..|..+|+.+++.+.+.++|.+|++++.+|+.++.++..+||++|++++++||++|+|..++|.+
T Consensus        84 ~FV~~~n~eqlr~as~~f~~lc~~l~~~~~~~~~p~~gi~ii~~av~k~~~~~~qlT~~H~~l~~~~L~ak~y~~~~p~l  163 (422)
T KOG2582|consen   84 DFVDENNGEQLRLASEIFFPLCHDLTEAVVKKNKPLRGIRIIMQAVDKMQPSNGQLTSIHADLLQLCLEAKDYASVLPYL  163 (422)
T ss_pred             HHHHhcChHHHhhHHHHHHHHHHHHHHHHHhcCCccccchHHHHHHHHhccCccchhhhHHHHHHHHHHhhcccccCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccc------CCchhHHHHHHHHHHHHHHHhcHHHHHHHHHHhhccCccchhHHHHHHHHHHHHHHHHhcCCCCCCC
Q 022902          164 EDDIYEI------NLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAIAVEAYKKYILVSLIHHGQFSSTL  237 (290)
Q Consensus       164 ~~~i~~i------~~~~~~l~Y~yygG~i~~~~k~~~~A~~~l~~ais~P~~~~s~i~veAyKK~iLv~Ll~~G~~~~~l  237 (290)
                      |.+|.++      .+++++|.|+|||||||+++|||++|+.||++||++|++++++|+.||||||+||+||+.||+. .+
T Consensus       164 d~divei~~~n~h~~~k~fL~Y~yYgg~iciglk~fe~Al~~~e~~v~~Pa~~vs~~hlEaYkkylLvsLI~~GK~~-ql  242 (422)
T KOG2582|consen  164 DDDIVEICKANPHLDPKYFLLYLYYGGMICIGLKRFERALYLLEICVTTPAMAVSHIHLEAYKKYLLVSLILTGKVF-QL  242 (422)
T ss_pred             chhHHHHhccCCCCCHHHHHHHHHhcceeeeccccHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHhhhcCcee-ec
Confidence            9999999      4599999999999999999999999999999999999999999999999999999999999999 99


Q ss_pred             CCCCCHHHHHhhhhcchhHHHHHHHhcCCChHHHHHHHHHhHHhhhcccccc
Q 022902          238 PKYTSSAAQRNLKNFSQPYMELVNTYNTGKIVELETYVQTNREKFESVSYLL  289 (290)
Q Consensus       238 Pk~~s~~~~r~~k~~~~pY~~la~af~~~~~~~l~~~~~~~~~~f~~D~N~~  289 (290)
                      ||+||+.+.|.+|....||.+|+++|.++...+|+.+|.+|++.|.+|||+-
T Consensus       243 ~k~ts~~~~r~~K~ms~pY~ef~~~Y~~~~~~eLr~lVk~~~~rF~kDnnt~  294 (422)
T KOG2582|consen  243 PKNTSQNAGRFFKPMSNPYHEFLNVYLKDSSTELRTLVKKHSERFTKDNNTG  294 (422)
T ss_pred             cccchhhhHHhcccCCchHHHHHHHHhcCCcHHHHHHHHHHHHHHhhcCcHH
Confidence            9999999999999999999999999999999999999999999999999974

>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 65.3 bits (158), Expect = 6e-12
 Identities = 48/309 (15%), Positives = 97/309 (31%), Gaps = 66/309 (21%)

Query: 7   LVTQIQGLSSNASDI---------TALKDYLKAAEDLLRSESTRLL----SFLDQLDPSK 53
           L  + Q L                 +++D L   ++       +L     S L+ L+P++
Sbjct: 311 LDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAE 370

Query: 54  HSLGYLYFLEPCMYCSITKERANTLVPIIARFITSCS--AEQIRYVPEKFINVCKRYKDQ 111
           +   +          S+     +  +P I           + I+      +N   +Y   
Sbjct: 371 YRKMF-------DRLSVFPP--SAHIPTI----LLSLIWFDVIKSDVMVVVNKLHKYS-- 415

Query: 112 VLLLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKA-GLSVLEDDIY-- 168
            L+ + P      + +   +++   E+   LH   +    + K + +  L     D Y  
Sbjct: 416 -LVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFY 474

Query: 169 --------------EINLPRDFFLYCYYGGMIFIGQKRFRKALELLHNVVTAPMSSINAI 214
                          + L R  FL        F+ QK     +        A  S +N +
Sbjct: 475 SHIGHHLKNIEHPERMTLFRMVFL-----DFRFLEQK-----IRHDSTAWNASGSILNTL 524

Query: 215 A-VEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVN---TYNTGKIVE 270
             ++ YK YI  +   + +  + +  +     + NL      Y +L+          I E
Sbjct: 525 QQLKFYKPYICDNDPKYERLVNAILDFLPKIEE-NL--ICSKYTDLLRIALMAEDEAIFE 581

Query: 271 LETYVQTNR 279
            E + Q  R
Sbjct: 582 -EAHKQVQR 589
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 99.96
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 99.42
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 99.39
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 98.3
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 98.02
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.24
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.97
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.78
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.61
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.42
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.4
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.32
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.2
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.19
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.14
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.01
3k9i_A117 BH0479 protein; putative protein binding protein, 96.0
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.0
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.0
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.99
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.96
3q15_A378 PSP28, response regulator aspartate phosphatase H; 95.95
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 95.89
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 95.85
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.82
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.77
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.62
3u4t_A272 TPR repeat-containing protein; structural genomics 95.6
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.6
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.57
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 95.57
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 95.51
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 95.51
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 95.46
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 95.45
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.37
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 95.36
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.29
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.19
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.17
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 95.13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.12
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 95.07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 95.07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 94.92
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 94.9
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 94.87
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 94.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.84
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 94.84
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 94.76
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.74
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.72
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 94.71
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 94.7
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.66
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 94.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 94.65
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 94.62
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.6
3q15_A378 PSP28, response regulator aspartate phosphatase H; 94.51
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 94.49
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 94.45
3u4t_A272 TPR repeat-containing protein; structural genomics 94.44
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 94.36
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 94.2
4i17_A228 Hypothetical protein; TPR repeats protein, structu 94.18
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 94.09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 94.08
3u3w_A293 Transcriptional activator PLCR protein; ternary co 94.07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.0
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 93.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 93.89
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.79
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 93.74
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 93.71
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 93.69
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 93.67
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 93.61
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 93.6
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.59
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 93.52
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 93.47
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 93.46
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 93.42
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 93.4
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.37
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 93.19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 93.1
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 93.07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 93.04
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 92.97
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 92.97
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 92.9
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 92.75
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 92.73
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 92.72
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 92.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 92.65
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 92.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 92.53
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 92.47
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 92.47
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 92.43
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 92.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 92.25
4eqf_A365 PEX5-related protein; accessory protein, tetratric 92.22
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 92.19
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 92.17
3u3w_A293 Transcriptional activator PLCR protein; ternary co 92.15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 92.14
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 92.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 92.06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 92.05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 91.97
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 91.81
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 91.78
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 91.63
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 91.56
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 91.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 91.53
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 91.45
1pc2_A152 Mitochondria fission protein; unknown function; NM 91.02
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 90.84
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 90.55
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 90.52
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 90.41
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 90.21
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 90.14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 89.78
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 89.66
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 89.63
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 89.6
3k9i_A117 BH0479 protein; putative protein binding protein, 89.41
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 89.35
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 89.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 89.04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 89.03
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 88.9
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 88.59
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 87.87
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 87.82
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 87.76
2gw1_A 514 Mitochondrial precursor proteins import receptor; 87.72
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 87.32
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 87.19
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 86.97
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 86.82
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 85.57
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 85.53
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 85.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 85.34
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 84.93
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 84.8
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 84.39
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 82.78
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 82.56
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 82.46
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 81.99
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 81.92
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 81.86
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 80.16
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.96  E-value=2e-29  Score=246.97  Aligned_cols=230  Identities=12%  Similarity=0.079  Sum_probs=143.9

Q ss_pred             cCcchhHHHHHHHHHHhhhcccchhhhhhHHHHHH--HHHhcCChhhhhhhhHhHHHH---HHHHHHhHh----------
Q 022902           49 LDPSKHSLGYLYFLEPCMYCSITKERANTLVPIIA--RFITSCSAEQIRYVPEKFINV---CKRYKDQVL----------  113 (290)
Q Consensus        49 ldp~~~sl~~L~vL~a~~~~~~~~~~~~~l~~~v~--~fl~~f~~~Qlr~a~~~~~~l---~~~~~~~~~----------  113 (290)
                      +-||+..+.+|.++..+++.+... ++..+...++  +.+..+|++.++....+.+.+   +++....+.          
T Consensus       130 ~~pE~~~y~~lL~~i~L~d~k~~~-~~~~~~~~~~~~~~l~~~nrrtlD~l~ak~~fY~s~~~e~~~~~~~~~~~~~~~~  208 (523)
T 4b4t_S          130 VTAEINCFMHLLVQLFLWDSKELE-QLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNI  208 (523)
T ss_dssp             --------------------------------------------------------------------------CHHHHH
T ss_pred             CChHHHHHHHHHHHHHHhccccHH-HHHHHHHHHHHHHHHHHHhHHhHHHHHHHHHHHHHHHHHHhcccccccccccchh
Confidence            458899899999999888866543 5667777776  789999999999888765553   333322111          


Q ss_pred             hhccccccHHHHHHHHHhhCCCCCCchhhHHHHHHHHHHccCchhhhhcccccccccC--CchhHHHHHHHHHHHHHHHh
Q 022902          114 LLEAPIRGVGPMLTAIRKIQSSTEHLTTLHPEFLQLCLLAKCYKAGLSVLEDDIYEIN--LPRDFFLYCYYGGMIFIGQK  191 (290)
Q Consensus       114 ~~~~p~~~i~~L~~Ai~r~~~~~~~LTs~H~~ll~lcL~ak~y~~Al~vl~~~i~~i~--~~~~~l~Y~yygG~i~~~~k  191 (290)
                      .+++.  -+..+|+|++|+|+.+  -+++|++++|+||..+.|++|.+++++..+...  +.++.++|+||.|+|++.++
T Consensus       209 ~ir~~--Ll~~~rta~lr~D~~~--qa~l~nllLRnYL~~~~y~qA~~lvsk~~fP~~~~sn~q~~rY~YY~GRI~a~q~  284 (523)
T 4b4t_S          209 ILRST--MMKFLKIASLKHDNET--KAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQL  284 (523)
T ss_dssp             HHHTH--HHHHHHHCCSCSSSCH--HHHHHHHHHHHHHHSSCSTTHHHHHHHHCSCTTTSCHHHHHHHHHHHHHHHHHTT
T ss_pred             hHHHH--HHHHHHHHhcccCcch--hHHHHHHHHHHHHccCcHHHHHHHHhcCcCCcccCCHHHHHHHHHHHHHHHHHhc
Confidence            12222  2577999999999865  599999999999999999999999999876432  36788999999999999999


Q ss_pred             cHHHHHHHHHHhhc-cCcc-chhHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCHHHHHhhhhcchhHHHHHHHhcCCChH
Q 022902          192 RFRKALELLHNVVT-APMS-SINAIAVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKNFSQPYMELVNTYNTGKIV  269 (290)
Q Consensus       192 ~~~~A~~~l~~ais-~P~~-~~s~i~veAyKK~iLv~Ll~~G~~~~~lPk~~s~~~~r~~k~~~~pY~~la~af~~~~~~  269 (290)
                      +|.+|.++|+.|++ +|.+ ...++.++++|++|+|.||+ |++| +.+.++    +..++..+.||.+|++||+.||++
T Consensus       285 ~Y~eA~~~L~~A~rkap~~~~a~gfr~~a~K~lI~V~LLl-G~iP-~r~lf~----q~~l~~~L~pY~~Lv~Avr~GdL~  358 (523)
T 4b4t_S          285 DYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLM-GDIP-ELSFFH----QSNMQKSLLPYYHLTKAVKLGDLK  358 (523)
T ss_dssp             CHHHHHHHHHHHTSSCSCSSSCSHHHHHHHHHHHHHHHHH-TCCC-CHHHHT----TTSCHHHHHHHHHHHHHHHHTCHH
T ss_pred             cHHHHHHHHHHHHHhCCcchhhhhHHHHHHHHHHhHHhhc-CCCC-ChHHhh----chhHHHHHHHHHHHHHHHHcCCHH
Confidence            99999999999998 8876 56799999999999999886 9999 754443    344555789999999999999999


Q ss_pred             HHHHHHHHhHHhhhcccccc
Q 022902          270 ELETYVQTNREKFESVSYLL  289 (290)
Q Consensus       270 ~l~~~~~~~~~~f~~D~N~~  289 (290)
                      +|++++++|++.|.+|||+.
T Consensus       359 ~F~~~L~~h~~~F~~Dgty~  378 (523)
T 4b4t_S          359 KFTSTITKYKQLLLKDDTYQ  378 (523)
T ss_dssp             HHHHHHHHTHHHHHHTTCTH
T ss_pred             HHHHHHHHhcceeccCChhH
Confidence            99999999999999999974
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.76
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.2
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.02
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 95.9
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.78
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.73
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.48
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.25
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.16
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 94.95
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.49
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.16
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 93.89
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 93.4
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.3
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 92.53
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 92.29
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 92.02
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 91.77
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 91.53
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.17
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 91.01
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 90.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 90.46
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 90.42
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 89.43
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 88.93
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 88.66
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 88.61
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 88.2
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 84.32
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 84.11
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.76  E-value=0.0022  Score=54.75  Aligned_cols=170  Identities=9%  Similarity=-0.005  Sum_probs=102.6

Q ss_pred             HHHHhHhhhccccccHHHHHHHHHhhCCCC--CCchhhHHHHHHHHHH-ccCchhhhhcccccc--ccc-CCchhHHHHH
Q 022902          107 RYKDQVLLLEAPIRGVGPMLTAIRKIQSST--EHLTTLHPEFLQLCLL-AKCYKAGLSVLEDDI--YEI-NLPRDFFLYC  180 (290)
Q Consensus       107 ~~~~~~~~~~~p~~~i~~L~~Ai~r~~~~~--~~LTs~H~~ll~lcL~-ak~y~~Al~vl~~~i--~~i-~~~~~~l~Y~  180 (290)
                      .++.+....+.+..++..++.++.-+...+  ......+..+...+.. .+.|+.|+....+-+  ..- +.+.+....+
T Consensus        82 ~~g~~y~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~A~~l~~~~~~~~~~~~~~  161 (290)
T d1qqea_          82 EAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCF  161 (290)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHHHHhCCcHHHHHHHHHhhHHhhhcccchhHHHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHhcCchhhhhhHH
Confidence            334444456777788999999988764433  2233444555555555 489999999988753  222 2245567777


Q ss_pred             HHHHHHHHHHhcHHHHHHHHHHhhc-cCccchhHH-HHHHHHHHHHHHHHhcCCCCCCCCCCCCHHHHHhhhh-------
Q 022902          181 YYGGMIFIGQKRFRKALELLHNVVT-APMSSINAI-AVEAYKKYILVSLIHHGQFSSTLPKYTSSAAQRNLKN-------  251 (290)
Q Consensus       181 yygG~i~~~~k~~~~A~~~l~~ais-~P~~~~s~i-~veAyKK~iLv~Ll~~G~~~~~lPk~~s~~~~r~~k~-------  251 (290)
                      +-.|.+|..+++|++|.++|+.++. .|....... .-..+-...++ .+..|+.. ..    .....+..+.       
T Consensus       162 ~~la~~~~~~g~y~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~~~d~~-~A----~~~~~~~~~~~~~~~~s  235 (290)
T d1qqea_         162 IKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLC-QLAATDAV-AA----ARTLQEGQSEDPNFADS  235 (290)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHTTSSCTTTGGGHHHHHHHHHHH-HHHTTCHH-HH----HHHHHGGGCC-------
T ss_pred             HHHHHHHHHcChHHHHHHHHHHHHHhCccchhhhhhHHHHHHHHHHH-HHHhccHH-HH----HHHHHHHHHhCCCccch
Confidence            8889999999999999999999997 455422211 12223333333 34455543 21    1111221111       


Q ss_pred             -cchhHHHHHHHhcCCChHHHHHHHHHhHHhh
Q 022902          252 -FSQPYMELVNTYNTGKIVELETYVQTNREKF  282 (290)
Q Consensus       252 -~~~pY~~la~af~~~~~~~l~~~~~~~~~~f  282 (290)
                       ...-..++..++..+|.+++...+..+.+.-
T Consensus       236 re~~~l~~l~~a~~~~d~e~~~eai~~y~~~~  267 (290)
T d1qqea_         236 RESNFLKSLIDAVNEGDSEQLSEHCKEFDNFM  267 (290)
T ss_dssp             --HHHHHHHHHHHHTTCTTTHHHHHHHHTTSS
T ss_pred             HHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHh
Confidence             1123456788898999888887777654433
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure