Citrus Sinensis ID: 023196
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| 224112575 | 293 | predicted protein [Populus trichocarpa] | 0.979 | 0.955 | 0.663 | 1e-104 | |
| 225466356 | 284 | PREDICTED: uncharacterized protein LOC10 | 0.951 | 0.957 | 0.655 | 1e-102 | |
| 255579140 | 288 | DNA binding protein, putative [Ricinus c | 0.972 | 0.965 | 0.650 | 6e-99 | |
| 351723575 | 306 | MYB transcription factor MYB75 [Glycine | 0.989 | 0.924 | 0.633 | 8e-99 | |
| 224098517 | 284 | predicted protein [Populus trichocarpa] | 0.923 | 0.929 | 0.662 | 4e-97 | |
| 449465027 | 295 | PREDICTED: transcription factor DIVARICA | 0.989 | 0.959 | 0.606 | 3e-92 | |
| 356539935 | 299 | PREDICTED: uncharacterized protein LOC10 | 0.958 | 0.916 | 0.615 | 2e-90 | |
| 356568642 | 299 | PREDICTED: uncharacterized protein LOC10 | 0.972 | 0.929 | 0.610 | 2e-89 | |
| 224059326 | 302 | predicted protein [Populus trichocarpa] | 0.965 | 0.913 | 0.595 | 6e-88 | |
| 225434676 | 307 | PREDICTED: uncharacterized protein LOC10 | 0.989 | 0.921 | 0.576 | 5e-87 |
| >gi|224112575|ref|XP_002316232.1| predicted protein [Populus trichocarpa] gi|222865272|gb|EEF02403.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 385 bits (990), Expect = e-104, Method: Compositional matrix adjust.
Identities = 191/288 (66%), Positives = 229/288 (79%), Gaps = 8/288 (2%)
Query: 1 METLYPASYMSNSSNWFLQESSRSTSWTKEENKRFESALAIYSESTPDRWIKVAAMIPGK 60
METL P+ YMSNS NWF Q +T WT+EENK FE ALAI+ E PDRW+KVAAMIPGK
Sbjct: 1 METLNPSWYMSNS-NWFTQ----TTEWTREENKEFEIALAIFDEHEPDRWLKVAAMIPGK 55
Query: 61 TVLDVIKQYKELEEDVSDIEAGRVPIPGYLSSSFTLELVSESDYDANRKRTLVAKSSDHE 120
TV DVIKQYKELEEDVSDIEAGRVP+PGYLSSSFT +LV S++DA RKR+L AKS+D +
Sbjct: 56 TVYDVIKQYKELEEDVSDIEAGRVPVPGYLSSSFTFQLVGNSNFDAYRKRSLTAKSADQQ 115
Query: 121 RKKGVPWTEEEHKRFLMGLIKYGKGDWRNISRNYVISKTPTQVASHAQKYFIR-QLSGGK 179
RKKGVPWTE+EH+RFLMGL+K+GKGDWRNISRN+V+SKTPTQVASHAQKYFIR QLSG K
Sbjct: 116 RKKGVPWTEDEHRRFLMGLLKHGKGDWRNISRNFVVSKTPTQVASHAQKYFIRQQLSGVK 175
Query: 180 DKRRPSIHDITTGNLTNSVS-SDNHKPSSFDQSNVIPAQQKSLGTPKVGLEWTDSNNGEV 238
DKRRPSIHDITT NL ++ + SD +PSS DQS+++ +QQK G KV ++W ++ +G +
Sbjct: 176 DKRRPSIHDITTVNLADATTPSDGDEPSSLDQSDLLLSQQKPAGMQKVLIDWDEAKDGSI 235
Query: 239 MASDSTQSNMLMPSAFEFGSHGLKLQGQNLYATTAYHGAHVKPRNPFF 286
M DST ++ S +E S+GLK QGQNL A+HGA + P N F
Sbjct: 236 MVFDSTHEDLFKSSPYEIPSNGLKFQGQNL-CVGAHHGARINPHNMVF 282
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225466356|ref|XP_002275014.1| PREDICTED: uncharacterized protein LOC100255200 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255579140|ref|XP_002530418.1| DNA binding protein, putative [Ricinus communis] gi|223530067|gb|EEF31988.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351723575|ref|NP_001235748.1| MYB transcription factor MYB75 [Glycine max] gi|110931672|gb|ABH02835.1| MYB transcription factor MYB75 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224098517|ref|XP_002311203.1| predicted protein [Populus trichocarpa] gi|222851023|gb|EEE88570.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449465027|ref|XP_004150230.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus] gi|56605378|emb|CAI30890.1| somatic embryogenesis MYB 1 transcription factor [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356539935|ref|XP_003538448.1| PREDICTED: uncharacterized protein LOC100788982 isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356568642|ref|XP_003552519.1| PREDICTED: uncharacterized protein LOC100783469 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224059326|ref|XP_002299827.1| predicted protein [Populus trichocarpa] gi|222847085|gb|EEE84632.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225434676|ref|XP_002280403.1| PREDICTED: uncharacterized protein LOC100244960 [Vitis vinifera] gi|147844863|emb|CAN81229.1| hypothetical protein VITISV_033664 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| UNIPROTKB|Q8S9H7 | 307 | DIVARICATA "Transcription fact | 0.933 | 0.869 | 0.560 | 3.1e-76 | |
| TAIR|locus:2074723 | 263 | AT3G11280 [Arabidopsis thalian | 0.895 | 0.973 | 0.564 | 2e-72 | |
| TAIR|locus:2166459 | 277 | AT5G05790 [Arabidopsis thalian | 0.909 | 0.938 | 0.555 | 4.3e-70 | |
| TAIR|locus:2042872 | 298 | AT2G38090 [Arabidopsis thalian | 0.699 | 0.671 | 0.616 | 4e-67 | |
| TAIR|locus:2154508 | 288 | AT5G58900 [Arabidopsis thalian | 0.839 | 0.833 | 0.520 | 6e-64 | |
| TAIR|locus:2150149 | 267 | AT5G01200 [Arabidopsis thalian | 0.290 | 0.310 | 0.722 | 8.8e-55 | |
| TAIR|locus:2028461 | 314 | AT1G49010 [Arabidopsis thalian | 0.311 | 0.283 | 0.644 | 4.1e-43 | |
| TAIR|locus:2159607 | 298 | AT5G08520 [Arabidopsis thalian | 0.615 | 0.590 | 0.481 | 8.5e-43 | |
| TAIR|locus:2175478 | 215 | AT5G04760 [Arabidopsis thalian | 0.674 | 0.897 | 0.439 | 3.6e-41 | |
| TAIR|locus:2171711 | 337 | AT5G23650 [Arabidopsis thalian | 0.671 | 0.569 | 0.443 | 1e-36 |
| UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] | Back alignment and assigned GO terms |
|---|
Score = 768 (275.4 bits), Expect = 3.1e-76, P = 3.1e-76
Identities = 157/280 (56%), Positives = 196/280 (70%)
Query: 1 METLYPASYMSNSSNWFLQESSRSTSWTKEENKRFESALAIYSESTPDRWIKVAAMIPGK 60
ME L P+SY S+SS WFL+ES +T WT ENK FE+ALA++ E+TP+RW +VA +PGK
Sbjct: 1 MEILAPSSYFSSSS-WFLEESRSTTRWTAAENKAFENALAVFDENTPNRWERVAERVPGK 59
Query: 61 TVLDVIKQYKELEEDVSDIEAGRVPIPGYLSSS-FTLELVS-------ESDYDANRKRTL 112
TV DV++QYKELE+DVS IEAG VP+PGY +SS FTLE S + Y +++
Sbjct: 60 TVGDVMRQYKELEDDVSSIEAGFVPVPGYSTSSPFTLEWGSGHGFDGFKQSYGTGGRKSS 119
Query: 113 VAKSSDHERKKGVPWTEEEHKRFLMGLIKYGKGDWRNISRNYVISKTPTQVASHAQKYFI 172
+ S+ ERKKGVPWTEEEHK FLMGL KYGKGDWRNISRN+VI++TPTQVASHAQKYFI
Sbjct: 120 SGRPSEQERKKGVPWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKYFI 179
Query: 173 RQLSGGKDKRRPSIHDITTGNLTNSV--SSDNHKPSSFDQSNVIPAQQKSLGTPKVGLEW 230
RQLSGGKDKRR SIHDITT NL+++ S DN KP S ++ Q S K+ +W
Sbjct: 180 RQLSGGKDKRRASIHDITTVNLSDNQTPSPDNKKPPSSPDHSMAQQQTSSTSIHKLPFQW 239
Query: 231 TDSNNGEVM--ASDSTQSNMLMPSAFEFGSHGLKLQGQNL 268
++N +M AS NM + F S+G K+QGQ +
Sbjct: 240 DQTSNETIMGFASSGHHGNMFQSNPFGMNSYGFKMQGQQM 279
|
|
| TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150149 AT5G01200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028461 AT1G49010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159607 AT5G08520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175478 AT5G04760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171711 AT5G23650 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 7e-16 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 5e-09 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 3e-08 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 4e-08 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-05 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 2e-05 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 4e-04 | |
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 0.001 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 70.1 bits (172), Expect = 7e-16
Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
Query: 122 KKGVPWTEEEHKRFLMGLIKYGKGDW---RNISRNYVISK-TPTQVASHAQKYFIRQ 174
K V WTE+ H RFL + K G DW + I V+ T QVASH QKY ++Q
Sbjct: 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.86 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.84 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.79 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 99.51 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.5 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.49 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.46 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.45 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.26 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.24 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.17 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.14 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.0 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.99 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.88 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.88 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 98.77 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 98.76 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.74 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.69 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.61 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 98.32 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.78 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 97.64 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.61 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 97.6 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.51 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.44 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.34 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 97.12 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.1 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 96.85 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 96.81 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 96.75 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.27 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 96.26 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 96.17 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 96.1 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 95.71 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.21 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 94.94 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 94.22 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 93.73 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 93.7 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 93.68 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 93.18 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 92.25 | |
| KOG1878 | 1672 | consensus Nuclear receptor coregulator SMRT/SMRTER | 91.48 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 91.41 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 90.79 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 90.16 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 90.13 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 89.96 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 89.21 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 89.02 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 87.65 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 87.59 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 87.0 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 86.45 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 83.64 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 81.12 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 80.35 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 80.15 |
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Probab=99.86 E-value=2.5e-21 Score=177.18 Aligned_cols=103 Identities=17% Similarity=0.217 Sum_probs=91.3
Q ss_pred CCCCCCHHHHHHHHHHHHHhCCCCCchhHHHhhhC-CCCCHHHHHHHHHHhhhhhhhhccCCCCCCCCCCCcchhhhccc
Q 023196 23 RSTSWTKEENKRFESALAIYSESTPDRWIKVAAMI-PGKTVLDVIKQYKELEEDVSDIEAGRVPIPGYLSSSFTLELVSE 101 (286)
Q Consensus 23 ~~~~WT~EEdk~Le~Ala~~~~~tpdRW~kIAa~v-PGRT~~QV~~rYk~L~~dv~~IE~G~v~~P~y~~~~f~l~~~~~ 101 (286)
+.+.||+|||++|.++|++|+.. +|..||..+ ++||.+||++||.+.+. |..
T Consensus 24 KRg~WT~EEDe~L~~lV~kyG~~---nW~~IAk~~g~gRT~KQCReRW~N~L~------------P~I------------ 76 (249)
T PLN03212 24 KRGPWTVEEDEILVSFIKKEGEG---RWRSLPKRAGLLRCGKSCRLRWMNYLR------------PSV------------ 76 (249)
T ss_pred cCCCCCHHHHHHHHHHHHHhCcc---cHHHHHHhhhcCCCcchHHHHHHHhhc------------hhc------------
Confidence 66789999999999999999854 699999988 59999999999998775 221
Q ss_pred ccchhhhhhhcccccccccCccCCCCCHHHHHHHHHHHHHhCCCchhcchhhhcCCCCHHHHHHHHHHHHHHHh
Q 023196 102 SDYDANRKRTLVAKSSDHERKKGVPWTEEEHKRFLMGLIKYGKGDWRNISRNYVISKTPTQVASHAQKYFIRQL 175 (286)
Q Consensus 102 ~~~dg~~kr~~~~r~~~qerkKg~pWT~EEd~lll~gl~kyG~g~W~~IA~~~V~tRT~~Q~~sh~qky~~r~~ 175 (286)
+.++||+|||++|++++.+||. +|..||+ +|++||..||++||..++++..
T Consensus 77 ---------------------~kgpWT~EED~lLlel~~~~Gn-KWs~IAk-~LpGRTDnqIKNRWns~LrK~l 127 (249)
T PLN03212 77 ---------------------KRGGITSDEEDLILRLHRLLGN-RWSLIAG-RIPGRTDNEIKNYWNTHLRKKL 127 (249)
T ss_pred ---------------------ccCCCChHHHHHHHHHHHhccc-cHHHHHh-hcCCCCHHHHHHHHHHHHhHHH
Confidence 2369999999999999999998 9999997 9999999999999988877653
|
|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG1878 consensus Nuclear receptor coregulator SMRT/SMRTER, contains Myb-like domains [Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 286 | ||||
| 2cjj_A | 93 | Crystal Structure Of The Myb Domain Of The Rad Tran | 4e-13 | ||
| 2m2e_A | 73 | Solution Nmr Structure Of The Sant Domain Of Human | 3e-08 | ||
| 4eef_G | 74 | Crystal Structure Of The Designed Inhibitor Protein | 3e-04 | ||
| 2cu7_A | 72 | Solution Structure Of The Sant Domain Of Human Kiaa | 4e-04 |
| >pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 | Back alignment and structure |
|
| >pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 | Back alignment and structure |
| >pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 | Back alignment and structure |
| >pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 5e-34 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 2e-26 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 2e-05 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 3e-22 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 5e-04 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 8e-21 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 8e-05 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 4e-20 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 2e-07 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 1e-14 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 2e-14 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 2e-12 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 4e-12 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 2e-05 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 1e-09 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 1e-06 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 2e-09 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 2e-07 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 3e-07 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 5e-07 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 5e-06 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 3e-05 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 6e-06 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 9e-06 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 4e-05 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 8e-05 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 9e-05 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 9e-05 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 1e-04 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 1e-04 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 2e-04 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 5e-04 |
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
Score = 118 bits (297), Expect = 5e-34
Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 6/94 (6%)
Query: 19 QESSRSTSWTKEENKRFESALAIYSESTPDRWIKVAAMIPGKTVLDVIKQYKELEEDVSD 78
W+ +ENK FE ALA+Y + TPDRW VA + G+T +V K Y+ L ED+
Sbjct: 3 STRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKY 62
Query: 79 IEAGRVPIPGYLSSSFTLELVSESDYDANRKRTL 112
IE+G+VP P Y ++ D R R L
Sbjct: 63 IESGKVPFPNYRTTGGN------MKTDEKRFRNL 90
|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.93 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.93 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.92 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.92 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.91 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.88 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.88 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.81 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.8 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.72 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.66 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.64 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.63 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.59 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.54 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.54 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.53 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.53 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 99.52 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.5 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.48 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.48 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.47 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.47 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.45 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.44 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.41 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.39 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.38 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.37 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.36 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.35 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.34 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.01 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.32 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.3 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.29 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.28 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 99.28 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.26 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.26 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.25 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.25 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.24 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.24 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.21 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.21 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.21 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.21 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.19 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.18 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.15 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.15 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.15 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.14 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.13 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.11 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.08 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.08 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.07 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 99.01 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.98 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.95 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.93 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.92 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.85 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.3 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.79 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.78 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.73 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.64 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.59 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 98.57 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.52 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.5 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 98.46 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.46 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.44 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 98.0 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.85 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.81 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.81 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.67 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.52 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.52 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.35 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.44 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 96.39 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 97.19 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.7 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.68 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.6 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.36 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 95.86 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 95.48 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 92.82 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 90.16 |
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
Probab=99.93 E-value=9.8e-26 Score=180.94 Aligned_cols=102 Identities=16% Similarity=0.426 Sum_probs=91.2
Q ss_pred CCCCHHHHHHHHHHHHHhCCCCCchhHHHhhhCCCCCHHHHHHHHHHhhhhhhhhccCCCCCCCCCCCcchhhhcccccc
Q 023196 25 TSWTKEENKRFESALAIYSESTPDRWIKVAAMIPGKTVLDVIKQYKELEEDVSDIEAGRVPIPGYLSSSFTLELVSESDY 104 (286)
Q Consensus 25 ~~WT~EEdk~Le~Ala~~~~~tpdRW~kIAa~vPGRT~~QV~~rYk~L~~dv~~IE~G~v~~P~y~~~~f~l~~~~~~~~ 104 (286)
+.||+|||++|..+|..|+.. +|..||..|||||..||++||...++ |..
T Consensus 2 ~~Wt~eED~~L~~~v~~~g~~---~W~~Ia~~~~~Rt~~qcr~Rw~~~L~------------p~i--------------- 51 (107)
T 2k9n_A 2 VKFTEEEDLKLQQLVMRYGAK---DWIRISQLMITRNPRQCRERWNNYIN------------PAL--------------- 51 (107)
T ss_dssp CSSCHHHHHHHHHHHHHHCSS---CHHHHHHHTTTSCHHHHHHHHHHHSS------------SCC---------------
T ss_pred CCCCHHHHHHHHHHHHHHCCC---CHHHHhhhcCCCCHHHHHHHHHHHHc------------ccc---------------
Confidence 679999999999999999964 59999999999999999999998764 211
Q ss_pred hhhhhhhcccccccccCccCCCCCHHHHHHHHHHHHHhCCCchhcchhhhcCCCCHHHHHHHHHHHHHHHhc
Q 023196 105 DANRKRTLVAKSSDHERKKGVPWTEEEHKRFLMGLIKYGKGDWRNISRNYVISKTPTQVASHAQKYFIRQLS 176 (286)
Q Consensus 105 dg~~kr~~~~r~~~qerkKg~pWT~EEd~lll~gl~kyG~g~W~~IA~~~V~tRT~~Q~~sh~qky~~r~~s 176 (286)
+.++||+|||.+|+.++.+||. +|..||+ +|++||+.||++||..++++...
T Consensus 52 ------------------~~~~WT~eEd~~L~~~~~~~G~-~W~~Ia~-~l~gRt~~~~k~rw~~l~r~~~~ 103 (107)
T 2k9n_A 52 ------------------RTDPWSPEEDMLLDQKYAEYGP-KWNKISK-FLKNRSDNNIRNRWMMIARHRAK 103 (107)
T ss_dssp ------------------TTCCCCHHHHHHHHHHHHHTCS-CHHHHHH-HHSSSCHHHHHHHHHHHHHHHHS
T ss_pred ------------------cccccCHHHHHHHHHHHHHhCc-CHHHHHH-HCCCCCHHHHHHHHHHHHhhHHH
Confidence 2369999999999999999998 9999996 99999999999999988888654
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 286 | ||||
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 9e-20 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 3e-06 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 3e-16 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 2e-06 | |
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 8e-16 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 3e-13 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 0.004 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 6e-09 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 8e-09 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 4e-04 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 5e-08 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 6e-05 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 7e-08 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 2e-07 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 0.001 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 1e-05 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 2e-05 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 0.003 | |
| d1ofcx1 | 52 | a.4.1.3 (X:799-850) SANT domain of the nucleosome | 0.004 |
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: DnaJ homolog subfamily C member 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 78.7 bits (194), Expect = 9e-20
Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 2/61 (3%)
Query: 24 STSWTKEENKRFESALAIYSESTPDRWIKVAAMIPGKTVLDVIKQYKELEEDVSDIEAGR 83
+ WT+E+ + ++ + TP RW K+A + G++V DV + K+L++ V+ G
Sbjct: 1 APEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL-GRSVTDVTTKAKQLKDSVT-CSPGM 58
Query: 84 V 84
V
Sbjct: 59 V 59
|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 52 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.78 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.63 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.6 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.54 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.52 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.52 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.5 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.49 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.41 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.4 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.39 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.36 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.32 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.31 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.3 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.28 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.27 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.26 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.24 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.21 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.18 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.17 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.17 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 99.14 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.1 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.08 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.05 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.04 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.95 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.95 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.62 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.62 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.57 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 98.12 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.09 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 96.76 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.56 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 96.24 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 95.12 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 94.32 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 94.11 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 94.11 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 89.51 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 87.8 |
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Radialis species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.78 E-value=1.2e-19 Score=131.71 Aligned_cols=63 Identities=48% Similarity=0.862 Sum_probs=60.3
Q ss_pred CCCCCHHHHHHHHHHHHHhCCCCCchhHHHhhhCCCCCHHHHHHHHHHhhhhhhhhccCCCCC
Q 023196 24 STSWTKEENKRFESALAIYSESTPDRWIKVAAMIPGKTVLDVIKQYKELEEDVSDIEAGRVPI 86 (286)
Q Consensus 24 ~~~WT~EEdk~Le~Ala~~~~~tpdRW~kIAa~vPGRT~~QV~~rYk~L~~dv~~IE~G~v~~ 86 (286)
+.+||.|||++|++||+.|+.+.+++|.+||.+|||||..||++||+.|+.|+..||+|.||+
T Consensus 1 G~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf 63 (63)
T d2cjja1 1 GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF 63 (63)
T ss_dssp CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred CcCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence 368999999999999999999999999999999999999999999999999999999999874
|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|