Citrus Sinensis ID: 023166


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAVSASAVAGPGIGRAAGRGVPAAPLVQAQPGLAGPVRGVGGPAPGMMQPQISRPPIPQLSAPPMTYPATSGGPPVIRPPGQMPPPVYPGQGPPMARGPPPQGPPQGFGVRPPQQFPMPPQQFGQRPMVPPPPGPMMRGPPSGPPRPGMPNAPPPRPGMPPPPGAPVFRPGMPPPPPNAQQQQQNQQQQ
cccccHHHHHHccccEEEEEEEcccEEEEEEEHHcccccEEEccHHHHHcccccccccccccccccccccccEEEEEcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccHHHHHHHcccEEEEEEccccEEEEEEEEEcccccEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEEEEcHHHEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcc
msmsksskMLQFINYRMRVTIQDGRQLVGKFMAFdrhmnlvlgdceefrklppakgkknntneereDRRTLGLVLLRGEEvismtvegppppeesrakavsasavagpgigraagrgvpaaplvqaqpglagpvrgvggpapgmmqpqisrppipqlsappmtypatsggppvirppgqmpppvypgqgppmargpppqgppqgfgvrppqqfpmppqqfgqrpmvppppgpmmrgppsgpprpgmpnappprpgmppppgapvfrpgmpppppnaqqQQQNQQQQ
msmsksskMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDceefrklppakgkknntneeredrrtlglvllrgeevismtvegppppEESRAKAVSASAVAGPGIGRAAGRGVPAAPLVQAQPGLAGPVRGVGGPAPGMMQPQISRPPIPQLSAPPMTYPATSGGPPVIRPPGQMPPPVYPGQGPPMARGPPPQGPPQGFGVRPPQQFPMPPQQFGQRPMVPPPPGPMMRGPPSGPPRPGMPNAPPPRPGMPPPPGAPVFRPGMPPPPPNAQQQQQNQQQQ
MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRakavsasavagpgigraagrgvpaapLVQAQpglagpvrgvggpapgMMQPQISRPPIPQLSAPPMTYPATSGGPPVIRppgqmpppvypgqgppmargpppqgppqgfgvrppqqfpmppqqfgqrpmvppppgpmmrgppsgpprpgmpnappprpgmppppgapvfrpgmpppppnaqqqqqnqqqq
*********LQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEF**********************LGLVLLRGEEV*************************************************************************************************************************************************************************************************************
**********QFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEF*********************TLGLVLLRGEEVISM**********************************************************************************************************************************************************************************************************
********MLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPA*************RRTLGLVLLRGEEVISMT*****************SAVAGPGIGRAAGRGVPAAPLVQAQPGLAGPVRGVGGPAPGMMQPQISRPPIPQLSAPPMTYPATSGGPPVIRPPGQMPPPVYPGQGPPMARGPPPQGPPQGFGVRPPQQFPMPPQQFGQRPMVPPPPGPMMRGPPSGPPRPGMPNAPPPRPGMPPPPGAPVFRPGMPPP**************
*****SSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAVSAS***********GRGVPAAPLVQAQPGLAGPVRGVGGPAPGMMQPQISRPPIPQLSAPPMTYPATSGGPPVIRPPGQMPPPVYPGQGPPMARGPPPQGPPQGFGVRPPQQFPMPPQQFGQRPMVPPPPGPMMRGPPSGPPRPGMPNAPPPRPGMPPPPGAPVFRPGMPPPPPNAQ*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAVSASAVAGPGIGRAAGRGVPAAPLVQAQPGLAGPVRGVGGPAPGMMQPQISRPPIPQLSAPPMTYPATSGGPPVIRPPGQMPPPVYPGQGPPMARGPPPQGPPQGFGVRPPQQFPMPPQQFGQRPMVPPPPGPMMRGPPSGPPRPGMPNAPPPRPGMPPPPGAPVFRPGMPPPPPNAQQQQQNQQQQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q9N1Q0240 Small nuclear ribonucleop N/A no 0.503 0.6 0.617 6e-45
Q9PV94240 Small nuclear ribonucleop yes no 0.503 0.6 0.624 2e-37
P14678240 Small nuclear ribonucleop yes no 0.503 0.6 0.617 2e-37
Q9TU67240 Small nuclear ribonucleop N/A no 0.503 0.6 0.617 2e-37
P27048231 Small nuclear ribonucleop yes no 0.503 0.623 0.617 3e-37
Q58DW4240 Small nuclear ribonucleop yes no 0.503 0.6 0.617 3e-37
Q9TU66240 Small nuclear ribonucleop no no 0.503 0.6 0.610 3e-36
Q55A45274 Small nuclear ribonucleop yes no 0.451 0.470 0.571 1e-35
Q05856199 Small nuclear ribonucleop yes no 0.545 0.783 0.537 2e-33
Q10163147 Small nuclear ribonucleop yes no 0.437 0.850 0.489 2e-28
>sp|Q9N1Q0|RSMB_MACEU Small nuclear ribonucleoprotein-associated protein B' OS=Macropus eugenii GN=SNRPB PE=2 SV=1 Back     alignment and function desciption
 Score =  181 bits (458), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 112/149 (75%), Gaps = 5/149 (3%)

Query: 1   MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNN 60
           M++ KSSKMLQ I+YRMR  +QDGR  +G F AFD+HMNL+L DC+EFRK+ P    KN+
Sbjct: 1   MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKP----KNS 56

Query: 61  TNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAVSASAVAGPGIGRAAGRGVPA 120
              ERE++R LGLVLLRGE ++SMTVEGPPP +   A+   + A  GPGIGRAAGRGVPA
Sbjct: 57  KQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLSGAAGGPGIGRAAGRGVPA 116

Query: 121 -APLVQAQPGLAGPVRGVGGPAPGMMQPQ 148
             P+ QA  GLAGPVRGVGGP+  +M PQ
Sbjct: 117 GVPMPQAPAGLAGPVRGVGGPSQQVMTPQ 145




Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. May have a functional role in the pre-mRNA splicing or in snRNP structure. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
Macropus eugenii (taxid: 9315)
>sp|Q9PV94|RSMB_CHICK Small nuclear ribonucleoprotein-associated protein B' OS=Gallus gallus GN=SNRPB PE=2 SV=1 Back     alignment and function description
>sp|P14678|RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' OS=Homo sapiens GN=SNRPB PE=1 SV=2 Back     alignment and function description
>sp|Q9TU67|RSMB_ERIEU Small nuclear ribonucleoprotein-associated protein B' OS=Erinaceus europaeus GN=SNRPB PE=2 SV=1 Back     alignment and function description
>sp|P27048|RSMB_MOUSE Small nuclear ribonucleoprotein-associated protein B OS=Mus musculus GN=Snrpb PE=1 SV=1 Back     alignment and function description
>sp|Q58DW4|RSMB_BOVIN Small nuclear ribonucleoprotein-associated protein B' OS=Bos taurus GN=SNRPB PE=2 SV=1 Back     alignment and function description
>sp|Q9TU66|RSMB_MONDO Small nuclear ribonucleoprotein-associated protein B' OS=Monodelphis domestica GN=SNRPB PE=2 SV=1 Back     alignment and function description
>sp|Q55A45|RSMB_DICDI Small nuclear ribonucleoprotein-associated protein B OS=Dictyostelium discoideum GN=snrpb PE=3 SV=1 Back     alignment and function description
>sp|Q05856|RSMB_DROME Small nuclear ribonucleoprotein-associated protein B OS=Drosophila melanogaster GN=SmB PE=1 SV=1 Back     alignment and function description
>sp|Q10163|RSMB_SCHPO Small nuclear ribonucleoprotein-associated protein B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smb1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
255578055275 small nuclear ribonucleoprotein-associat 0.734 0.763 0.806 7e-85
255578051275 small nuclear ribonucleoprotein-associat 0.734 0.763 0.801 3e-84
357494377 394 Small nuclear ribonucleoprotein-associat 0.685 0.497 0.808 2e-81
224115254289 predicted protein [Populus trichocarpa] 0.793 0.785 0.846 7e-81
449433521284 PREDICTED: small nuclear ribonucleoprote 0.639 0.644 0.879 6e-80
356501499282 PREDICTED: small nuclear ribonucleoprote 0.618 0.627 0.872 2e-79
225463717276 PREDICTED: small nuclear ribonucleoprote 0.695 0.721 0.861 4e-79
118482995286 unknown [Populus trichocarpa] 0.902 0.902 0.816 4e-79
356553373281 PREDICTED: small nuclear ribonucleoprote 0.618 0.629 0.867 8e-79
224117856250 predicted protein [Populus trichocarpa] 0.618 0.708 0.892 3e-78
>gi|255578055|ref|XP_002529898.1| small nuclear ribonucleoprotein-associated protein, putative [Ricinus communis] gi|223530625|gb|EEF32501.1| small nuclear ribonucleoprotein-associated protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  319 bits (818), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 183/227 (80%), Positives = 188/227 (82%), Gaps = 17/227 (7%)

Query: 1   MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNN 60
           MSMSKSSKMLQ INYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNN
Sbjct: 1   MSMSKSSKMLQHINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNN 60

Query: 61  TNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAVSASAVAGPGIGRAAGRGVPA 120
             EEREDRRTLGLVLLRGEEVISMTVEGPPP EESRAKAVSA+AVAGPGIGRAAGRG+P 
Sbjct: 61  --EEREDRRTLGLVLLRGEEVISMTVEGPPPQEESRAKAVSATAVAGPGIGRAAGRGIPT 118

Query: 121 APLVQAQPGLAGPVRGVGGPAPGMMQPQISRPPIPQLSAPPMTYPATSGGPPVIRPPGQM 180
           APL+QAQPGLAGPVRGVGGPAPGMMQPQISRPP+PQLSAPPM+YP     PPVIRPPGQM
Sbjct: 119 APLIQAQPGLAGPVRGVGGPAPGMMQPQISRPPVPQLSAPPMSYP-----PPVIRPPGQM 173

Query: 181 PPPVYPGQGPPMARGPPPQGPPQGFGVRPP---QQFPM-PPQQFGQR 223
                               PP  FG RPP   Q FPM PP QFGQR
Sbjct: 174 ------AFPGQGPPPMGRGPPPPQFGARPPPPGQGFPMPPPPQFGQR 214




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255578051|ref|XP_002529896.1| small nuclear ribonucleoprotein-associated protein, putative [Ricinus communis] gi|223530623|gb|EEF32499.1| small nuclear ribonucleoprotein-associated protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357494377|ref|XP_003617477.1| Small nuclear ribonucleoprotein-associated protein B [Medicago truncatula] gi|355518812|gb|AET00436.1| Small nuclear ribonucleoprotein-associated protein B [Medicago truncatula] Back     alignment and taxonomy information
>gi|224115254|ref|XP_002332199.1| predicted protein [Populus trichocarpa] gi|222875306|gb|EEF12437.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449433521|ref|XP_004134546.1| PREDICTED: small nuclear ribonucleoprotein-associated protein B'-like [Cucumis sativus] gi|449490639|ref|XP_004158663.1| PREDICTED: small nuclear ribonucleoprotein-associated protein B'-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356501499|ref|XP_003519562.1| PREDICTED: small nuclear ribonucleoprotein-associated protein B'-like [Glycine max] Back     alignment and taxonomy information
>gi|225463717|ref|XP_002263359.1| PREDICTED: small nuclear ribonucleoprotein-associated protein B' [Vitis vinifera] gi|147774905|emb|CAN61706.1| hypothetical protein VITISV_001610 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118482995|gb|ABK93409.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553373|ref|XP_003545031.1| PREDICTED: small nuclear ribonucleoprotein-associated protein B'-like [Glycine max] Back     alignment and taxonomy information
>gi|224117856|ref|XP_002317685.1| predicted protein [Populus trichocarpa] gi|222860750|gb|EEE98297.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
TAIR|locus:2128610257 smB "small nuclear ribonucleop 0.587 0.653 0.680 1.9e-51
TAIR|locus:2163416254 AT5G44500 "AT5G44500" [Arabido 0.590 0.665 0.649 3.6e-50
UNIPROTKB|Q9PV94240 SNRPB "Small nuclear ribonucle 0.311 0.370 0.623 2e-32
ZFIN|ZDB-GENE-040426-1819239 snrpb "small nuclear ribonucle 0.311 0.372 0.623 2.5e-32
UNIPROTKB|P14678240 SNRPB "Small nuclear ribonucle 0.311 0.370 0.623 2.5e-32
UNIPROTKB|Q9TU67240 SNRPB "Small nuclear ribonucle 0.311 0.370 0.623 2.5e-32
UNIPROTKB|Q58DW4240 SNRPB "Small nuclear ribonucle 0.311 0.370 0.623 2.5e-32
UNIPROTKB|Q9N1Q0240 SNRPB "Small nuclear ribonucle 0.311 0.370 0.623 5.1e-32
UNIPROTKB|Q9TU66240 SNRPB "Small nuclear ribonucle 0.311 0.370 0.612 2.2e-31
FB|FBgn0262601199 SmB "Small ribonucleoprotein p 0.314 0.452 0.585 2.6e-30
TAIR|locus:2128610 smB "small nuclear ribonucleoprotein associated protein B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 534 (193.0 bits), Expect = 1.9e-51, P = 1.9e-51
 Identities = 117/172 (68%), Positives = 118/172 (68%)

Query:     1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNN 60
             MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKK  
Sbjct:     1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKK-- 58

Query:    61 TNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRXXXXXXXXXXXXXXXXXXXXXXXX 120
              NEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESR                        
Sbjct:    59 INEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAGSAAAVAGPGIGRAAGRGVPT 118

Query:   121 XXLVQAQXXXXXXXXXXXXXXXXMMQPQISRPPIPQLSAPPMTYPATSGGPP 172
               LVQAQ                MMQPQISRPP  QLSAPP+  P     PP
Sbjct:   119 GPLVQAQPGLSGPVRGVGGPAPGMMQPQISRPP--QLSAPPIIRPPGQMLPP 168




GO:0005634 "nucleus" evidence=ISM;ISS
GO:0005732 "small nucleolar ribonucleoprotein complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=TAS
GO:0005654 "nucleoplasm" evidence=IDA
GO:0015030 "Cajal body" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0001510 "RNA methylation" evidence=RCA
TAIR|locus:2163416 AT5G44500 "AT5G44500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PV94 SNRPB "Small nuclear ribonucleoprotein-associated protein B'" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1819 snrpb "small nuclear ribonucleoprotein polypeptides B and B1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P14678 SNRPB "Small nuclear ribonucleoprotein-associated proteins B and B'" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TU67 SNRPB "Small nuclear ribonucleoprotein-associated protein B'" [Erinaceus europaeus (taxid:9365)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DW4 SNRPB "Small nuclear ribonucleoprotein-associated protein B'" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9N1Q0 SNRPB "Small nuclear ribonucleoprotein-associated protein B'" [Macropus eugenii (taxid:9315)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TU66 SNRPB "Small nuclear ribonucleoprotein-associated protein B'" [Monodelphis domestica (taxid:13616)] Back     alignment and assigned GO terms
FB|FBgn0262601 SmB "Small ribonucleoprotein particle protein SmB" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
cd0171780 cd01717, Sm_B, Sm protein B 8e-58
smart0065167 smart00651, Sm, snRNP Sm proteins 4e-22
cd0616873 cd06168, LSMD1, LSM domain containing 1 6e-19
pfam0142366 pfam01423, LSM, LSM domain 6e-19
cd0060063 cd00600, Sm_like, Sm and related proteins 2e-18
COG195879 COG1958, LSM1, Small nuclear ribonucleoprotein (sn 7e-16
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-13
cd0172989 cd01729, LSm7, Like-Sm protein 7 3e-10
cd0173082 cd01730, LSm3, Like-Sm protein 3 3e-10
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-10
cd0173169 cd01731, archaeal_Sm1, archaeal Sm protein 1 6e-10
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-09
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-09
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-09
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-08
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-08
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-08
cd0172791 cd01727, LSm8, Like-Sm protein 8 3e-08
cd0171879 cd01718, Sm_E, Sm protein E 6e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-07
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-07
cd0172874 cd01728, LSm1, Like-Sm protein 1 5e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-06
PTZ0013889 PTZ00138, PTZ00138, small nuclear ribonucleoprotei 2e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-06
cd1167869 cd11678, archaeal_LSm, archaeal Like-Sm protein 3e-06
cd0172089 cd01720, Sm_D2, Sm protein D2 3e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-06
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-06
cd0171970 cd01719, Sm_G, Sm protein G 4e-06
pfam04652315 pfam04652, DUF605, Vta1 like 4e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-06
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 5e-06
cd0173963 cd01739, LSm11_M, Like-Sm protein 11, middle domai 8e-06
PRK0073772 PRK00737, PRK00737, small nuclear ribonucleoprotei 1e-05
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 2e-05
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-05
cd0173276 cd01732, LSm5, Like-Sm protein 5 5e-05
cd0172668 cd01726, LSm6, Like-Sm protein 6 6e-05
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 7e-05
cd0172269 cd01722, Sm_F, Sm protein F 7e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 9e-05
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-04
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 2e-04
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits ga 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-04
PRK06995 484 PRK06995, flhF, flagellar biosynthesis regulator F 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 5e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 5e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 5e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 6e-04
pfam04652315 pfam04652, DUF605, Vta1 like 7e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 8e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 9e-04
pfam04652315 pfam04652, DUF605, Vta1 like 0.001
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.001
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 0.001
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.002
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 0.002
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.002
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.002
PRK09111 598 PRK09111, PRK09111, DNA polymerase III subunits ga 0.002
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.002
pfam03153 332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.002
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 0.002
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.004
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.004
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.004
>gnl|CDD|212464 cd01717, Sm_B, Sm protein B Back     alignment and domain information
 Score =  179 bits (456), Expect = 8e-58
 Identities = 63/83 (75%), Positives = 71/83 (85%), Gaps = 3/83 (3%)

Query: 5  KSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEE 64
          KSSKMLQ+INYRMRVT+QDGRQ VG F+AFD+HMNLVL DCEEFRK+ P K KK    EE
Sbjct: 1  KSSKMLQYINYRMRVTLQDGRQFVGTFLAFDKHMNLVLSDCEEFRKIKPKKKKK---GEE 57

Query: 65 REDRRTLGLVLLRGEEVISMTVE 87
          RE++R LGLVLLRGE V+SMTVE
Sbjct: 58 REEKRVLGLVLLRGENVVSMTVE 80


The eukaryotic Sm proteins (B/B', D1, D2, D3, E, F and G) assemble into a hetero-heptameric ring around the Sm site of the 2,2,7-trimethyl guanosine (m3G) capped U1, U2, U4 and U5 snRNAs (Sm snRNAs) forming the core of the snRNP particle. The snRNP particle, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. Members of this family share a highly conserved Sm fold, containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 80

>gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins Back     alignment and domain information
>gnl|CDD|212486 cd06168, LSMD1, LSM domain containing 1 Back     alignment and domain information
>gnl|CDD|201787 pfam01423, LSM, LSM domain Back     alignment and domain information
>gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins Back     alignment and domain information
>gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|212476 cd01729, LSm7, Like-Sm protein 7 Back     alignment and domain information
>gnl|CDD|212477 cd01730, LSm3, Like-Sm protein 3 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 Back     alignment and domain information
>gnl|CDD|212465 cd01718, Sm_E, Sm protein E Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|212475 cd01728, LSm1, Like-Sm protein 1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|185472 PTZ00138, PTZ00138, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein Back     alignment and domain information
>gnl|CDD|212467 cd01720, Sm_D2, Sm protein D2 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|212466 cd01719, Sm_G, Sm protein G Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|212485 cd01739, LSm11_M, Like-Sm protein 11, middle domain Back     alignment and domain information
>gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|212479 cd01732, LSm5, Like-Sm protein 5 Back     alignment and domain information
>gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|212469 cd01722, Sm_F, Sm protein F Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG3168177 consensus U1 snRNP component [Transcription] 100.0
cd0171779 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins 99.92
cd0616875 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins 99.9
cd0172981 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins 99.87
cd0173082 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins 99.86
cd0172774 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins 99.86
cd0172874 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins 99.85
cd0171972 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins 99.84
cd0172087 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins 99.84
PRK0073772 small nuclear ribonucleoprotein; Provisional 99.83
cd0173168 archaeal_Sm1 The archaeal sm1 proteins: The Sm pro 99.83
cd0173276 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins 99.83
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 99.81
smart0065167 Sm snRNP Sm proteins. small nuclear ribonucleoprot 99.8
cd0172667 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins 99.8
cd0172268 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins 99.79
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 99.78
cd0171879 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins 99.77
COG195879 LSM1 Small nuclear ribonucleoprotein (snRNP) homol 99.76
PTZ0013889 small nuclear ribonucleoprotein; Provisional 99.7
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 99.67
KOG1781108 consensus Small Nuclear ribonucleoprotein splicing 99.66
cd0172376 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins 99.66
KOG178077 consensus Small Nuclear ribonucleoprotein G [RNA p 99.64
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 99.62
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 99.61
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 99.58
KOG346091 consensus Small nuclear ribonucleoprotein (snRNP) 99.58
KOG348279 consensus Small nuclear ribonucleoprotein (snRNP) 99.5
KOG178496 consensus Small Nuclear ribonucleoprotein splicing 99.43
KOG178377 consensus Small nuclear ribonucleoprotein F [RNA p 99.39
KOG1782129 consensus Small Nuclear ribonucleoprotein splicing 99.35
KOG177584 consensus U6 snRNA-associated Sm-like protein [RNA 99.19
KOG177488 consensus Small nuclear ribonucleoprotein E [RNA p 99.18
KOG3459114 consensus Small nuclear ribonucleoprotein (snRNP) 98.88
KOG3172119 consensus Small nuclear ribonucleoprotein Sm D3 [R 98.81
KOG3293134 consensus Small nuclear ribonucleoprotein (snRNP) 98.8
KOG344896 consensus Predicted snRNP core protein [RNA proces 98.8
KOG3428109 consensus Small nuclear ribonucleoprotein SMD1 and 98.6
cd0173966 LSm11_C The eukaryotic Sm and Sm-like (LSm) protei 98.5
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 97.65
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 97.57
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.53
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.22
PF0223748 BPL_C: Biotin protein ligase C terminal domain; In 96.58
PF1109580 Gemin7: Gem-associated protein 7 (Gemin7); InterPr 96.46
PF06372166 Gemin6: Gemin6 protein; InterPro: IPR009422 This f 96.41
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 96.37
KOG1073361 consensus Uncharacterized mRNA-associated protein 95.71
KOG3168177 consensus U1 snRNP component [Transcription] 95.15
PRK02001152 hypothetical protein; Validated 94.4
cd0173561 LSm12_N LSm12 belongs to a family of Sm-like prote 93.79
PRK14638150 hypothetical protein; Provisional 93.76
PF1084266 DUF2642: Protein of unknown function (DUF2642); In 93.41
PRK14639140 hypothetical protein; Provisional 93.19
cd0171661 Hfq Hfq, an abundant, ubiquitous RNA-binding prote 93.11
TIGR0238361 Hfq RNA chaperone Hfq. This model represents the R 93.06
PF03614165 Flag1_repress: Repressor of phase-1 flagellin; Int 92.52
PRK14644136 hypothetical protein; Provisional 92.04
PRK14640152 hypothetical protein; Provisional 91.44
cd0173483 YlxS_C YxlS is a Bacillus subtilis gene of unknown 91.4
PRK14636176 hypothetical protein; Provisional 91.01
PRK14642197 hypothetical protein; Provisional 90.97
PRK14633150 hypothetical protein; Provisional 90.92
PRK0039579 hfq RNA-binding protein Hfq; Provisional 90.88
PRK14632172 hypothetical protein; Provisional 90.46
PRK14646155 hypothetical protein; Provisional 89.64
PF0707380 ROF: Modulator of Rho-dependent transcription term 88.86
PRK14634155 hypothetical protein; Provisional 88.61
PRK14643164 hypothetical protein; Provisional 88.43
PRK14645154 hypothetical protein; Provisional 88.24
PF02576141 DUF150: Uncharacterised BCR, YhbC family COG0779; 88.14
COG0779153 Uncharacterized protein conserved in bacteria [Fun 87.88
PRK14647159 hypothetical protein; Provisional 87.09
PRK14637151 hypothetical protein; Provisional 86.88
PRK14631174 hypothetical protein; Provisional 85.84
PRK00092154 ribosome maturation protein RimP; Reviewed 85.44
PRK06955300 biotin--protein ligase; Provisional 85.29
PRK14641173 hypothetical protein; Provisional 83.27
COG0340238 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenz 83.22
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 81.9
PRK14091165 RNA-binding protein Hfq; Provisional 80.78
PRK11886319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 80.16
>KOG3168 consensus U1 snRNP component [Transcription] Back     alignment and domain information
Probab=100.00  E-value=1.4e-45  Score=320.35  Aligned_cols=148  Identities=64%  Similarity=1.088  Sum_probs=139.4

Q ss_pred             CCchhhhHHHHhcCCEEEEEEeCCcEEEEEEEEeccccceEeCceEEeecCCCCcCCCCCCcccccceeEeceEEecCce
Q 023166            1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEEREDRRTLGLVLLRGEE   80 (286)
Q Consensus         1 m~~~k~skL~qlIgkRVRVtLqDGR~fvGtLlAFDKhMNLVLsD~eE~r~ik~k~~kk~~~~~e~eekR~LGlVLIRGen   80 (286)
                      |+++|++||+++|||+++|+|+|||+|+|+|++||+||||||+|||||++++.++.|    ..+.||||.||||+|||||
T Consensus         1 M~~a~sskml~~iNyr~rv~~qDgr~~ig~~~afDkhmNlvl~dceE~r~~k~k~~~----~~~~eEkr~lgLvllRgen   76 (177)
T KOG3168|consen    1 MTVAKSSKMLQHINYRMRVRLQDGRTFIGQFKAFDKHMNLVLQDCEEFRKIKPKNRK----MTDGEEKRVLGLVLLRGEN   76 (177)
T ss_pred             CCccchhHHHHhhcceEEEEeccCceeechhhhhHHHHHHHHHHHHHHhcccccccc----ccccceeeEEEEEEecCCc
Confidence            899999999999999999999999999999999999999999999999998876653    3578999999999999999


Q ss_pred             eEEeeecCCCCChhhhhhhccccCCCCCCccccCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 023166           81 VISMTVEGPPPPEESRAKAVSASAVAGPGIGRAAGRGVPAAPLVQAQPGLAGPVRGVGGPAPGMMQPQISRPP  153 (286)
Q Consensus        81 IVSIsVe~PPp~d~~~~~~~~~~~~~Gpg~~r~aGRG~p~~~~~~~~~gL~gp~~gvggp~~~~m~p~~~~~~  153 (286)
                      |||++||++|+.|++.+++. +++..|+|++|.+||||+..++.+++.||+||++|||++++++|+|++++.+
T Consensus        77 Ivs~tVegppp~s~s~~~v~-ag~~~g~G~ar~~Grgip~~~~~~a~~gLtGp~rg~g~~a~~~~qp~g~g~p  148 (177)
T KOG3168|consen   77 IVSMTVEGPPPPSDSFRRVP-AGAARGPGIARVAGRGIPSGPLGQAPEGLTGPVRGVGGPAPQIMQPQGRGYP  148 (177)
T ss_pred             EEEEeccCCCCCcccccccc-ccccCCcccccccCCCccCCCcccCCCCCcCCccccCCCCccccCccccCCC
Confidence            99999999999999998887 8899999999999999998889999999999999999999999999987644



>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK00737 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences Back     alignment and domain information
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>smart00651 Sm snRNP Sm proteins Back     alignment and domain information
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>PTZ00138 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1781 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] Back     alignment and domain information
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1780 consensus Small Nuclear ribonucleoprotein G [RNA processing and modification] Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3460 consensus Small nuclear ribonucleoprotein (snRNP) LSM3 [RNA processing and modification] Back     alignment and domain information
>KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification] Back     alignment and domain information
>KOG1784 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1783 consensus Small nuclear ribonucleoprotein F [RNA processing and modification] Back     alignment and domain information
>KOG1782 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1775 consensus U6 snRNA-associated Sm-like protein [RNA processing and modification] Back     alignment and domain information
>KOG1774 consensus Small nuclear ribonucleoprotein E [RNA processing and modification] Back     alignment and domain information
>KOG3459 consensus Small nuclear ribonucleoprotein (snRNP) Sm core protein [RNA processing and modification] Back     alignment and domain information
>KOG3172 consensus Small nuclear ribonucleoprotein Sm D3 [RNA processing and modification] Back     alignment and domain information
>KOG3293 consensus Small nuclear ribonucleoprotein (snRNP) [RNA processing and modification] Back     alignment and domain information
>KOG3448 consensus Predicted snRNP core protein [RNA processing and modification] Back     alignment and domain information
>KOG3428 consensus Small nuclear ribonucleoprotein SMD1 and related snRNPs [RNA processing and modification] Back     alignment and domain information
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown Back     alignment and domain information
>PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins Back     alignment and domain information
>PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1073 consensus Uncharacterized mRNA-associated protein RAP55 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3168 consensus U1 snRNP component [Transcription] Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others Back     alignment and domain information
>TIGR02383 Hfq RNA chaperone Hfq Back     alignment and domain information
>PF03614 Flag1_repress: Repressor of phase-1 flagellin; InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella Back     alignment and domain information
>PRK14644 hypothetical protein; Provisional Back     alignment and domain information
>PRK14640 hypothetical protein; Provisional Back     alignment and domain information
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information
>PRK14636 hypothetical protein; Provisional Back     alignment and domain information
>PRK14642 hypothetical protein; Provisional Back     alignment and domain information
>PRK14633 hypothetical protein; Provisional Back     alignment and domain information
>PRK00395 hfq RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14632 hypothetical protein; Provisional Back     alignment and domain information
>PRK14646 hypothetical protein; Provisional Back     alignment and domain information
>PF07073 ROF: Modulator of Rho-dependent transcription termination (ROF); InterPro: IPR009778 This family consists of several bacterial modulator of Rho-dependent transcription termination (ROF) proteins Back     alignment and domain information
>PRK14634 hypothetical protein; Provisional Back     alignment and domain information
>PRK14643 hypothetical protein; Provisional Back     alignment and domain information
>PRK14645 hypothetical protein; Provisional Back     alignment and domain information
>PF02576 DUF150: Uncharacterised BCR, YhbC family COG0779; InterPro: IPR003728 The RimP protein facilitates maturation of the 30S ribsomal subunit, and is required for the efficient production of translationally competent ribosmomes [] Back     alignment and domain information
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14647 hypothetical protein; Provisional Back     alignment and domain information
>PRK14637 hypothetical protein; Provisional Back     alignment and domain information
>PRK14631 hypothetical protein; Provisional Back     alignment and domain information
>PRK00092 ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>PRK06955 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK14641 hypothetical protein; Provisional Back     alignment and domain information
>COG0340 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2y9a_A95 Structure Of The Spliceosomal U4 Snrnp Core Domain 7e-30
1d3b_B91 Crystal Structure Of The D3b Subcomplex Of The Huma 9e-30
3pgw_B231 Crystal Structure Of Human U1 Snrnp Length = 231 1e-29
3cw1_A174 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 2e-29
3swn_C117 Structure Of The Lsm657 Complex: An Assembly Interm 2e-04
>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain Length = 95 Back     alignment and structure

Iteration: 1

Score = 127 bits (319), Expect = 7e-30, Method: Compositional matrix adjust. Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 4/93 (4%) Query: 1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNN 60 M++ KSSKMLQ I+YRMR +QDGR +G F AFD+HMNL+L DC+EFRK+ P KN+ Sbjct: 1 MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKP----KNS 56 Query: 61 TNEEREDRRTLGLVLLRGEEVISMTVEGPPPPE 93 ERE++R LGLVLLRGE ++SMTVEGPPP + Sbjct: 57 KQAEREEKRVLGLVLLRGENLVSMTVEGPPPKD 89
>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human Core Snrnp Domain At 2.0a Resolution Length = 91 Back     alignment and structure
>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp Length = 231 Back     alignment and structure
>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 174 Back     alignment and structure
>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate Of The Lsm1 7 And Lsm2 8 Rings Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 2e-35
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 1e-21
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 1e-20
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 1e-19
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 4e-19
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 2e-18
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-18
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 3e-17
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 2e-16
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 9e-16
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 5e-15
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 1e-14
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-14
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-14
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-13
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-10
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 1e-07
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 1e-13
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 5e-13
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 2e-12
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 4e-11
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 6e-11
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 1e-10
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 1e-06
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-06
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-04
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-05
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-05
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 2e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 5e-05
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 4e-04
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 5e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-05
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
3tx7_B 352 Nuclear receptor subfamily 5 group A member 2; LRH 4e-04
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 4e-04
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 8e-04
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 4e-04
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-04
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 Back     alignment and structure
 Score =  121 bits (306), Expect = 2e-35
 Identities = 58/94 (61%), Positives = 73/94 (77%), Gaps = 4/94 (4%)

Query: 1  MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNN 60
          M++ KSSKMLQ I+YRMR  +QDGR  +G F AFD+HMNL+L DC+EFRK+ P    KN+
Sbjct: 1  MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKP----KNS 56

Query: 61 TNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEE 94
             ERE++R LGLVLLRGE ++SMTVEGPPP + 
Sbjct: 57 KQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDT 90


>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 100.0
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 99.94
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 99.88
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 99.86
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 99.86
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 99.86
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 99.86
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 99.86
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 99.86
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 99.85
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 99.85
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 99.84
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 99.84
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 99.84
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 99.84
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 99.82
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 99.82
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 99.82
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 99.81
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 99.8
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 99.8
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 99.77
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 99.76
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 99.72
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 98.77
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 97.42
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 97.27
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 96.38
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 96.11
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 94.8
2qtx_A71 Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi 94.5
1ycy_A71 Conserved hypothetical protein; structural genomic 94.02
1kq1_A77 HFQ, HOST factor for Q beta; hexamer, RNA binding 94.01
2ylb_A74 Protein HFQ; RNA-binding protein, LSM protein, RNA 93.94
3ahu_A78 Protein HFQ; SM-like motif, protein-RNA complex, t 93.77
3sb2_A79 Protein HFQ; SM-like, RNA chaperone, chaperone; 2. 92.99
2y90_A104 Protein HFQ; RNA-binding protein, SM-like, RNA cha 92.96
1u1s_A82 HFQ protein; SM-like bacterial protein, riken stru 92.5
3rux_A270 BIRA bifunctional protein; biotin-protein ligase, 90.42
1ib8_A164 Conserved protein SP14.3; nucleic acid binding pro 90.37
2rm4_A103 CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- 88.37
3hfn_A72 ASL2047 protein; HFQ, SM, RNA-binding protein, sRN 87.66
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 87.09
3hfo_A70 SSR3341 protein; HFQ, SM, RNA-binding protein, sRN 84.34
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 84.01
1bia_A321 BIRA bifunctional protein; transcription regulatio 83.9
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
Probab=100.00  E-value=4.1e-49  Score=357.10  Aligned_cols=189  Identities=57%  Similarity=0.998  Sum_probs=167.4

Q ss_pred             CCchhhhHHHHhcCCEEEEEEeCCcEEEEEEEEeccccceEeCceEEeecCCCCcCCCCCCcccccceeEeceEEecCce
Q 023166            1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEEREDRRTLGLVLLRGEE   80 (286)
Q Consensus         1 m~~~k~skL~qlIgkRVRVtLqDGR~fvGtLlAFDKhMNLVLsD~eE~r~ik~k~~kk~~~~~e~eekR~LGlVLIRGen   80 (286)
                      |+|+|+++|++||||+|+|+|+|||+|+|+|++||+||||||+||+||++++.|+++    +.+.+++|+||+|||||||
T Consensus         1 ~~v~k~~kL~klIdKrV~V~LkdGRel~GtLkgFDq~MNLVL~Da~E~~~ik~k~~k----~~~~~~~R~LGlV~IRGdn   76 (231)
T 3pgw_B            1 MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSK----QAEREEKRVLGLVLLRGEN   76 (231)
T ss_pred             CCcCchHHHHHhcCCeEEEEECCCcEEEEEEEEEcccccEEecCEEEEEeccCcccc----cccccceeEeceEEECCCc
Confidence            899999999999999999999999999999999999999999999999976554332    2356789999999999999


Q ss_pred             eEEeeecCCCCChhhhhhhccccCCCCCCccccCCCCCCC-CCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 023166           81 VISMTVEGPPPPEESRAKAVSASAVAGPGIGRAAGRGVPA-APLVQAQPGLAGPVRGVGGPAPGMMQPQISRPPIPQLSA  159 (286)
Q Consensus        81 IVSIsVe~PPp~d~~~~~~~~~~~~~Gpg~~r~aGRG~p~-~~~~~~~~gL~gp~~gvggp~~~~m~p~~~~~~~~~~~a  159 (286)
                      |++|++|+++++|+++.+++++++++|||++|+||||+++ .++++++.||+||++|||+|++++|+||++    ..+.+
T Consensus        77 IV~Isve~pPp~d~~~~~~~~~~~~~gpg~~~~agrg~~~~~~~~~~~~gl~gp~~g~g~p~~~~~~p~~~----~~~~~  152 (231)
T 3pgw_B           77 LVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGR----GTVAA  152 (231)
T ss_pred             EEEEEecCCCCCCcccccccccccCCCCcccccccCCCCccCCCCCCccccccccccccCCCcccccCCCc----ccccc
Confidence            9999999999999999888888899999999999999997 567889999999999999999999999985    46666


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 023166          160 PPMTYPATSGGPPVIRPPGQMPPPVYPGQGPPMARGPPPQGPPQ  203 (286)
Q Consensus       160 ~~~~~~~~~~~~p~~~ppg~~~~~~~~~~~p~~~~g~ppp~~~~  203 (286)
                      ......++.-+++..++++....+      ++++++++|++.|.
T Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~g~~~  190 (231)
T 3pgw_B          153 AAAAATASIAGAPTQYPPGRGGPP------PPMGRGAPPPGMMG  190 (231)
T ss_pred             cccccccccccCCcccCccccCCC------CccccCCCCCcccC
Confidence            666666666677888888877543      78999999999887



>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 Back     alignment and structure
>1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A Back     alignment and structure
>2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* Back     alignment and structure
>3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A Back     alignment and structure
>3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 Back     alignment and structure
>2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A Back     alignment and structure
>1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A Back     alignment and structure
>3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A Back     alignment and structure
>1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} SCOP: b.38.2.1 d.52.4.1 Back     alignment and structure
>2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} Back     alignment and structure
>3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1d3bb_81 b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa 1e-33
d2fwka192 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr 7e-23
d1b34b_93 b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s 5e-21
d1i8fa_71 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 1e-17
d1th7a176 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote 3e-17
d1mgqa_74 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 2e-16
d1h641_71 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 5e-16
d1ljoa_75 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 1e-15
d1n9ra_68 b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S 5e-14
d1i4k1_72 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 6e-14
d1m5q1_127 b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch 5e-09
d1d3ba_72 b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s 1e-06
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: B core SNRNP protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  115 bits (290), Expect = 1e-33
 Identities = 55/85 (64%), Positives = 67/85 (78%), Gaps = 4/85 (4%)

Query: 7  SKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEERE 66
          SKMLQ I+YRMR  +QDGR  +G F AFD+HMNL+L DC+EFRK+ P    KN+   ERE
Sbjct: 1  SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKP----KNSKQAERE 56

Query: 67 DRRTLGLVLLRGEEVISMTVEGPPP 91
          ++R LGLVLLRGE ++SMTVEGPPP
Sbjct: 57 EKRVLGLVLLRGENLVSMTVEGPPP 81


>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 99.95
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 99.88
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 99.87
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 99.85
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 99.84
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 99.84
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 99.83
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 99.82
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 99.8
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 99.78
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 99.74
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 99.63
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 99.54
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 97.38
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-t 96.57
d1ycya166 Hypothetical protein PF1955 {Pyrococcus furiosus [ 94.3
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcu 93.97
d1kq1a_60 Pleiotropic translational regulator Hfq {Staphyloc 90.75
d1u1sa166 Pleiotropic translational regulator Hfq {Pseudomon 87.11
d1sg5a186 Inhibitor of Rho Rof {Escherichia coli [TaxId: 562 83.27
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: B core SNRNP protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2.3e-28  Score=186.53  Aligned_cols=81  Identities=67%  Similarity=1.177  Sum_probs=72.0

Q ss_pred             hHHHHhcCCEEEEEEeCCcEEEEEEEEeccccceEeCceEEeecCCCCcCCCCCCcccccceeEeceEEecCceeEEeee
Q 023166            7 SKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNTNEEREDRRTLGLVLLRGEEVISMTV   86 (286)
Q Consensus         7 skL~qlIgkRVRVtLqDGR~fvGtLlAFDKhMNLVLsD~eE~r~ik~k~~kk~~~~~e~eekR~LGlVLIRGenIVSIsV   86 (286)
                      +||.+|||+||+|+|+|||+|+|+|+|||+||||||+||+|++....++.+    ..+.+++|.||++||||+||++|++
T Consensus         1 s~L~~~l~~rv~V~l~dgR~~~G~L~~~D~~~NlvL~~~~E~~~~~~~~~~----~~~~~~~r~lG~v~IRG~~Iv~i~~   76 (81)
T d1d3bb_           1 SKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSK----QAEREEKRVLGLVLLRGENLVSMTV   76 (81)
T ss_dssp             CCCGGGTTSEEEEEETTCCEEEEEEEECCTTCCEEEEEEEEEEEECCSSTT----SCCEEEEEEEEEEEECGGGEEEEEE
T ss_pred             ChhHHHCCCEEEEEEcCCCEEEEEEEEECCccCEEEcCEEEEEeecCcccc----ccccceEEEeeeEEEeCCEEEEEEc
Confidence            479999999999999999999999999999999999999999876554332    2346678999999999999999999


Q ss_pred             cCCCC
Q 023166           87 EGPPP   91 (286)
Q Consensus        87 e~PPp   91 (286)
                      +++||
T Consensus        77 ~~~pp   81 (81)
T d1d3bb_          77 EGPPP   81 (81)
T ss_dssp             EECCC
T ss_pred             cCCCC
Confidence            99876



>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sg5a1 b.137.1.2 (A:1-86) Inhibitor of Rho Rof {Escherichia coli [TaxId: 562]} Back     information, alignment and structure